254780303

254780303

DNA protecting protein DprA

GeneID in NCBI database:8209285Locus tag:CLIBASIA_00940
Protein GI in NCBI database:254780303Protein Accession:YP_003064716.1
Gene range:+(193546, 193779)Protein Length:77aa
Gene description:DNA protecting protein DprA
COG prediction:[L] [U] Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake
KEGG prediction:DNA protecting protein DprA
SEED prediction:putative smf protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70-------
MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGAVYAGKRAFVQKNQQKKS
ccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcc
ccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHcHHHHHHccccccEEEEEHHHHHHcc
mkkmnplkggvsltddqkiSWLRlirsdnispatcRDMINYFGSAEQALEMIPELAQRGAVYAGKRAFVQKNQQKKS
mkkmnplkggvsltddqkisWLRLirsdnispaTCRDMINYFGSAEQALEMIPELAQRGAVYAGKRAFVQKNQQKKS
MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGAVYAGKRAFVQKNQQKKS
****************QKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELA*********************
**********VSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGAVYAGKRAF*********
**********VSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGAVYAGKRAFVQKNQ****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGAVYAGKRAFVQKNQQKKS
MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGAVYAGKRAFVQKNQQKKS
MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGAVYAGKRAFVQKNQQKKS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target77 DNA protecting protein DprA [Candidatus Liberibacter as
315122272 298 hypothetical protein CKC_02620 [Candidatus Liberibacter 1 4e-23
222148310 383 DNA protecting protein DprA [Agrobacterium vitis S4] Le 1 6e-14
227821656 386 DNA processing chain A [Sinorhizobium fredii NGR234] Le 1 1e-13
150396156 383 DNA protecting protein DprA [Sinorhizobium medicae WSM4 1 1e-13
163759336 383 putative smf protein [Hoeflea phototrophica DFL-43] Len 1 2e-13
307301126 383 DNA protecting protein DprA [Sinorhizobium meliloti BL2 1 1e-12
15965054 383 hypothetical protein SMc01363 [Sinorhizobium meliloti 1 1 2e-12
307317859 383 DNA protecting protein DprA [Sinorhizobium meliloti AK8 1 2e-12
222085614 383 DNA protecting protein DprA [Agrobacterium radiobacter 1 5e-12
325292667 379 DNA processing chain A [Agrobacterium sp. H13-3] Length 1 3e-11
>gi|315122272|ref|YP_004062761.1| hypothetical protein CKC_02620 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 298 Back     alignment and organism information
 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 53/76 (69%), Positives = 62/76 (81%)

Query: 1  MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGA 60
          M K+NP K GV LTDDQKISWLRLIRSDNI PAT RDMINYFGSAEQALEMIPEL+QRG 
Sbjct: 1  MTKINPQKRGVYLTDDQKISWLRLIRSDNIGPATFRDMINYFGSAEQALEMIPELSQRGD 60

