254780305

254780305

hypothetical protein CLIBASIA_00950

GeneID in NCBI database:8209287Locus tag:CLIBASIA_00950
Protein GI in NCBI database:254780305Protein Accession:YP_003064718.1
Gene range:+(194424, 194711)Protein Length:95aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ
ccccHHHHHcccHHHHHHHcccccccccccccccHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHccEEEEccccEEEEEccccccc
cccccEEccccccHccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccc
mvhpqieqnffssqsdtnhtkninithypeytqcERVRIKQslnnvpihiddiihhtgiEAPVVYLVLLELDLagrlchhpegkvsltmhlpspq
MVHPQIEQNFfssqsdtnhtknINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPegkvsltmhlpspq
MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPihiddiihhTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ
*VHP*********************************RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH*P***
MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ
*********FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ
MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ
MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target95 hypothetical protein CLIBASIA_00950 [Candidatus Liberib
163759336383 putative smf protein [Hoeflea phototrophica DFL-43] Len 1 3e-10
218663674147 DNA processing chain A protein [Rhizobium etli IE4771] 1 1e-09
86357273380 DNA processing chain A protein [Rhizobium etli CFN 42] 1 3e-09
209548899380 DNA protecting protein DprA [Rhizobium leguminosarum bv 1 4e-09
90417726376 DNA processing protein DprA, putative [Aurantimonas man 1 4e-09
190891322380 DNA processing chain A protein [Rhizobium etli CIAT 652 1 6e-09
150396156383 DNA protecting protein DprA [Sinorhizobium medicae WSM4 1 8e-09
15888630380 DNA processing chain A [Agrobacterium tumefaciens str. 1 9e-09
241204123380 DNA protecting protein DprA [Rhizobium leguminosarum bv 1 1e-08
116251502380 smf protein [Rhizobium leguminosarum bv. viciae 3841] L 1 1e-08
>gi|163759336|ref|ZP_02166422.1| putative smf protein [Hoeflea phototrophica DFL-43] Length = 383 Back     alignment and organism information
 Score = 68.6 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 39/58 (67%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
           +R R+ ++L   P  +DDII HTG+ A  VYLVL+ELDLAGRL  HP G VSL    P
Sbjct: 326 DRARVIEALGPSPSEVDDIIRHTGVAAATVYLVLIELDLAGRLHRHPGGMVSLAFDDP 383


Species: Hoeflea phototrophica
Genus: Hoeflea
Family: Phyllobacteriaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218663674|ref|ZP_03519604.1| DNA processing chain A protein [Rhizobium etli IE4771] Length = 147 Back     alignment and organism information
>gi|86357273|ref|YP_469165.1| DNA processing chain A protein [Rhizobium etli CFN 42] Length = 380 Back     alignment and organism information
>gi|209548899|ref|YP_002280816.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 380 Back     alignment and organism information
>gi|90417726|ref|ZP_01225638.1| DNA processing protein DprA, putative [Aurantimonas manganoxydans SI85-9A1] Length = 376 Back     alignment and organism information
>gi|190891322|ref|YP_001977864.1| DNA processing chain A protein [Rhizobium etli CIAT 652] Length = 380 Back     alignment and organism information
>gi|150396156|ref|YP_001326623.1| DNA protecting protein DprA [Sinorhizobium medicae WSM419] Length = 383 Back     alignment and organism information
>gi|15888630|ref|NP_354311.1| DNA processing chain A [Agrobacterium tumefaciens str. C58] Length = 380 Back     alignment and organism information
>gi|241204123|ref|YP_002975219.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 380 Back     alignment and organism information
>gi|116251502|ref|YP_767340.1| smf protein [Rhizobium leguminosarum bv. viciae 3841] Length = 380 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target95 hypothetical protein CLIBASIA_00950 [Candidatus Liberib
COG0758350 COG0758, Smf, Predicted Rossmann fold nucleotide-bindin 4e-06
>gnl|CDD|31101 COG0758, Smf, Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [DNA replication, recombination, and repair / Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 95 hypothetical protein CLIBASIA_00950 [Candidatus Liberib
PRK10736364 hypothetical protein; Provisional 99.32
COG0758350 Smf Predicted Rossmann fold nucleotide-binding protein 98.92
COG1414 246 IclR Transcriptional regulator [Transcription] 97.12
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulation. 97.07
PRK11569 274 transcriptional repressor IclR; Provisional 96.87
PRK09834 264 DNA-binding transcriptional activator MhpR; Provisional 96.51
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor 96.4
PRK10163 271 DNA-binding transcriptional repressor AllR; Provisional 96.23
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and simi 96.13
pfam0933952 HTH_IclR IclR helix-turn-helix domain. 96.11
pfam0822057 HTH_DeoR DeoR-like helix-turn-helix domain. 95.97
