254780302

254780302

putative glycerol-3-phosphate acyltransferase PlsY

GeneID in NCBI database:8209284Locus tag:CLIBASIA_00935
Protein GI in NCBI database:254780302Protein Accession:YP_003064715.1
Gene range:+(192895, 193512)Protein Length:205aa
Gene description:putative glycerol-3-phosphate acyltransferase PlsY
COG prediction:[S] Predicted membrane protein
KEGG prediction:putative glycerol-3-phosphate acyltransferase PlsY; K08591 glycerol-3-phosphate acyltransferase PlsY [EC:2.3.1.15]
SEED prediction:Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY
Pathway involved in KEGG:Glycerolipid metabolism [PATH:las00561]
Glycerophospholipid metabolism [PATH:las00564]
Subsystem involved in SEED:Glycerolipid and Glycerophospholipid Metabolism in Bacteria
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED5 TM-Helix
HMMTOP5 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS5 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSNKKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYIGVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMTITVYWKHIENIKRLILGSEKKIFKK
ccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
ccEEEcccHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccccccccccccHHEccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTrmfgfqdirsigsgnigatnvlrtsnKKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPvwlkfkggkgiSTYIGVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWitypevnipiIFTFMTITVYWKHIENIKRLILGSEKKIFKK
MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSNKKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYIGVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMTITVYWKHIENIKrlilgsekkifkk
MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSNKKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYIGVLIALELKMAILFSAIWMSSALVTGYssisslfstliiAMIIWITYPEVNIPIIFTFMTITVYWKHIENIKRLILGSEKKIFKK
******A*HELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSNKKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYIGVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMTITVYWKHIENIKRLILGS*******
MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSNKKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYIGVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMTITVYWKHIENIKRLILGSEKKIFKK
MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSNKKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYIGVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMTITVYWKHIENIKRLILG********
ooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
ooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSNKKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYIGVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMTITVYWKHIENIKRLILGSEKKIFKK
MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSNKKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYIGVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMTITVYWKHIENIKRLILGSEKKIFKK
MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSNKKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYIGVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMTITVYWKHIENIKRLILGSEKKIFKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target205 putative glycerol-3-phosphate acyltransferase PlsY [Can
315122273214 putative glycerol-3-phosphate acyltransferase PlsY [Can 1 3e-73
90423748196 putative glycerol-3-phosphate acyltransferase PlsY [Rho 1 1e-47
239833967203 conserved hypothetical protein [Ochrobactrum intermediu 1 1e-47
150396157203 putative glycerol-3-phosphate acyltransferase PlsY [Sin 1 3e-47
153010989201 putative glycerol-3-phosphate acyltransferase PlsY [Och 1 4e-46
27380212198 glycerol-3-phosphate acyltransferase PlsY [Bradyrhizobi 1 1e-45
118590184221 hypothetical protein SIAM614_11738 [Stappia aggregata I 1 2e-45
319783705195 hypothetical protein Mesci_4017 [Mesorhizobium ciceri b 1 3e-45
307946438220 acyl-phosphate glycerol 3-phosphate acyltransferase [Ro 1 5e-45
325292668205 hypothetical protein AGROH133_05742 [Agrobacterium sp. 1 1e-44
>gi|315122273|ref|YP_004062762.1| putative glycerol-3-phosphate acyltransferase PlsY [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 214 Back     alignment and organism information
 Score =  278 bits (712), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 141/202 (69%), Positives = 166/202 (82%)

Query: 1   MNNLQFAYHELIAPIISLILSYAIGSIPFGLLLTRMFGFQDIRSIGSGNIGATNVLRTSN 60
           M+NL F  +E  A I ++IL Y IGSIPFGLLLTR+ GF DIRSIGSGNIGATNVLRT N
Sbjct: 1   MDNLPFFSYEFFAKITAIILGYMIGSIPFGLLLTRVCGFNDIRSIGSGNIGATNVLRTGN 60