Query: 61 VYAGKRAFVQKNQQKK 76
          +    R + +++ +K+
Sbjct: 61 INKKIRIYSKESAEKE 76


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148310|ref|YP_002549267.1| DNA protecting protein DprA [Agrobacterium vitis S4] Length = 383 Back     alignment and organism information
>gi|227821656|ref|YP_002825626.1| DNA processing chain A [Sinorhizobium fredii NGR234] Length = 386 Back     alignment and organism information
>gi|150396156|ref|YP_001326623.1| DNA protecting protein DprA [Sinorhizobium medicae WSM419] Length = 383 Back     alignment and organism information
>gi|163759336|ref|ZP_02166422.1| putative smf protein [Hoeflea phototrophica DFL-43] Length = 383 Back     alignment and organism information
>gi|307301126|ref|ZP_07580895.1| DNA protecting protein DprA [Sinorhizobium meliloti BL225C] Length = 383 Back     alignment and organism information
>gi|15965054|ref|NP_385407.1| hypothetical protein SMc01363 [Sinorhizobium meliloti 1021] Length = 383 Back     alignment and organism information
>gi|307317859|ref|ZP_07597297.1| DNA protecting protein DprA [Sinorhizobium meliloti AK83] Length = 383 Back     alignment and organism information
>gi|222085614|ref|YP_002544144.1| DNA protecting protein DprA [Agrobacterium radiobacter K84] Length = 383 Back     alignment and organism information
>gi|325292667|ref|YP_004278531.1| DNA processing chain A [Agrobacterium sp. H13-3] Length = 379 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target77 DNA protecting protein DprA [Candidatus Liberibacter as
COG0758 350 COG0758, Smf, Predicted Rossmann fold nucleotide-bindin 0.002
>gnl|CDD|31101 COG0758, Smf, Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [DNA replication, recombination, and repair / Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 77 DNA protecting protein DprA [Candidatus Liberibacter as
COG0758 350 Smf Predicted Rossmann fold nucleotide-binding protein 98.2
pfam01367100 5_3_exonuc 5'-3' exonuclease, C-terminal SAM fold. 93.57
cd00008240 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonuclease dom 93.38
PRK09482256 xni exonuclease IX; Provisional 92.85
smart00475259 53EXOc 5'-3' exonuclease. 92.37
cd0008075 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) mo 91.63
PRK08786 927 consensus 91.62
PRK13766764 Hef nuclease; Provisional 91.6
PRK05929 870 consensus 91.35
PRK08434 887 consensus 91.11
PRK07300 880 consensus 90.96
PRK08928 861 consensus 90.95
PRK07898 902 consensus 90.86
PRK05797 869 consensus 90.81
PRK07625 922 consensus 90.8
PRK07456 975 consensus 90.56
PRK07556 977 consensus 90.53
PRK07997 928 consensus 90.38
PRK08835 931 consensus 90.34
>COG0758 Smf Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [DNA replication, recombination, and repair / Intracellular trafficking and secretion] Back     alignment and domain information
>pfam01367 5_3_exonuc 5'-3' exonuclease, C-terminal SAM fold Back     alignment and domain information
>cd00008 53EXOc 5'-3' exonuclease; T5 type 5'-3' exonuclease domains may co-occur with DNA polymerase I (Pol I) domains, or be part of Pol I containing complexes Back     alignment and domain information
>PRK09482 xni exonuclease IX; Provisional Back     alignment and domain information
>smart00475 53EXOc 5'-3' exonuclease Back     alignment and domain information
>cd00080 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) motif Back     alignment and domain information
>PRK08786 consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK05929 consensus Back     alignment and domain information
>PRK08434 consensus Back     alignment and domain information
>PRK07300 consensus Back     alignment and domain information
>PRK08928 consensus Back     alignment and domain information
>PRK07898 consensus Back     alignment and domain information
>PRK05797 consensus Back     alignment and domain information
>PRK07625 consensus Back     alignment and domain information
>PRK07456 consensus Back     alignment and domain information
>PRK07556 consensus Back     alignment and domain information
>PRK07997 consensus Back     alignment and domain information
>PRK08835 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target77 DNA protecting protein DprA [Candidatus Liberibacter as
3maj_A 382 Crystal Structure Of Putative Dna Processing Protei 5e-14
>gi|295982522|pdb|3MAJ|A Chain A, Crystal Structure Of Putative Dna Processing Protein Dpra Fr Rhodopseudomonas Palustris Cga009 Length = 382 Back     alignment and structure
 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 47/76 (61%)

Query: 1  MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGA 60
          + + +  +G   LT+ Q+I W RLIR++N+ P T R +IN+FGSA  ALE +PELA+RG 
Sbjct: 5  VGERSSDQGTTVLTEAQRIDWXRLIRAENVGPRTFRSLINHFGSARAALERLPELARRGG 64

Query: 61 VYAGKRAFVQKNQQKK 76
               R   +   +++
Sbjct: 65 AARAGRIPSEDEARRE 80


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target77 DNA protecting protein DprA [Candidatus Liberibacter as
3maj_A 382 DNA processing chain A; MCSG, PSI-2, structural genomic 2e-13
>3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris} Length = 382 Back     alignment and structure
 Score = 69.6 bits (170), Expect = 2e-13
 Identities = 30/67 (44%), Positives = 44/67 (65%)

Query: 1  MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGA 60
          + + +  +G   LT+ Q+I W+RLIR++N+ P T R +IN+FGSA  ALE +PELA+RG 
Sbjct: 5  VGERSSDQGTTVLTEAQRIDWMRLIRAENVGPRTFRSLINHFGSARAALERLPELARRGG 64