pfam0197868 TrmB Sugar-specific transcriptional regulator TrmB. One 95.92
PRK09802 269 DNA-binding transcriptional regulator AgaR; Provisional 95.9
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Provisi 95.86
PRK10906 252 DNA-binding transcriptional repressor GlpR; Provisional 95.76
PRK13509 251 transcriptional repressor UlaR; Provisional 95.72
pfam0172665 LexA_DNA_bind LexA DNA binding domain. This is the DNA 95.71
pfam0102247 HTH_5 Bacterial regulatory protein, arsR family. Member 95.7
COG1349 253 GlpR Transcriptional regulators of sugar metabolism [Tr 95.55
COG4742 260 Predicted transcriptional regulator [Transcription] 95.42
PRK10411 240 DNA-binding transcriptional activator FucR; Provisional 95.32
COG4190144 Predicted transcriptional regulator [Transcription] 95.28
PRK11512144 DNA-binding transcriptional repressor MarR; Provisional 94.57
pfam0104759 MarR MarR family. The Mar proteins are involved in the 94.07
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon 94.04
TIGR01884231 cas_HTH CRISPR locus-related DNA-binding protein; Inter 93.95
pfam08784103 RPA_C Replication protein A C terminal. This domain cor 93.89
COG2345 218 Predicted transcriptional regulator [Transcription] 93.85
COG3355126 Predicted transcriptional regulator [Transcription] 93.77
COG1510177 Predicted transcriptional regulators [Transcription] 93.32
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminases. He 93.18
PRK12423 202 LexA repressor; Provisional 92.88
COG4189 308 Predicted transcriptional regulator [Transcription] 92.81
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resistanc 92.54
pfam0827955 HTH_11 HTH domain. This family includes helix-turn-heli 92.28
COG1378 247 Predicted transcriptional regulators [Transcription] 92.22
PRK00215 204 LexA repressor; Validated 92.17
COG2512258 Predicted membrane-associated trancriptional regulator 92.17
PRK04172 501 pheS phenylalanyl-tRNA synthetase subunit alpha; Provis 92.07
PRK03573144 transcriptional regulator SlyA; Provisional 92.01
PRK10141106 DNA-binding transcriptional repressor ArsR; Provisional 91.58
TIGR02431 252 pcaR_pcaU beta-ketoadipate pathway transcriptional regu 90.59
PRK03902142 manganese transport transcriptional regulator; Provisio 90.35
COG1777 217 Predicted transcriptional regulators [Transcription] 90.27
>PRK10736 hypothetical protein; Provisional Back     alignment and domain information
>COG0758 Smf Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [DNA replication, recombination, and repair / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>pfam09339 HTH_IclR IclR helix-turn-helix domain Back     alignment and domain information
>pfam08220 HTH_DeoR DeoR-like helix-turn-helix domain Back     alignment and domain information
>pfam01978 TrmB Sugar-specific transcriptional regulator TrmB Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>pfam01726 LexA_DNA_bind LexA DNA binding domain Back     alignment and domain information
>pfam01022 HTH_5 Bacterial regulatory protein, arsR family Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4742 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>COG4190 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>pfam01047 MarR MarR family Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein; InterPro: IPR010163 Most but not all examples of this family are associated with CRISPR loci, a combination of DNA repeats and characteristic proteins encoded near the repeat cluster Back     alignment and domain information
>pfam08784 RPA_C Replication protein A C terminal Back     alignment and domain information
>COG2345 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1510 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>COG4189 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>pfam08279 HTH_11 HTH domain Back     alignment and domain information
>COG1378 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>COG2512 Predicted membrane-associated trancriptional regulator [Transcription] Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family; InterPro: IPR012794 Members of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>COG1777 Predicted transcriptional regulators [Transcription] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target95 hypothetical protein CLIBASIA_00950 [Candidatus Liberib
3maj_A382 Crystal Structure Of Putative Dna Processing Protei 1e-13
>gi|295982522|pdb|3MAJ|A Chain A, Crystal Structure Of Putative Dna Processing Protein Dpra Fr Rhodopseudomonas Palustris Cga009 Length = 382 Back     alignment and structure
 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 37/79 (46%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                 +    +  +     E    +R RI   L   P+ IDD+I  +GI   VV  +LL
Sbjct: 304 ILERPIELPGREPEHAPPEGEPDTGDRTRILALLGPSPVGIDDLIRLSGISPAVVRTILL 363

Query: 70  ELDLAGRLCHHPEGKVSLT 88
           EL+LAGRL  H    VSL+
Sbjct: 364 ELELAGRLERHGGSLVSLS 382