Query: 61  KKLAFATLSLDAIKATATIIIVSELFDHKIGILAGFATFLGHIFPVWLKFKGGKGISTYI 120
           KKLAF TL  D+IKATATII+VS LF+  +G LAG A FLGHIFPV+LKFKGGKG+STYI
Sbjct: 61  KKLAFITLLFDSIKATATIIVVSMLFNDNVGALAGLAAFLGHIFPVYLKFKGGKGVSTYI 120

Query: 121 GVLIALELKMAILFSAIWMSSALVTGYSSISSLFSTLIIAMIIWITYPEVNIPIIFTFMT 180
           GVLIAL+ +M I F+ IW+  AL+T YSSI+SLF+TLII +++WI +P +N+PIIFTFMT
Sbjct: 121 GVLIALKPEMVIFFAIIWILFALITRYSSIASLFATLIITLVLWIIHPGINVPIIFTFMT 180

Query: 181 ITVYWKHIENIKRLILGSEKKI 202
             V WKHIENIKRLI GSE +I
Sbjct: 181 TIVVWKHIENIKRLISGSETEI 202


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|90423748|ref|YP_532118.1| putative glycerol-3-phosphate acyltransferase PlsY [Rhodopseudomonas palustris BisB18] Length = 196 Back     alignment and organism information
>gi|239833967|ref|ZP_04682295.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301] Length = 203 Back     alignment and organism information
>gi|150396157|ref|YP_001326624.1| putative glycerol-3-phosphate acyltransferase PlsY [Sinorhizobium medicae WSM419] Length = 203 Back     alignment and organism information
>gi|153010989|ref|YP_001372203.1| putative glycerol-3-phosphate acyltransferase PlsY [Ochrobactrum anthropi ATCC 49188] Length = 201 Back     alignment and organism information
>gi|27380212|ref|NP_771741.1| glycerol-3-phosphate acyltransferase PlsY [Bradyrhizobium japonicum USDA 110] Length = 198 Back     alignment and organism information
>gi|118590184|ref|ZP_01547587.1| hypothetical protein SIAM614_11738 [Stappia aggregata IAM 12614] Length = 221 Back     alignment and organism information
>gi|319783705|ref|YP_004143181.1| hypothetical protein Mesci_4017 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 195 Back     alignment and organism information
>gi|307946438|ref|ZP_07661773.1| acyl-phosphate glycerol 3-phosphate acyltransferase [Roseibium sp. TrichSKD4] Length = 220 Back     alignment and organism information
>gi|325292668|ref|YP_004278532.1| hypothetical protein AGROH133_05742 [Agrobacterium sp. H13-3] Length = 205 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 putative glycerol-3-phosphate acyltransferase PlsY [Can
PRK00220198 PRK00220, PRK00220, putative glycerol-3-phosphate acylt 5e-49
COG0344200 COG0344, COG0344, Predicted membrane protein [Function 5e-36
PRK14396190 PRK14396, PRK14396, membrane protein; Provisional 1e-34
PRK14394195 PRK14394, PRK14394, membrane protein; Provisional 1e-34
TIGR00023196 TIGR00023, TIGR00023, acyl-phosphate glycerol 3-phospha 2e-34
PRK14400201 PRK14400, PRK14400, membrane protein; Provisional 6e-32
PRK14419199 PRK14419, PRK14419, membrane protein; Provisional 2e-31
PRK14393194 PRK14393, PRK14393, membrane protein; Provisional 1e-30
PRK14398191 PRK14398, PRK14398, membrane protein; Provisional 9e-30
PRK14397222 PRK14397, PRK14397, membrane protein; Provisional 6e-29
PRK14403196 PRK14403, PRK14403, membrane protein; Provisional 1e-25
PRK14405202 PRK14405, PRK14405, membrane protein; Provisional 6e-25
PRK14402198 PRK14402, PRK14402, membrane protein; Provisional 9e-25
PRK14406199 PRK14406, PRK14406, membrane protein; Provisional 2e-24
PRK14412198 PRK14412, PRK14412, membrane protein; Provisional 3e-24
PRK14392207 PRK14392, PRK14392, membrane protein; Provisional 5e-23
PRK14415216 PRK14415, PRK14415, membrane protein; Provisional 5e-23
PRK14418236 PRK14418, PRK14418, membrane protein; Provisional 7e-23
PRK14409205 PRK14409, PRK14409, membrane protein; Provisional 1e-19
PRK14410235 PRK14410, PRK14410, membrane protein; Provisional 3e-19
PRK14395195 PRK14395, PRK14395, membrane protein; Provisional 1e-18
PRK14407219 PRK14407, PRK14407, membrane protein; Provisional 3e-17
PRK14414210 PRK14414, PRK14414, membrane protein; Provisional 2e-15
PRK14413197 PRK14413, PRK14413, membrane protein; Provisional 4e-15
PRK14411204 PRK14411, PRK14411, membrane protein; Provisional 3e-09
pfam02660178 pfam02660, DUF205, Domain of unknown function (DUF205) 8e-42
PRK14399258 PRK14399, PRK14399, membrane protein; Provisional 5e-21
PRK14408257 PRK14408, PRK14408, membrane protein; Provisional 5e-15
PRK14416200 PRK14416, PRK14416, membrane protein; Provisional 3e-13