Query: 61 VYAGKRA 67
               R 
Sbjct: 65 AARAGRI 71


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target77 DNA protecting protein DprA [Candidatus Liberibacter as
3maj_A 382 DNA processing chain A; MCSG, PSI-2, structural genomic 99.44
1kft_A78 UVRC, excinuclease ABC subunit C; helix-hairpin-helix, 91.51
1x2i_A75 HEF helicase/nuclease; alpha helix, helix-hairpin-helix 91.3
2a1j_A63 DNA repair endonuclease XPF; XPF, xeroderma pigmentosum 90.77
1z00_B84 DNA repair endonuclease XPF; helix-hairpin-helix, hydro 90.66
1exn_A290 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enteroba 90.12
>3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris} Back     alignment and structure
Probab=99.44  E-value=3.5e-13  Score=94.87  Aligned_cols=71  Identities=42%  Similarity=0.721  Sum_probs=65.6

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHH
Q ss_conf             11248788999999999998658968999999999749999999970999996145588767898997540
Q gi|254780303|r    6 PLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGAVYAGKRAFVQKNQQKK   76 (77)
Q Consensus         6 ~~~~~~~ls~~erlawLRL~Rt~~VGp~Tf~~Ll~~fGsA~aAL~aLP~la~rgG~~~~~ri~s~~~Ae~E   76 (77)
                      +-+.-..|||+|+++||+|.++++|||.|+++|+++|||++++++++|++.++.|..+..++.+.++|++|
T Consensus        10 ~~~~~~~~t~~e~l~wl~L~~~~giG~~~~~~Ll~~fgs~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~   80 (382)
T 3maj_A           10 SDQGTTVLTEAQRIDWMRLIRAENVGPRTFRSLINHFGSARAALERLPELARRGGAARAGRIPSEDEARRE   80 (382)
T ss_dssp             ---CCCCSCHHHHHHHHHHHTSTTCCHHHHHHHHHHHSSHHHHHHHHHHHHHHHTCSSCCCCCCHHHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHCCHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             77788889999999999998289964999999999839999999779999987635665427998899999



>1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 Back     alignment and structure
>1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 Back     alignment and structure
>2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* Back     alignment and structure
>1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* Back     alignment and structure
>1exn_A 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enterobacteria phage T5} SCOP: a.60.7.1 c.120.1.2 PDB: 1ut5_A 1ut8_A 1xo1_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target77 DNA protecting protein DprA [Candidatus Liberibacter as
d2bgwa170 DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 5 94.96
d1kfta_56 Excinuclease UvrC C-terminal domain {Escherichia coli [ 92.86
d1rxwa1105 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeog 92.49
d1xo1a1105 T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} 91.7
d2a1ja162 DNA repair endonuclease XPF {Human (Homo sapiens) [TaxI 91.58
d1ul1x1140 Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapie 90.93
d1x2ia168 ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus 90.81
>d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
class: All alpha proteins
fold: SAM domain-like
superfamily: RuvA domain 2-like
family: Hef domain-like
domain: DNA repair endonuclease XPF
species: Aeropyrum pernix [TaxId: 56636]
Probab=94.96  E-value=0.017  Score=32.91  Aligned_cols=51  Identities=18%  Similarity=0.230  Sum_probs=38.9

Q ss_pred             CCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCHHHHHHHHHH-HHHHHCC
Q ss_conf             78899999999999865896899999999974999999997099-9996145
Q gi|254780303|r   11 VSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPE-LAQRGAV   61 (77)
Q Consensus        11 ~~ls~~erlawLRL~Rt~~VGp~Tf~~Ll~~fGsA~aAL~aLP~-la~rgG~   61 (77)
                      +.+++-+.+.+.-|---|+|||++-.+|+++|||..+.+.|-++ |+.=.|.
T Consensus         2 ~~~~~~~~~~~~~L~~IpgIG~~~a~~L~~~F~s~~~l~~As~eeL~~v~GI   53 (70)
T d2bgwa1           2 PRLSDVREWQLYILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGI   53 (70)
T ss_dssp             CCCCHHHHHHHHHHHTSTTCCHHHHHHHHHHHSSHHHHTTCCHHHHHHSTTC
T ss_pred             CCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHHCCHHHHHCCCCC
T ss_conf             8858899989999808999579999999998298899988699999757998