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target95 hypothetical protein CLIBASIA_00950 [Candidatus Liberib
3maj_A382 DNA processing chain A; MCSG, PSI-2, structural genomic 2e-09
>3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris} Length = 382 Back     alignment and structure
 Score = 55.7 bits (134), Expect = 2e-09
 Identities = 26/54 (48%), Positives = 33/54 (61%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
           +R RI   L   P+ IDD+I  +GI   VV  +LLEL+LAGRL  H    VSL+
Sbjct: 329 DRTRILALLGPSPVGIDDLIRLSGISPAVVRTILLELELAGRLERHGGSLVSLS 382


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target95 hypothetical protein CLIBASIA_00950 [Candidatus Liberib
3maj_A382 DNA processing chain A; MCSG, PSI-2, structural genomic 99.42
1mkm_A 249 ICLR transcriptional regulator; structural genomics, wi 96.98
2o0y_A 260 Transcriptional regulator; ICLR-family, structural geno 96.78
1j5y_A 187 Transcriptional regulator, biotin repressor family; str 96.7
1ku9_A152 Hypothetical protein MJ223; putative transcription fact 96.22
2g7u_A 257 Transcriptional regulator; ICLR family, structural geno 96.06
1uly_A 192 Hypothetical protein PH1932; helix-turn-helix, structur 95.87
2p4w_A 202 Transcriptional regulatory protein ARSR family; archaea 95.85
2ia2_A 265 Putative transcriptional regulator; SAD, PSI-2, structu 95.78
1sfx_A109 Conserved hypothetical protein AF2008; structural genom 95.78
2oqg_A114 Possible transcriptional regulator, ARSR family protein 95.61
3jth_A98 Transcription activator HLYU; transcription factor, RTX 95.61
2d1h_A109 ST1889, 109AA long hypothetical transcriptional regulat 95.6
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptional r 95.54
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fold; HE 95.52
3f6o_A118 Probable transcriptional regulator, ARSR family protein 95.45
3f6v_A151 Possible transcriptional regulator, ARSR family protein 95.29
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, tran 95.23
3cuo_A99 Uncharacterized HTH-type transcriptional regulator YGAV 95.05
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transcripti 95.03
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracycline 94.92
2wte_A244 CSA3; antiviral protein, viral resistance, winged helix 94.92
1y0u_A96 Arsenical resistance operon repressor, putative; struct 94.91
2gxg_A146 146AA long hypothetical transcriptional regulator; wing 94.9
1qbj_A81 Protein (double-stranded RNA specific adenosine deamina 94.55
2ip2_A 334 Probable phenazine-specific methyltransferase; pyocyani 94.49
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, SAH, 94.4
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix motif, wi 94.19
2heo_A67 Z-DNA binding protein 1; protein DLM1/Z-DNA complex, im 94.15
2kko_A108 Possible transcriptional regulatory protein (possibly A 94.15
1x19_A 359 CRTF-related protein; methyltransferase, bacteriochlloc 93.84
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, APC5613 93.75
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-helix, 93.73
1u2w_A122 CADC repressor, cadmium efflux system accessory protein 93.38
1qgp_A77 Protein (double stranded RNA adenosine deaminase); Z-al 93.32
2qlz_A 232 Transcription factor PF0095; 2.50A {Pyrococcus furiosus 93.07
3kp7_A151 Transcriptional regulator TCAR; multiple drug resistanc 92.96
3f3x_A144 Transcriptional regulator, MARR family, putative; DNA b 92.93
3boq_A160 Transcriptional regulator, MARR family; structural geno 92.8
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, DNA-b 92.7
2ia0_A171 Putative HTH-type transcriptional regulator PF0864; ASN 92.31
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH motif, 92.3
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl methioni 92.28
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-turn-hel 92.26
2nyx_A168 Probable transcriptional regulatory protein, RV1404; al 92.05
3e6m_A161 MARR family transcriptional regulator; APC88769, silici 91.99
2pn6_A150 ST1022, 150AA long hypothetical transcriptional regulat 91.91
2h09_A155 Transcriptional regulator MNTR; transcription regulator 91.58
3dp7_A 363 SAM-dependent methyltransferase; structural genomics, p 91.31
2nnn_A140 Probable transcriptional regulator; structural genomics 91.31
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, meth 91.22
1s3j_A155 YUSO protein; structural genomics, MARR transcriptional 91.22
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01047, 91.19
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A {Sul 91.09
2hr3_A147 Probable transcriptional regulator; MCSG, structural ge 91.05
2e1c_A171 Putative HTH-type transcriptional regulator PH1519; DNA 91.04
3bpv_A138 Transcriptional regulator; MARR, DNA binding, transcrip 91.01
2cyy_A151 Putative HTH-type transcriptional regulator PH1519; str 90.95
3nqo_A189 MARR-family transcriptional regulator; structural genom 90.74
2pex_A153 Transcriptional regulator OHRR; transcription regulator 90.74