PRK14417232 PRK14417, PRK14417, membrane protein; Provisional 5e-16
PRK14404201 PRK14404, PRK14404, membrane protein; Provisional 3e-08
PRK14401187 PRK14401, PRK14401, membrane protein; Provisional 1e-07
>gnl|CDD|178934 PRK00220, PRK00220, putative glycerol-3-phosphate acyltransferase PlsY; Provisional Back     alignment and domain information
>gnl|CDD|30692 COG0344, COG0344, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|184657 PRK14396, PRK14396, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172870 PRK14394, PRK14394, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|161669 TIGR00023, TIGR00023, acyl-phosphate glycerol 3-phosphate acyltransferase Back     alignment and domain information
>gnl|CDD|172876 PRK14400, PRK14400, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184670 PRK14419, PRK14419, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172869 PRK14393, PRK14393, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172874 PRK14398, PRK14398, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172873 PRK14397, PRK14397, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172879 PRK14403, PRK14403, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184661 PRK14405, PRK14405, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184659 PRK14402, PRK14402, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172882 PRK14406, PRK14406, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184664 PRK14412, PRK14412, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172868 PRK14392, PRK14392, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184666 PRK14415, PRK14415, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184669 PRK14418, PRK14418, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172885 PRK14409, PRK14409, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184662 PRK14410, PRK14410, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172871 PRK14395, PRK14395, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172883 PRK14407, PRK14407, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184665 PRK14414, PRK14414, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172889 PRK14413, PRK14413, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184663 PRK14411, PRK14411, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|145683 pfam02660, DUF205, Domain of unknown function (DUF205) Back     alignment and domain information
>gnl|CDD|172875 PRK14399, PRK14399, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|172884 PRK14408, PRK14408, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184667 PRK14416, PRK14416, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184668 PRK14417, PRK14417, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184660 PRK14404, PRK14404, membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|184658 PRK14401, PRK14401, membrane protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 205 putative glycerol-3-phosphate acyltransferase PlsY [Can
PRK00220198 putative glycerol-3-phosphate acyltransferase PlsY; Pro 100.0
TIGR00023243 TIGR00023 conserved hypothetical protein TIGR00023; Int 100.0
pfam02660178 DUF205 Domain of unknown function (DUF205). This family 100.0
COG0344200 Predicted membrane protein [Function unknown] 100.0
>PRK00220 putative glycerol-3-phosphate acyltransferase PlsY; Provisional Back     alignment and domain information
>TIGR00023 TIGR00023 conserved hypothetical protein TIGR00023; InterPro: IPR003811 This entry describes proteins of unknown function Back     alignment and domain information
>pfam02660 DUF205 Domain of unknown function (DUF205) Back     alignment and domain information
>COG0344 Predicted membrane protein [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 putative glycerol-3-phosphate acyltransferase PlsY [Can
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 0.002
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 37.7 bits (86), Expect = 0.002
 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 9/24 (37%)

Query: 61 KKLAFATLSL---D-----AIKAT 76
          KKL  A+L L   D     AIKAT
Sbjct: 23 KKLQ-ASLKLYADDSAPALAIKAT 45


Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00