>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} Back     information, alignment and structure
>d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target77 DNA protecting protein DprA [Candidatus Liberibacter as
1x2i_A_1-4949 HEF helicase/nuclease; alpha helix, helix-hairpin- 93.88
1a76_A_210-27465 Flap endonuclease-1 protein; 5'-3' EXO/endo nuclea 93.64
1exn_A_182-26180 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Ent 93.36
2bgw_A_149-19749 XPF endonuclease; hydrolase, structure specific en 93.18
1rxw_A_221-28868 Flap structure-specific endonuclease; helical clam 93.07
1z00_A_89 DNA excision repair protein ERCC-1; helix-hairpin- 92.95
1z00_B_1-7171 DNA repair endonuclease XPF; helix-hairpin-helix, 92.79
2a1j_A_63 DNA repair endonuclease XPF; XPF, xeroderma pigmen 92.62
2izo_A_219-30082 FEN1, flap structure-specific endonuclease; hydrol 92.51
1ul1_X_1-14_218-29289 Flap endonuclease-1; protein complex, DNA-binding 91.69
3c1y_A_304-37774 DNA integrity scanning protein DISA; DNA damage, D 91.2
2nrt_A_157-22064 Uvrabc system protein C; UVRC, endonuclease, RNAse 91.02
1b43_A_212-28877 Protein (FEN-1); nuclease, DNA repair, DNA replica 90.44
>1x2i_A (A:1-49) HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} Back     alignment and structure
Probab=93.88  E-value=0.053  Score=32.35  Aligned_cols=31  Identities=19%  Similarity=0.315  Sum_probs=26.2

Q ss_pred             HHHCCCCCHHHHHHHHHHCCCHHHHHHHHHH
Q ss_conf             9865896899999999974999999997099
Q gi|254780303|r   24 LIRSDNISPATCRDMINYFGSAEQALEMIPE   54 (77)
Q Consensus        24 L~Rt~~VGp~Tf~~Ll~~fGsA~aAL~aLP~   54 (77)
                      |---|+|||.+...|+++|||-++...|-.+
T Consensus        16 L~~I~gVG~~~ak~Ll~~Fgsi~~i~~As~e   46 (49)
T 1x2i_A           16 VEGLPHVSATLARRLLKHFGSVERVFTASVA   46 (49)
T ss_dssp             HTTSTTCCHHHHHHHHHHHCSHHHHHHCCHH
T ss_pred             HCCCCCCCHHHHHHHHHHCCHHHHHHHCCHH
T ss_conf             8589997899999999970628888626798



>1a76_A (A:210-274) Flap endonuclease-1 protein; 5'-3' EXO/endo nuclease, DNA replication, RTH, RAD27, DNA repair; 2.00A {Methanococcus jannaschii} Back     alignment and structure
>1exn_A (A:182-261) 5'-exonuclease, 5'-nuclease; hydrolase; 2.50A {Enterobacteria phage T5} Back     alignment and structure
>2bgw_A (A:149-197) XPF endonuclease; hydrolase, structure specific endonuclease, nucleotide excision repair; 2.8A {Aeropyrum pernix} Back     alignment and structure
>1rxw_A (A:221-288) Flap structure-specific endonuclease; helical clamp, helix-3 turn-helix, hydrophobic wedge, 3' flap binding site, hydrolase/DNA complex; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1z00_A (A:) DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1z00_B (B:1-71) DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2a1j_A (A:) DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} Back     alignment and structure
>2izo_A (A:219-300) FEN1, flap structure-specific endonuclease; hydrolase, DNA repair, DNA-binding, endonuclease, metal-binding, excision repair, DNA replication, PCNA; HET: DNA; 2.9A {Sulfolobus solfataricus} Back     alignment and structure
>1ul1_X (X:1-14,X:218-292) Flap endonuclease-1; protein complex, DNA-binding protein, flap DNA, flap endonuclease, sliding clamp, DNA clamp; 2.90A {Homo sapiens} Back     alignment and structure
>3c1y_A (A:304-377) DNA integrity scanning protein DISA; DNA damage, DNA repair, DNA-binding, DNA binding protein; HET: DNA 2BA; 2.10A {Thermotoga maritima} PDB: 3c1z_A* 3c21_A* 3c23_A* Back     alignment and structure
>2nrt_A (A:157-220) Uvrabc system protein C; UVRC, endonuclease, RNAse H, helix hairpin helix, NER, hydrolase; 1.50A {Thermotoga maritima} PDB: 2nrv_A 2nrw_A 2nrx_A 2nrz_A Back     alignment and structure
>1b43_A (A:212-288) Protein (FEN-1); nuclease, DNA repair, DNA replication; 2.00A {Pyrococcus furiosus} Back     alignment and structure