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; PSI- 90.73
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix-turn 90.67
3ech_A142 MEXR, multidrug resistance operon repressor; winged hel 90.63
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, LRP/A 90.61
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; DNA-b 90.54
3cjn_A162 Transcriptional regulator, MARR family; structural geno 90.46
1jgs_A138 Multiple antibiotic resistance protein MARR; transcript 90.41
3hrs_A 214 Metalloregulator SCAR; DTXR/MNTR family member, transcr 90.4
1fx7_A 230 Iron-dependent repressor IDER; DTXR, iron-dependent reg 90.37
3bdd_A142 Regulatory protein MARR; putative multiple antibiotic-r 90.37
2r3s_A 335 Uncharacterized protein; methyltransferase domain, stru 90.3
3i4p_A162 Transcriptional regulator, ASNC family; PSI, structural 90.29
3lwf_A159 LIN1550 protein, putative transcriptional regulator; st 90.28
>3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris} Back     alignment and structure
Probab=99.42  E-value=1.1e-13  Score=92.97  Aligned_cols=62  Identities=44%  Similarity=0.569  Sum_probs=57.2

Q ss_pred             CCCCCCCHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             68879998999999985889889999999829999999999999999417986479868981
Q gi|254780305|r   27 HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT   88 (95)
Q Consensus        27 ~~p~~~~~~~~~Il~~L~~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~   88 (95)
                      ....+.+.++++|+++|+.+|+++|+|+.++|+++++++++|++|||+|+|+++|||+|+|+
T Consensus       321 ~~~~~~~~~~~~il~~l~~~~~~~d~l~~~~gl~~~~~~~~L~~LEl~G~v~~~~G~~y~l~  382 (382)
T 3maj_A          321 PEGEPDTGDRTRILALLGPSPVGIDDLIRLSGISPAVVRTILLELELAGRLERHGGSLVSLS  382 (382)
T ss_dssp             --CCCCTTHHHHHHHHCCSSCEEHHHHHHHHCCCHHHHHHHHHHHHHTTCCEECTTSEEEC-
T ss_pred             CCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCCEEEEC
T ss_conf             77798986899999866999988999999989099999999999997596773499179829



>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>1j5y_A Transcriptional regulator, biotin repressor family; structural genomics, TM1602, JCSG, conserved hypothetical protein, PSI; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, MCSG, PSI, protein structure initiative, midwest center for structural genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii OT3} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged helix, DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 Back     alignment and structure
>2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Rhodococcus SP} Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH motif, PSI, protein structure initiative; 1.55A {Archaeoglobus fulgidus dsm 4304} SCOP: a.4.5.50 Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bonds; 2.05A {Sulfolobus tokodaii str} SCOP: a.4.5.50 Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulator YGAV; DNA-binding transcriptional regulator, structural genomics, PSI, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.4.5.5 Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine deaminase (ADAR1)); protein/Z-DNA complex, hydrolase/DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1- carboxylic acid, PHZM; 1.80A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genomics, transcription; 2.05A {Pyrococcus horikoshii OT3} SCOP: a.4.5.28 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1/Z-DNA complex, immune system/DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, S-adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum tls} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; zinc, LEAD, SOFT metal ION resistance, ARSR/SMTB family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF0864; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DNA-binding, plasmid, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcriptional regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV1404; alpha/beta, structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research, nysgxrc; 2.33A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in europe; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix DNA binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH1519; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} PDB: 1lnw_A 3mex_A Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis 89} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.15A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genomics, protein structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target95 hypothetical protein CLIBASIA_00950 [Candidatus Liberib
d1mkma175 Transcriptional regulator IclR, N-terminal domain {Ther 97.03
d1ulya_ 190 Hypothetical protein PH1932 {Pyrococcus horikoshii [Tax 96.19
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidus [Ta 96.13
d1tw3a185 Carminomycin 4-O-methyltransferase {Streptomyces peucet 95.86
d1j5ya165 Putative transcriptional regulator TM1602, N-terminal d 95.82
d2p4wa1 194 Transcriptional regulatory protein PF1790 {Pyrococcus f 95.75
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus janna 95.61
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 95.55
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sulfolob 95.37
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Escheric 95.26
d1biaa163 Biotin repressor, N-terminal domain {Escherichia coli [ 94.9
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Staphyloc 94.68
d1u2wa1108 Cadmium efflux system accessory protein CadC {Staphyloc 94.58
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus horiko 93.33
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} 92.89
d2hoea162 N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 92.49
d2f2ea1142 Hypothetical protein PA1607 {Pseudomonas aeruginosa [Ta 92.38
d1z05a171 Transcriptional regulator VC2007 N-terminal domain {Vib 92.22
d1qzza192 Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpura 91.93
d1okra_120 Methicillin resistance regulatory protein MecI {Staphyl 91.88
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudomonas 91.73
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Escheri 91.57
d1j75a_57 Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} 91.41
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [TaxId: 91.18
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS {Sta 91.14
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus subti 91.14
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oeni [Ta 90.92
d2hzta195 Putative transcriptional regulator YtcD {Bacillus subti 90.78
d2fxaa1162 Protease production regulatory protein Hpr {Bacillus su 90.74
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 90.14
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Transcriptional regulator IclR, N-terminal domain
domain: Transcriptional regulator IclR, N-terminal domain
species: Thermotoga maritima [TaxId: 2336]
Probab=97.03  E-value=0.00043  Score=39.92  Aligned_cols=52  Identities=10%  Similarity=0.157  Sum_probs=47.8

Q ss_pred             HHHHHHCC--CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             99998588--98899999998299999999999999994179864798689813
Q gi|254780305|r   38 RIKQSLNN--VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM   89 (95)
Q Consensus        38 ~Il~~L~~--~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~~   89 (95)
                      +|++.+..  .|+.+.+|++.+|++.+.++..|-.|+-.|++.+-+.|+|++..
T Consensus         9 ~IL~~~a~~~~~~s~~eia~~~~~~~st~~rll~tL~~~g~l~~~~~g~y~lG~   62 (75)
T d1mkma1           9 EILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYVPGY   62 (75)
T ss_dssp             HHHHHHHHCSSCBCHHHHHHHTTCCHHHHHHHHHHHHHTTSEEECTTSCEEECT
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCCCEEECH
T ss_conf             999999857999899999999791999999999999988998889999786329



>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1okra_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j75a_ a.4.5.19 (A:) Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d2hzta1 a.4.5.69 (A:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target95 hypothetical protein CLIBASIA_00950 [Candidatus Liberib
1mkm_A_1-6464 ICLR transcriptional regulator; structural genomic 97.39
2o0y_A_1-9595 Transcriptional regulator; ICLR-family, structural 97.03
1j5y_A_1-7979 Transcriptional regulator, biotin repressor family 96.75
3i53_A_1-9090 O-methyltransferase; CO-complex, rossmann-like fol 96.6
2ia2_A_1-8686 Putative transcriptional regulator; SAD, PSI-2, st 96.47
3hrs_A_1-138138 Metalloregulator SCAR; DTXR/MNTR family member, tr 96.45
2g7u_A_1-7575 Transcriptional regulator; ICLR family, structural 96.42
1fx7_A_1-141141 Iron-dependent repressor IDER; DTXR, iron-dependen 96.41
3f6v_A_1-131131 Possible transcriptional regulator, ARSR family pr 96.36
1r1t_A_45-12278 Transcriptional repressor SMTB; zinc, transcriptio 96.33
2qq9_A_1-146146 Diphtheria toxin repressor; regulator, DTXR, helix 96.33
2heo_A_67 Z-DNA binding protein 1; protein DLM1/Z-DNA comple 96.31
1stz_A_1-105105 Heat-inducible transcription repressor HRCA homolo 96.2
1tw3_A_30-10980 COMT, carminomycin 4-O-methyltransferase; anthracy 96.04
1on2_A_142 Transcriptional regulator MNTR; helix-turn-helix, 96.0
2oqg_A_1-7979 Possible transcriptional regulator, ARSR family pr 95.94
2vxz_A_165 Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Py 95.94
2ip2_A_1-8989 Probable phenazine-specific methyltransferase; pyo 95.85
3f6o_A_118 Probable transcriptional regulator, ARSR family pr 95.85
3b73_A_111 PHIH1 repressor-like protein; winged-helix-turn-he 95.82
2jsc_A_118 Transcriptional regulator RV1994C/MT2050; cadmium, 95.7
1r1u_A_106 CZRA, repressor protein; zinc, DNA binding, transc 95.65
2p4w_A_1-7777 Transcriptional regulatory protein ARSR family; ar 95.65
2h09_A_155 Transcriptional regulator MNTR; transcription regu 95.64
2gxg_A_1-121121 146AA long hypothetical transcriptional regulator; 95.51
2kko_A_1-8282 Possible transcriptional regulatory protein (possi 95.51
1uly_A_10-8374 Hypothetical protein PH1932; helix-turn-helix, str 95.4
2hoe_A_1-8585 N-acetylglucosamine kinase; TM1224, structural gen 95.29
1u2w_A_28-12295 CADC repressor, cadmium efflux system accessory pr 95.22
2ia0_A_1-6666 Putative HTH-type transcriptional regulator PF0864 94.96
3cuo_A_10-9990 Uncharacterized HTH-type transcriptional regulator 94.94
1z05_A_1-105_403-429132 Transcriptional regulator, ROK family; structural 94.93
2pn6_A_1-5353 ST1022, 150AA long hypothetical transcriptional re 94.9
2e1c_A_1-7777 Putative HTH-type transcriptional regulator PH1519 94.88
1bia_A_1-6464 BIRA bifunctional protein; transcription regulatio 94.77
1jhf_A_1-7272 LEXA repressor; LEXA SOS repressor, hydrolase; 1.8 94.75
2r3s_A_17-9579 Uncharacterized protein; ZP_00112478.1, methyltran 94.64
1qzz_A_26-10883 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 94.58
2w25_A_1-5656 Probable transcriptional regulatory protein; trans 94.41
2htj_A_81 P fimbrial regulatory protein KS71A; winged helix- 94.41
2dbb_A_1-5858 Putative HTH-type transcriptional regulator PH0061 94.24
1qbj_A_81 Protein (double-stranded RNA specific adenosine de 94.16
3bdd_A_30-10273 Regulatory protein MARR; ZP_00875883.1, putative m 93.97
3f3x_A_1-122122 Transcriptional regulator, MARR family, putative; 93.95
1qgp_A_77 Protein (double stranded RNA adenosine deaminase); 93.87
2qlz_A_1-7676 Transcription factor PF0095; 2.50A {Pyrococcus fur 93.56
1z6r_A_1-82_382-406107 MLC protein; transcriptional repressor, ROK family 93.5
3i4p_A_1-5353 Transcriptional regulator, ASNC family; PSI, struc 93.3
2p5v_A_1-6060 Transcriptional regulator, LRP/ASNC family; NMB057 93.21
2fbh_A_35-10167 Transcriptional regulator PA3341; MARR, transcript 93.15
2cfx_A_1-5555 HTH-type transcriptional regulator LRPC; transcrip 93.09
2fsw_A_107 PG_0823 protein; alpha-beta structure, helix-turn- 93.0
3cjn_A_48-12578 Transcriptional regulator, MARR family; structural 92.96
3deu_A_1-139139 Transcriptional regulator SLYA; MARR, WING-helix, 92.91
1i1g_A_1-5454 Transcriptional regulator LRPA; helix-turn-helix, 92.75
2f2e_A_1-8686 PA1607; transcription factor, helix-TRUN-helix, AP 92.65
1y0u_A_96 Arsenical resistance operon repressor, putative; s 92.48
2cyy_A_1-5757 Putative HTH-type transcriptional regulator PH1519 92.42
2eth_A_1-130130 Transcriptional regulator, putative, MAR family; T 92.39
2rdp_A_1-127127 Putative transcriptional regulator MARR; PFAM PF01 92.37
3bj6_A_1-125125 Transcriptional regulator, MARR family; helix-turn 92.22
2a61_A_29-9466 Transcriptional regulator TM0710; APC4350, MCSG, m 92.2
3bpv_A_1-114114 Transcriptional regulator; MARR, DNA binding, tran 92.16
3ech_A_1-122122 MEXR, multidrug resistance operon repressor; winge 92.05
1ku9_A_1-8888 Hypothetical protein MJ223; putative transcription 91.8
1ub9_A_100 Hypothetical protein PH1061; helix-turn-helix moti 91.79
3cdh_A_31-133103 Transcriptional regulator, MARR family; helix-turn 91.78
2nnn_A_35-9965 Probable transcriptional regulator; structural gen 91.75
2fxa_A_45-12581 Protease production regulatory protein HPR; protea 91.54
1z91_A_34-11178 Organic hydroperoxide resistance transcriptional r 91.53
2hs5_A_1-9494 Putative transcriptional regulator GNTR; APC6050, 91.35
3cta_A_1-9191 Riboflavin kinase; structural genomics, transferas 91.34
3fm5_A_1-124124 Transcriptional regulator; MCSG, PF04017, PSI, MAR 91.33
3eco_A_1-119119 MEPR; mutlidrug efflux pump regulator winged helix 91.14
2pex_A_44-11471 Transcriptional regulator OHRR; transcription regu 91.01
1jgs_A_1-122122 Multiple antibiotic resistance protein MARR; trans 91.0
3hsr_A_1-119119 HTH-type transcriptional regulator SARZ; helix-tur 90.97
3g3z_A_30-12091 NMB1585, transcriptional regulator, MARR family; t 90.95
2fbi_A_35-10975 Probable transcriptional regulator; MARR, APC5816, 90.37
2nyx_A_43-10664 Probable transcriptional regulatory protein, RV140 90.36
3dp7_A_1-9999 SAM-dependent methyltransferase; structural genomi 90.31
3k0l_A_1-131131 Repressor protein; helix-turn-helix, structural ge 90.28
3boq_A_1-133133 Transcriptional regulator, MARR family; structural 90.21
>1mkm_A (A:1-64) ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} Back     alignment and structure
Probab=97.39  E-value=0.0002  Score=43.80  Aligned_cols=51  Identities=10%  Similarity=0.150  Sum_probs=47.9

Q ss_pred             HHHHHHC--CCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             9999858--89889999999829999999999999999417986479868981
Q gi|254780305|r   38 RIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT   88 (95)
Q Consensus        38 ~Il~~L~--~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~   88 (95)
                      +|+++++  ..++.+.+|++++|+|.++++.+|-.|+=.|+|.+.+.|+|++.
T Consensus        12 ~iL~~l~~~~~~~t~~eia~~~glp~st~~Rll~tL~~~g~l~~~~~~~Y~lG   64 (64)
T 1mkm_A           12 EILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYVPG   64 (64)
T ss_dssp             HHHHHHHHCSSCBCHHHHHHHTTCCHHHHHHHHHHHHHTTSEEECTTSCEEEC
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCCCEECC
T ss_conf             99999972899989999999879199999999999997798640577544227



>2o0y_A (A:1-95) Transcriptional regulator; ICLR-family, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>1j5y_A (A:1-79) Transcriptional regulator, biotin repressor family; structural genomics, TM1602, JCSG, conserved hypothetical protein, PSI; 2.30A {Thermotoga maritima} Back     alignment and structure
>3i53_A (A:1-90) O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2ia2_A (A:1-86) Putative transcriptional regulator; SAD, PSI-2, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Rhodococcus SP} Back     alignment and structure
>3hrs_A (A:1-138) Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>2g7u_A (A:1-75) Transcriptional regulator; ICLR family, structural genomics, MCSG, PSI, protein structure initiative, midwest center for structural genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>1fx7_A (A:1-141) Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3f6v_A (A:1-131) Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>1r1t_A (A:45-122) Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} Back     alignment and structure
>2qq9_A (A:1-146) Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, activation, DNA-binding, ferrous iron, cytoplasm; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure
>2heo_A (A:) Z-DNA binding protein 1; protein DLM1/Z-DNA complex, immune system/DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>1stz_A (A:1-105) Heat-inducible transcription repressor HRCA homolog; circe element, structural genomics, BSGC structure funded by NIH; 2.20A {Thermotoga maritima} Back     alignment and structure
>1tw3_A (A:30-109) COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} Back     alignment and structure
>1on2_A (A:) Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} Back     alignment and structure
>2oqg_A (A:1-79) Possible transcriptional regulator, ARSR family protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2vxz_A (A:) Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Pyrobaculum spherical virus} Back     alignment and structure
>2ip2_A (A:1-89) Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1- carboxylic acid, PHZM; 1.80A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3f6o_A (A:) Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>3b73_A (A:) PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>1r1u_A (A:) CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2p4w_A (A:1-77) Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged helix, DNA binding; 2.60A {Pyrococcus furiosus} Back     alignment and structure
>2h09_A (A:) Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>2gxg_A (A:1-121) 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>2kko_A (A:1-82) Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>1uly_A (A:10-83) Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2hoe_A (A:1-85) N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center for structural genomics, JCSG; 2.46A {Thermotoga maritima} Back     alignment and structure
>1u2w_A (A:28-122) CADC repressor, cadmium efflux system accessory protein; zinc, LEAD, SOFT metal ION resistance, ARSR/SMTB family, DNA binding protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2ia0_A (A:1-66) Putative HTH-type transcriptional regulator PF0864; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>3cuo_A (A:10-99) Uncharacterized HTH-type transcriptional regulator YGAV; DNA-binding transcriptional regulator, structural genomics, PSI, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>1z05_A (A:1-105,A:403-429) Transcriptional regulator, ROK family; structural genomics, PSI, protein structure initiative; 2.00A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
>2pn6_A (A:1-53) ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>1bia_A (A:1-64) BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} Back     alignment and structure
>1jhf_A (A:1-72) LEXA repressor; LEXA SOS repressor, hydrolase; 1.80A {Escherichia coli} Back     alignment and structure
>2r3s_A (A:17-95) Uncharacterized protein; ZP_00112478.1, methyltransferase domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>1qzz_A (A:26-108) RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in europe; HET: SAM; 2.10A {Streptomyces purpurascens} Back     alignment and structure
>2w25_A (A:1-56) Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>2htj_A (A:) P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} Back     alignment and structure
>2dbb_A (A:1-58) Putative HTH-type transcriptional regulator PH0061; ASNC family, helix-turn-helix (HTH) domain, structural genomics, NPPSFA; 2.00A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1qbj_A (A:) Protein (double-stranded RNA specific adenosine deaminase (ADAR1)); protein/Z-DNA complex, hydrolase/DNA complex; HET: DNA; 2.10A {Homo sapiens} Back     alignment and structure
>3bdd_A (A:30-102) Regulatory protein MARR; ZP_00875883.1, putative multiple antibiotic-resistance repressor (MARR), structural genomics; 2.20A {Streptococcus suis 89} Back     alignment and structure
>3f3x_A (A:1-122) Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>1qgp_A (A:) Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} Back     alignment and structure
>2qlz_A (A:1-76) Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>1z6r_A (A:1-82,A:382-406) MLC protein; transcriptional repressor, ROK family protein, DNA binding protein, helix-turn-helix, phosphotransferase system, metalloprotein; 2.70A {Escherichia coli} Back     alignment and structure
>3i4p_A (A:1-53) Transcriptional regulator, ASNC family; PSI, structural genomics, protein structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2p5v_A (A:1-60) Transcriptional regulator, LRP/ASNC family; NMB0573, structural genomics; 1.99A {Neisseria meningitidis MC58} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>2fbh_A (A:35-101) Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, PSI, protein structure initiative; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2cfx_A (A:1-55) HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} Back     alignment and structure
>2fsw_A (A:) PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn- HEIX, structural genomics, PSI; HET: MSE; 2.16A {Porphyromonas gingivalis W83} Back     alignment and structure
>3cjn_A (A:48-125) Transcriptional regulator, MARR family; structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3deu_A (A:1-139) Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} Back     alignment and structure
>1i1g_A (A:1-54) Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} Back     alignment and structure
>2f2e_A (A:1-86) PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>1y0u_A (A:) Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>2cyy_A (A:1-57) Putative HTH-type transcriptional regulator PH1519; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} Back     alignment and structure
>2eth_A (A:1-130) Transcriptional regulator, putative, MAR family; TM0816, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} Back     alignment and structure
>2rdp_A (A:1-127) Putative transcriptional regulator MARR; PFAM PF01047, winged-helix DNA binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>3bj6_A (A:1-125) Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, structural genomics, PSI-2; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2a61_A (A:29-94) Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} Back     alignment and structure
>3bpv_A (A:1-114) Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>3ech_A (A:1-122) MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} PDB: 1lnw_A Back     alignment and structure
>1ku9_A (A:1-88) Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ub9_A (A:) Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genomics, transcription; 2.05A {Pyrococcus horikoshii OT3} Back     alignment and structure
>3cdh_A (A:31-133) Transcriptional regulator, MARR family; helix-turn-hleix, structural genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2nnn_A (A:35-99) Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2fxa_A (A:45-125) Protease production regulatory protein HPR; protease porduction, regulation, structural genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} Back     alignment and structure
>1z91_A (A:34-111) Organic hydroperoxide resistance transcriptional regulator; OHRR, MARR family, bacterial transcription factor, DNA binding protein; 2.50A {Bacillus subtilis} Back     alignment and structure
>2hs5_A (A:1-94) Putative transcriptional regulator GNTR; APC6050, rhodococcus SP. RHA1, structural genomics, PSI-2, protein structure initiative; 2.20A {Rhodococcus SP} Back     alignment and structure
>3cta_A (A:1-91) Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3fm5_A (A:1-124) Transcriptional regulator; MCSG, PF04017, PSI, MARR, structural genomics, protein structure initiative; HET: GOL; 2.00A {Rhodococcus jostii RHA1} Back     alignment and structure
>3eco_A (A:1-119) MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2pex_A (A:44-114) Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>1jgs_A (A:1-122) Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor; HET: SAL; 2.30A {Escherichia coli} Back     alignment and structure
>3hsr_A (A:1-119) HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcriptional regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A Back     alignment and structure
>3g3z_A (A:30-120) NMB1585, transcriptional regulator, MARR family; transcription factor, structural genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2fbi_A (A:35-109) Probable transcriptional regulator; MARR, APC5816, structural genomics, PSI, protein structure initiative; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>2nyx_A (A:43-106) Probable transcriptional regulatory protein, RV1404; alpha/beta, structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>3dp7_A (A:1-99) SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research, nysgxrc; 2.33A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3k0l_A (A:1-131) Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>3boq_A (A:1-133) Transcriptional regulator, MARR family; structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure