254780306

254780306

DNA topoisomerase I

GeneID in NCBI database:8209288Locus tag:CLIBASIA_00955
Protein GI in NCBI database:254780306Protein Accession:YP_003064719.1
Gene range:+(194907, 197420)Protein Length:837aa
Gene description:DNA topoisomerase I
COG prediction:[L] Topoisomerase IA
KEGG prediction:DNA topoisomerase I (EC:5.99.1.2); K03168 DNA topoisomerase I [EC:5.99.1.2]
SEED prediction:DNA topoisomerase I (EC 5.99.1.2)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Conserved gene cluster associated with Met-tRNA formyltransferase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------
MNVIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPEKEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATDPDREGEAISWHVLDVLRQKNLIEKTKIQRVSFNAITKQVVLNAMKSPRDINLDLVNAYLARRALDYLVGFNLSPILWQKLPGARSAGRVQSVALRLICNRENQIESFVSEEYWSLSVLLETPRNDKFTAHLTDFNGQRIEKKSISNKKEADDLISFVKKATYSVEKIENKPIKRNPWPAFTTSTLQQVASSRLGFSASHTMRIAQKLYEGIDVNGEIVGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPEKPRIYSSKSKNAQEAHEAIRPNDFDFLPSKMKQFLDSDQFQLYNLIWKRSVASQMASAKFERTTVNIIATYNDQIGHLRTTGSLLCFDGFLKVWENQYDQEKNSEEDILLPYISANEQLIATETNASQHFTEPPPRYSESSLIKKMEEIGIGRPSTYATILETLYKRKYVIAEKRKILPQNTGRIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIKKLRISNVLDILNDTLSSVIFPPKENNEDSRTCPECHTHSLSLKLSSKYGAFVGCTNYPECKYTRQLTSNPQDIPEMKESVLLGNDLETKESVTLRSGRFGLYVQRGDGKDAKRCSLPKTWKSDSVDYDKAMSLLSLPREIGIHPETQKNIIAGTGKYGYYLNHDGAYTKLESIEQVLTIDLEQAISCITEKKKIEKSSRKNSKNQGHVIGTHPEGGSITVHNGRYGPYLHWKKINASLSKEESPDTVDLEKALKILNIKKQKKL
cEEEEEccHHHHHHHHHHcccccEEEEEEccEEcccccccccccccccccEEEEccccHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHcccccccccEEEEEEEccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccccccccccHHHHHHHHHHHHHHccccccEEEEEEEEEcccccEEEEEEEccccccccccccccHHHHHHHHHHHccccEEEEEEEcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccEEEccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEccccccEEEEEEEEEEEEccHHHHHcccccccccccccccccccccccEEEEcccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHcccEEEEccEEEEcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEccccccEEEcccccccccccccccccccccccccccccccccccccEEEEEccccccEEcccccccccccccccccccccccHHHHHHHHHcHHHccccccccccEEEcccccccEEEEccEEcccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccEEEEcccccccEEcccEEEEccccccHHHccHHHHHHHHHHHHHccc
ccEEEEEcHHHHHHHHHHcccccEEEEcccccccccccccccccccccccEEEEccHHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHcccEEEEEcccccccEEEEEEEEcccEEEEcccccHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHcHHHccccccHHHHHHHcHHHHHHHHccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccEEEEEEccEEEEEccEEEEEEcccccccccHHcccccccccccccccEEEcccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEccccccEEEccccccccccccccccHHHccccccccEcccccccccEEEEEccccccEEEEccccccccccccccccHccccHHHHHHHHccccEcccccccccEEEEEccccccEEEEcccEccccccccccEccHHHHHHHHHccHHcccccccccccHHHHHcccccccEEEEEccccccEEEcccEEcEcccccccccccHHHHHHHHHHHHHccc
MNVIIVESPAKAKTISKYLGSNYKVlssfghirdlpakkgsvlpekefemiwnidpssqKHLQNIIHAVKSSTIlilatdpdregeaiSWHVLDVLRQKNLIEKTKIQRVSFNAITKQVVLNamksprdiNLDLVNAYLARRALDYLVgfnlspilwqklpgarsagrVQSVALRLICNRENQIESFVSEEYWSLSVLletprndkftahltdfngqriekksisnkkeADDLISFVKKATYSVekienkpikrnpwpafttstLQQVAssrlgfsasHTMRIAQKLYEGIDVNGEIVGLITYmrtdgvhmspDALEAVRRSITShygdhylpekpriyssksknaqeaheairpndfdflpskmkqfldsdQFQLYNLIWKRSVASQMASAKFERTTVNIIATYNDqighlrttgsllCFDGFLKVWENQYdqeknseedillpYISANEQLIATEtnasqhfteppprysessLIKKMEeigigrpsTYATILETLYKRKYVIAEKrkilpqntgRIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIKKLRISNVLDILNDTlssvifppkennedsrtcpechthslslklsskygafvgctnypeckytrqltsnpqdipemkesvllgndletkesvtlrsgrfglyvqrgdgkdakrcslpktwksdsvdyDKAMSLlslpreigihpetqkniiagtgkygyylnhdgayTKLESIEQVLTIDLEQAISCITEKKKIEKSsrknsknqghvigthpeggsitvhngrygpylhwkkinaslskeespdtVDLEKALKILNIKKQKKL
mnviivespakakTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPEKEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATDPDREGEAISWHVLDVLRQKNLIektkiqrvsfnAITKQVvlnamksprdiNLDLVNAYLARRALDYLVGFNLSPILWQKLPGARSAGRVQSVALRLICNRENQIESFVSEEYWSLSVLLETPRNDKFtahltdfngqriekksisnkkeaddlISFVKKATysvekienkpikrnpwpaFTTSTLQQVASSRLGFSASHTMRIAQKLyegidvngEIVGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPEKPRIYSSKSKNAQEAHEAIRPNDFDFLPSKMKQFLDSDQFQLYNLIWKRSVASQMASAKFERTTVNIIATYNDQIGHLRTTGSLLCFDGFLKVWENQYDQEKNSEEDILLPYISANEQLIATEtnasqhftepppryseSSLIKKMEeigigrpstyATILETLYKRKYVIAekrkilpqntgrIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIKKLRISNVLDILNDTLSsvifppkennedsrtcpECHTHSLSLKLSSKYGAFVGCTNYPECKYTRqltsnpqdipEMKESVLLGndletkesvtlrsgrfglyvqrgdgkdakrcslpktwksdsvdyDKAMSLLSLPREIGIHPETQKNIIAGTGKYGYYLNHDGAYTKLESIEQVLTIDLEQAISCITekkkiekssrknsknqghvigthpeggsitvHNGRYGPYLHWKKINASlskeespdtvDLEKALkilnikkqkkl
MNVIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPEKEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATDPDREGEAISWHVLDVLRQKNLIEKTKIQRVSFNAITKQVVLNAMKSPRDINLDLVNAYLARRALDYLVGFNLSPILWQKLPGARSAGRVQSVALRLICNRENQIESFVSEEYWSLSVLLETPRNDKFTAHLTDFNGQRIEKKSISNKKEADDLISFVKKATYSVEKIENKPIKRNPWPAFTTSTLQQVASSRLGFSASHTMRIAQKLYEGIDVNGEIVGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPEKPRIYSSKSKNAQEAHEAIRPNDFDFLPSKMKQFLDSDQFQLYNLIWKRSVASQMASAKFERTTVNIIATYNDQIGHLRTTGSLLCFDGFLKVWENQYDQEKNSEEDILLPYISANEQLIATETNASQHFTEPPPRYSESSLIKKMEEIGIGRPSTYATILETLYKRKYVIAEKRKILPQNTGRIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIKKLRISNVLDILNDTLSSVIFPPKENNEDSRTCPECHTHslslklsskYGAFVGCTNYPECKYTRQLTSNPQDIPEMKESVLLGNDLETKESVTLRSGRFGLYVQRGDGKDAKRCSLPKTWKSDSVDYDKAMSLLSLPREIGIHPETQKNIIAGTGKYGYYLNHDGAYTKLESIEQVLTIDLEQAISCITEKKKIEKSSRKNSKNQGHVIGTHPEGGSITVHNGRYGPYLHWKKINASLSKEESPDTVDLEkalkilnikkqkkl
MNVIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPEKEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATDPDREGEAISWHVLDVLRQKNLIEKTKIQRVSFNAITKQVVLNAMKSPRDINLDLVNAYLARRALDYLVGFNLSPILWQKLPGARSAGRVQSVALRLICNRENQIESFVSEEYWSLSVLLETPRNDKFTAHLTDFNGQRIEKKSISNKKEADDLISFVKKATYSV**IE******NPWPAFTTSTLQQVASSRLGFSASHTMRIAQKLYEGIDVNGEIVGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPE************QEAHEAIRPNDFDFLPSKMKQFLDSDQFQLYNLIWKRSVASQMASAKFERTTVNIIATYNDQIGHLRTTGSLLCFDGFLKVWEN***************YISANEQLIATETNASQHFTEPPPRYSESSLIKKMEEIGIGRPSTYATILETLYKRKYVIAEKRKILPQNTGRIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKID*********VLDILNDTLSSVIFPPKENNEDSRTCPECHTHSLSLKLSSKYGAFVGCTNYPECKYTRQLT***************GNDLETKESVTLRSGRFGLYVQRGDGKDAKRCSLPKTWKSDSVDYDKAMSLLSLPREIGIHPETQKNIIAGTGKYGYYLNHDGAYTKLESIEQVLTIDLEQAISC*********************IGTHPEGGSITVHNGRYGPYLHWKKINASLSKEESPDTVDLEKALKILNIKKQ***
MNVIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPEKEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATDPDREGEAISWHVLDVLRQKNLIEKTKIQRVSFNAITKQVVLNAMKSPRDINLDLVNAYLARRALDYLVGFNLSPILWQKL*********QSVALRLICNRENQIESFVSEEYWSLSVLLETPRNDKFTAHLTDFNGQRIEKKSISNKKEADDLISFVKKATYSVEKIENKPIKRNPWPAFTTSTLQQVASSRLGFSASHTMRIAQKLYEGIDVNGEIVGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPEKPRIYS**********EAIRPNDFDFLPSKMKQFLDSDQFQLYNLIWKRSVASQMASAKFERTTVNIIATYNDQIGHLRTTGSLLCFDGFLKVWENQYDQEKNSEEDILLPYISANEQLIATETNAS*************SLIKKMEEIGIGRPSTYATILETLYKRKYVIAEKRKILPQNTGRIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIKKLRISNVLDILNDTLSSVIFPPK*************THSLSLKLSSKYGAFVGCTNYPECKYTRQLTSNPQDIPEMKESVLLGNDLETKESVTLRSGRFGLYVQRGDGKDAKRCSLPKTWKSDSVDYDKAMSLLSLPREIGIHPETQKNIIAGTGKYGYYLNHDGAYTKLESIEQVLTIDLEQAISCITEKK************QGHVIGTHPEGGSITVHNGRYGPYLHWKKINAS**********DLEKALKILNIKKQKKL
MNVIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPEKEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATDPDREGEAISWHVLDVLRQKNLIEKTKIQRVSFNAITKQVVLNAMKSPRDINLDLVNAYLARRALDYLVGFNLSPILWQKLPGARSAGRVQSVALRLICNRENQIESFVSEEYWSLSVLLETPRNDKFTAHLTDFNGQRIEKKSISNKKEADDLISFVKKATYSVEKIENKPIKRNPWPAFTTSTLQQVASSRLGFSASHTMRIAQKLYEGIDVNGEIVGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPEKPRIYSSKSKNAQEAHEAIRPNDFDFLPSKMKQFLDSDQFQLYNLIWKRSVASQMASAKFERTTVNIIATYNDQIGHLRTTGSLLCFDGFLKVWENQY*****S**DILLPYISANEQLIATETNASQHFTEPPPRYSESSLIKKMEEIGIGRPSTYATILETLYKRKYVIAEKRKILPQNTGRIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIKKLRISNVLDILNDTLSSVIFPPKENNEDSRTCPECHTHSLSLKLSSKYGAFVGCTNYPECKYTRQLTSNPQDIPEMKESVLLGNDLETKESVTLRSGRFGLYVQRGDGKDAKRCSLPKTWKSDSVDYDKAMSLLSLPREIGIHPETQKNIIAGTGKYGYYLNHDGAYTKLESIEQVLTIDLEQAISCITEKKK*********KNQGHVIGTHPEGGSITVHNGRYGPYLHWKKINASLSKEESPDTVDLEKALKILNIKK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPEKEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATDPDREGEAISWHVLDVLRQKNLIEKTKIQRVSFNAITKQVVLNAMKSPRDINLDLVNAYLARRALDYLVGFNLSPILWQKLPGARSAGRVQSVALRLICNRENQIESFVSEEYWSLSVLLETPRNDKFTAHLTDFNGQRIEKKSISNKKEADDLISFVKKATYSVEKIENKPIKRNPWPAFTTSTLQQVASSRLGFSASHTMRIAQKLYEGIDVNGEIVGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPEKPRIYSSKSKNAQEAHEAIRPNDFDFLPSKMKQFLDSDQFQLYNLIWKRSVASQMASAKFERTTVNIIATYNDQIGHLRTTGSLLCFDGFLKVWENQYDQEKNSEEDILLPYISANEQLIATETNASQHFTEPPPRYSESSLIKKMEEIGIGRPSTYATILETLYKRKYVIAEKRKILPQNTGRIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIKKLRISNVLDILNDTLSSVIFPPKENNEDSRTCPECHTHSLSLKLSSKYGAFVGCTNYPECKYTRQLTSNPQDIPEMKESVLLGNDLETKESVTLRSGRFGLYVQRGDGKDAKRCSLPKTWKSDSVDYDKAMSLLSLPREIGIHPETQKNIIAGTGKYGYYLNHDGAYTKLESIEQVLTIDLEQAISCITEKKKIEKSSRKNSKNQGHVIGTHPEGGSITVHNGRYGPYLHWKKINASLSKEESPDTVDLEKALKILNIKKQKKL
MNVIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPEKEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATDPDREGEAISWHVLDVLRQKNLIEKTKIQRVSFNAITKQVVLNAMKSPRDINLDLVNAYLARRALDYLVGFNLSPILWQKLPGARSAGRVQSVALRLICNRENQIESFVSEEYWSLSVLLETPRNDKFTAHLTDFNGQRIEKKSISNKKEADDLISFVKKATYSVEKIENKPIKRNPWPAFTTSTLQQVASSRLGFSASHTMRIAQKLYEGIDVNGEIVGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPEKPRIYSSKSKNAQEAHEAIRPNDFDFLPSKMKQFLDSDQFQLYNLIWKRSVASQMASAKFERTTVNIIATYNDQIGHLRTTGSLLCFDGFLKVWENQYDQEKNSEEDILLPYISANEQLIATETNASQHFTEPPPRYSESSLIKKMEEIGIGRPSTYATILETLYKRKYVIAEKRKILPQNTGRIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIKKLRISNVLDILNDTLSSVIFPPKENNEDSRTCPECHTHSLSLKLSSKYGAFVGCTNYPECKYTRQLTSNPQDIPEMKESVLLGNDLETKESVTLRSGRFGLYVQRGDGKDAKRCSLPKTWKSDSVDYDKAMSLLSLPREIGIHPETQKNIIAGTGKYGYYLNHDGAYTKLESIEQVLTIDLEQAISCITEKKKIEKSSRKNSKNQGHVIGTHPEGGSITVHNGRYGPYLHWKKINASLSKEESPDTVDLEKALKILNIKKQKKL
MNVIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPEKEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATDPDREGEAISWHVLDVLRQKNLIEKTKIQRVSFNAITKQVVLNAMKSPRDINLDLVNAYLARRALDYLVGFNLSPILWQKLPGARSAGRVQSVALRLICNRENQIESFVSEEYWSLSVLLETPRNDKFTAHLTDFNGQRIEKKSISNKKEADDLISFVKKATYSVEKIENKPIKRNPWPAFTTSTLQQVASSRLGFSASHTMRIAQKLYEGIDVNGEIVGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPEKPRIYSSKSKNAQEAHEAIRPNDFDFLPSKMKQFLDSDQFQLYNLIWKRSVASQMASAKFERTTVNIIATYNDQIGHLRTTGSLLCFDGFLKVWENQYDQEKNSEEDILLPYISANEQLIATETNASQHFTEPPPRYSESSLIKKMEEIGIGRPSTYATILETLYKRKYVIAEKRKILPQNTGRIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIKKLRISNVLDILNDTLSSVIFPPKENNEDSRTCPECHTHSLSLKLSSKYGAFVGCTNYPECKYTRQLTSNPQDIPEMKESVLLGNDLETKESVTLRSGRFGLYVQRGDGKDAKRCSLPKTWKSDSVDYDKAMSLLSLPREIGIHPETQKNIIAGTGKYGYYLNHDGAYTKLESIEQVLTIDLEQAISCITEKKKIEKSSRKNSKNQGHVIGTHPEGGSITVHNGRYGPYLHWKKINASLSKEESPDTVDLEKALKILNIKKQKKL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target837 DNA topoisomerase I [Candidatus Liberibacter asiaticus
315122270840 DNA topoisomerase I [Candidatus Liberibacter solanacear 1 0.0
222148309904 DNA topoisomerase I [Agrobacterium vitis S4] Length = 9 1 0.0
222085613889 DNA topoisomerase I [Agrobacterium radiobacter K84] Len 1 0.0
190891321884 DNA topoisomerase I protein [Rhizobium etli CIAT 652] L 1 0.0
116251501884 DNA topoisomerase I [Rhizobium leguminosarum bv. viciae 1 0.0
209548898884 DNA topoisomerase I [Rhizobium leguminosarum bv. trifol 1 0.0
327194843884 DNA topoisomerase I protein [Rhizobium etli CNPAF512] L 1 0.0
86357272884 DNA topoisomerase I [Rhizobium etli CFN 42] Length = 88 1 0.0
241204122884 DNA topoisomerase I [Rhizobium leguminosarum bv. trifol 1 0.0
227821655890 DNA topoisomerase I [Sinorhizobium fredii NGR234] Lengt 1 0.0
>gi|315122270|ref|YP_004062759.1| DNA topoisomerase I [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 840 Back     alignment and organism information
 Score = 1405 bits (3636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/837 (80%), Positives = 748/837 (89%), Gaps = 1/837 (0%)

Query: 1   MNVIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAKKGSVLPEKEFEMIWNIDPSSQK 60
           MNVIIVESPAKAKTISKYLG +YKVLSSFGH+RDLPAKKGSVLPEK FEM+W  D SSQK
Sbjct: 1   MNVIIVESPAKAKTISKYLGPDYKVLSSFGHVRDLPAKKGSVLPEKNFEMLWETDKSSQK 60

Query: 61  HLQNIIHAVKSSTILILATDPDREGEAISWHVLDVLRQKNLIEKTKIQRVSFNAITKQVV 120
           HL+NII AVKSST+LILATDPDREGEAISWHVLD+LRQ+NLI + KI+RVSFNAITK+VV
Sbjct: 61  HLENIISAVKSSTLLILATDPDREGEAISWHVLDILRQRNLIGERKIKRVSFNAITKKVV 120

Query: 121 LNAMKSPRDINLDLVNAYLARRALDYLVGFNLSPILWQKLPGARSAGRVQSVALRLICNR 180
           LNAM++ RD+NLDLVNAYLARRALDYLVGFNLSPILW+KLPGARSAGRVQSVALRLIC+R
Sbjct: 121 LNAMENTRDLNLDLVNAYLARRALDYLVGFNLSPILWRKLPGARSAGRVQSVALRLICHR 180

Query: 181 ENQIESFVSEEYWSLSVLLETPRNDKFTAHLTDFNGQRIEKKSISNKKEADDLISFVKKA 240
           ENQIE FVSEEYW LSVLLETPR DKF A L DFNGQRIEK SI NKKEAD LISF++KA
Sbjct: 181 ENQIECFVSEEYWLLSVLLETPRGDKFIARLVDFNGQRIEKTSIGNKKEADKLISFLEKA 240

Query: 241 TYSVEKIENKPIKRNPWPAFTTSTLQQVASSRLGFSASHTMRIAQKLYEGIDVNGEIVGL 300
           TY V+  E KPIKRNPWPAFTTSTLQQ ASSRLGFS S+TMRIAQKLYEGIDVNGE+VGL
Sbjct: 241 TYIVKNTETKPIKRNPWPAFTTSTLQQAASSRLGFSPSYTMRIAQKLYEGIDVNGEVVGL 300

Query: 301 ITYMRTDGVHMSPDALEAVRRSITSHYGDHYLPEKPRIYSSKSKNAQEAHEAIRPNDFDF 360
           ITYMRTD VH+S DALE VRRSI+S++G+ YLP+KPRIYS K+KNAQEAHEAIRPNDF+F
Sbjct: 301 ITYMRTDSVHLSLDALEEVRRSISSNFGNSYLPDKPRIYSVKAKNAQEAHEAIRPNDFNF 360

Query: 361 LPSKMKQFLDSDQFQLYNLIWKRSVASQMASAKFERTTVNIIATYNDQIGHLRTTGSLLC 420
           LPS+MK+FLDSDQFQLYNLIWKRSVASQMASA+FERTT++I ATY DQI HLRT GS L 
Sbjct: 361 LPSEMKKFLDSDQFQLYNLIWKRSVASQMASAEFERTTISIDATYEDQIAHLRTVGSCLR 420

Query: 421 FDGFLKVWENQYDQEKNSEEDILLPYISANEQLIATETNASQHFTEPPPRYSESSLIKKM 480
           FDGFLKVWENQ DQE NS+ED LLP I+ NE+L+A ETNASQHFTE P RYSESSLIKKM
Sbjct: 421 FDGFLKVWENQNDQENNSDEDKLLPCINKNEKLLAKETNASQHFTEAPLRYSESSLIKKM 480

Query: 481 EEIGIGRPSTYATILETLYKRKYVIAEKRKILPQNTGRIVTAFLENFFSQYVEYDFTADL 540
           EE+GIGRPSTYA ILETL KR+Y++ EKRK+ PQNTGRIVTAFLENFFS+YVEYDFTADL
Sbjct: 481 EELGIGRPSTYAAILETLSKRRYIVIEKRKLFPQNTGRIVTAFLENFFSRYVEYDFTADL 540

Query: 541 EEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIKKLRISNVLDILNDTLSSVIFPPKENNE 600
           EEKLD+IS+GKL+WKEVLHEFW+EFIEKIDS K+LR SNVLDILNDTLSSVIFP K+NNE
Sbjct: 541 EEKLDKISSGKLDWKEVLHEFWKEFIEKIDSTKELRTSNVLDILNDTLSSVIFPAKDNNE 600

Query: 601 DSRTCPECHTHSLSLKLSSKYGAFVGCTNYPECKYTRQL-TSNPQDIPEMKESVLLGNDL 659
           DSRTCP C  + LS+KLSSKYGAFVGCTNYPECKYTRQL TSN Q I E  E +LLG+D 
Sbjct: 601 DSRTCPSCQKNPLSIKLSSKYGAFVGCTNYPECKYTRQLTTSNQQYIEENLEPLLLGDDP 660

Query: 660 ETKESVTLRSGRFGLYVQRGDGKDAKRCSLPKTWKSDSVDYDKAMSLLSLPREIGIHPET 719
           ETKE +TLRSGRFG YVQRGDGKDAKRC LPK W  +S+DYDKA+SL+SLPREIGIHPET
Sbjct: 661 ETKEPITLRSGRFGFYVQRGDGKDAKRCGLPKNWDRESIDYDKALSLISLPREIGIHPET 720

Query: 720 QKNIIAGTGKYGYYLNHDGAYTKLESIEQVLTIDLEQAISCITEKKKIEKSSRKNSKNQG 779
           QK+IIA  GKYG YL HDG +TKLESIEQVLTI+L+QAISC+ +K K EKSSR ++KNQG
Sbjct: 721 QKSIIASMGKYGCYLKHDGHHTKLESIEQVLTINLDQAISCMIQKNKKEKSSRTSTKNQG 780

Query: 780 HVIGTHPEGGSITVHNGRYGPYLHWKKINASLSKEESPDTVDLEKALKILNIKKQKK 836
           HVIG HPEGGSIT+H GRYGPYL+W KINAS+   E+PDT+DLE ALKI   K + K
Sbjct: 781 HVIGIHPEGGSITIHRGRYGPYLNWGKINASIPNNENPDTIDLENALKIFETKIKGK 837


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148309|ref|YP_002549266.1| DNA topoisomerase I [Agrobacterium vitis S4] Length = 904 Back     alignment and organism information
>gi|222085613|ref|YP_002544143.1| DNA topoisomerase I [Agrobacterium radiobacter K84] Length = 889 Back     alignment and organism information
>gi|190891321|ref|YP_001977863.1| DNA topoisomerase I protein [Rhizobium etli CIAT 652] Length = 884 Back     alignment and organism information
>gi|116251501|ref|YP_767339.1| DNA topoisomerase I [Rhizobium leguminosarum bv. viciae 3841] Length = 884 Back     alignment and organism information
>gi|209548898|ref|YP_002280815.1| DNA topoisomerase I [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 884 Back     alignment and organism information
>gi|327194843|gb|EGE61677.1| DNA topoisomerase I protein [Rhizobium etli CNPAF512] Length = 884 Back     alignment and organism information
>gi|86357272|ref|YP_469164.1| DNA topoisomerase I [Rhizobium etli CFN 42] Length = 884 Back     alignment and organism information
>gi|241204122|ref|YP_002975218.1| DNA topoisomerase I [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 884 Back     alignment and organism information
>gi|227821655|ref|YP_002825625.1| DNA topoisomerase I [Sinorhizobium fredii NGR234] Length = 890 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target837 DNA topoisomerase I [Candidatus Liberibacter asiaticus
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit omega; 0.0
PRK06599675 PRK06599, PRK06599, DNA topoisomerase I; Validated 0.0
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusi 1e-168
PRK05582650 PRK05582, PRK05582, DNA topoisomerase I; Validated 0.0
TIGR01051610 TIGR01051, topA_bact, DNA topoisomerase I, bacterial 0.0
PRK07219822 PRK07219, PRK07219, DNA topoisomerase I; Validated 8e-80
PRK07726658 PRK07726, PRK07726, DNA topoisomerase III; Provisional 2e-63
TIGR01057618 TIGR01057, topA_arch, DNA topoisomerase I, archaeal 5e-61
TIGR01056660 TIGR01056, topB, DNA topoisomerase III, bacteria and co 5e-49
PRK08780780 PRK08780, PRK08780, DNA topoisomerase I; Provisional 0.0
PRK094011176 PRK09401, PRK09401, reverse gyrase; Reviewed 9e-83
COG11101187 COG1110, COG1110, Reverse gyrase [DNA replication, reco 4e-77
TIGR010541171 TIGR01054, rgy, reverse gyrase 9e-72
PRK05776670 PRK05776, PRK05776, DNA topoisomerase I; Provisional 1e-66
PRK08173862 PRK08173, PRK08173, DNA topoisomerase III; Validated 1e-36
COG0550570 COG0550, TopA, Topoisomerase IA [DNA replication, recom 1e-178
pfam01131403 pfam01131, Topoisom_bac, DNA topoisomerase 1e-116
cd00186381 cd00186, TOP1Ac, DNA Topoisomerase, subtype IA; DNA-bin 1e-109
KOG1956758 KOG1956, KOG1956, KOG1956, DNA topoisomerase III alpha 1e-78
PRK14973 936 PRK14973, PRK14973, DNA topoisomerase I; Provisional 9e-56
PRK14724 987 PRK14724, PRK14724, DNA topoisomerase III; Provisional 2e-30
smart00437259 smart00437, TOP1Ac, Bacterial DNA topoisomerase I DNA-b 4e-74
COG1754298 COG1754, COG1754, Uncharacterized C-terminal domain of 3e-59
PRK07220740 PRK07220, PRK07220, DNA topoisomerase I; Validated 2e-57
cd03363123 cd03363, TOPRIM_TopoIA_TopoI, TOPRIM_TopoIA_TopoI: The 1e-44
cd01028142 cd01028, TOPRIM_TopoIA, TOPRIM_TopoIA: topoisomerase-pr 2e-32
pfam0175189 pfam01751, Toprim, Toprim domain 6e-15
cd03362151 cd03362, TOPRIM_TopoIA_TopoIII, TOPRIM_TopoIA_TopoIII: 9e-14
smart0049376 smart00493, TOPRIM, topoisomerases, DnaG-type primases, 4e-13
cd03361170 cd03361, TOPRIM_TopoIA_RevGyr, TopoIA_RevGyr : The topo 6e-12
cd0018883 cd00188, TOPRIM, Topoisomerase-primase domain 5e-10
PTZ00407805 PTZ00407, PTZ00407, DNA topoisomerase IA; Provisional 8e-33
KOG1957555 KOG1957, KOG1957, KOG1957, DNA topoisomerase III beta [ 5e-08
smart0043689 smart00436, TOP1Bc, Bacterial DNA topoisomeraes I ATP-b 2e-29
PRK14701 1638 PRK14701, PRK14701, reverse gyrase; Provisional 3e-28
PRK147011638 PRK14701, PRK14701, reverse gyrase; Provisional 7e-27
PRK08780780 PRK08780, PRK08780, DNA topoisomerase I; Provisional 2e-22
PRK08780780 PRK08780, PRK08780, DNA topoisomerase I; Provisional 7e-10
COG1754298 COG1754, COG1754, Uncharacterized C-terminal domain of 8e-10
pfam0139639 pfam01396, zf-C4_Topoisom, Topoisomerase DNA binding C4 3e-08
PRK07219822 PRK07219, PRK07219, DNA topoisomerase I; Validated 5e-07
COG0551140 COG0551, TopA, Zn-finger domain associated with topoiso 0.002
>gnl|CDD|181030 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|180637 PRK06599, PRK06599, DNA topoisomerase I; Validated Back     alignment and domain information
>gnl|CDD|180527 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|180146 PRK05582, PRK05582, DNA topoisomerase I; Validated Back     alignment and domain information
>gnl|CDD|162175 TIGR01051, topA_bact, DNA topoisomerase I, bacterial Back     alignment and domain information
>gnl|CDD|180891 PRK07219, PRK07219, DNA topoisomerase I; Validated Back     alignment and domain information
>gnl|CDD|181093 PRK07726, PRK07726, DNA topoisomerase III; Provisional Back     alignment and domain information
>gnl|CDD|162179 TIGR01057, topA_arch, DNA topoisomerase I, archaeal Back     alignment and domain information
>gnl|CDD|162178 TIGR01056, topB, DNA topoisomerase III, bacteria and conjugative plasmid Back     alignment and domain information
>gnl|CDD|181555 PRK08780, PRK08780, DNA topoisomerase I; Provisional Back     alignment and domain information
>gnl|CDD|181823 PRK09401, PRK09401, reverse gyrase; Reviewed Back     alignment and domain information
>gnl|CDD|31307 COG1110, COG1110, Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|162177 TIGR01054, rgy, reverse gyrase Back     alignment and domain information
>gnl|CDD|180251 PRK05776, PRK05776, DNA topoisomerase I; Provisional Back     alignment and domain information
>gnl|CDD|181267 PRK08173, PRK08173, DNA topoisomerase III; Validated Back     alignment and domain information
>gnl|CDD|30896 COG0550, TopA, Topoisomerase IA [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|144649 pfam01131, Topoisom_bac, DNA topoisomerase Back     alignment and domain information
>gnl|CDD|73184 cd00186, TOP1Ac, DNA Topoisomerase, subtype IA; DNA-binding, ATP-binding and catalytic domain of bacterial DNA topoisomerases I and III, and eukaryotic DNA topoisomerase III and eubacterial and archael reverse gyrases Back     alignment and domain information
>gnl|CDD|37167 KOG1956, KOG1956, KOG1956, DNA topoisomerase III alpha [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|184936 PRK14973, PRK14973, DNA topoisomerase I; Provisional Back     alignment and domain information
>gnl|CDD|184805 PRK14724, PRK14724, DNA topoisomerase III; Provisional Back     alignment and domain information
>gnl|CDD|128714 smart00437, TOP1Ac, Bacterial DNA topoisomerase I DNA-binding domain Back     alignment and domain information
>gnl|CDD|31940 COG1754, COG1754, Uncharacterized C-terminal domain of topoisomerase IA [General function prediction only] Back     alignment and domain information
>gnl|CDD|180892 PRK07220, PRK07220, DNA topoisomerase I; Validated Back     alignment and domain information
>gnl|CDD|173783 cd03363, TOPRIM_TopoIA_TopoI, TOPRIM_TopoIA_TopoI: The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to Escherichia coli DNA topoisomerase I Back     alignment and domain information
>gnl|CDD|173778 cd01028, TOPRIM_TopoIA, TOPRIM_TopoIA: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in the type IA family of DNA topoisomerases (TopoIA) Back     alignment and domain information
>gnl|CDD|145089 pfam01751, Toprim, Toprim domain Back     alignment and domain information
>gnl|CDD|173782 cd03362, TOPRIM_TopoIA_TopoIII, TOPRIM_TopoIA_TopoIII: The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to topoisomerase III Back     alignment and domain information
>gnl|CDD|128769 smart00493, TOPRIM, topoisomerases, DnaG-type primases, OLD family nucleases and RecR proteins Back     alignment and domain information
>gnl|CDD|173781 cd03361, TOPRIM_TopoIA_RevGyr, TopoIA_RevGyr : The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to the ATP-dependent reverse gyrase found in archaea and thermophilic bacteria Back     alignment and domain information
>gnl|CDD|173773 cd00188, TOPRIM, Topoisomerase-primase domain Back     alignment and domain information
>gnl|CDD|173597 PTZ00407, PTZ00407, DNA topoisomerase IA; Provisional Back     alignment and domain information
>gnl|CDD|37168 KOG1957, KOG1957, KOG1957, DNA topoisomerase III beta [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|128713 smart00436, TOP1Bc, Bacterial DNA topoisomeraes I ATP-binding domain Back     alignment and domain information
>gnl|CDD|184796 PRK14701, PRK14701, reverse gyrase; Provisional Back     alignment and domain information
>gnl|CDD|184796 PRK14701, PRK14701, reverse gyrase; Provisional Back     alignment and domain information
>gnl|CDD|181555 PRK08780, PRK08780, DNA topoisomerase I; Provisional Back     alignment and domain information
>gnl|CDD|181555 PRK08780, PRK08780, DNA topoisomerase I; Provisional Back     alignment and domain information
>gnl|CDD|31940 COG1754, COG1754, Uncharacterized C-terminal domain of topoisomerase IA [General function prediction only] Back     alignment and domain information
>gnl|CDD|110400 pfam01396, zf-C4_Topoisom, Topoisomerase DNA binding C4 zinc finger Back     alignment and domain information
>gnl|CDD|180891 PRK07219, PRK07219, DNA topoisomerase I; Validated Back     alignment and domain information
>gnl|CDD|30897 COG0551, TopA, Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 837 DNA topoisomerase I [Candidatus Liberibacter asiaticus
PRK09138887 DNA topoisomerase I; Validated 100.0
PRK07941933 DNA topoisomerase I; Validated 100.0
PRK07561878 DNA topoisomerase I; Validated 100.0
PRK08780783 DNA topoisomerase III; Provisional 100.0
PRK06599776 DNA topoisomerase I; Validated 100.0
PRK09137761 DNA topoisomerase I; Validated 100.0
PRK07219769 DNA topoisomerase I; Validated 100.0
PRK08173857 DNA topoisomerase III; Validated 100.0
KOG1956758 consensus 100.0
TIGR01051688 topA_bact DNA topoisomerase I; InterPro: IPR005733 DNA 100.0
PRK09001869 DNA topoisomerase I; Validated 100.0
PRK08174670 DNA topoisomerase III; Validated 100.0
PRK07141622 DNA topoisomerase I; Validated 100.0
PRK07726716 DNA topoisomerase III; Provisional 100.0
TIGR01056755 topB DNA topoisomerase III; InterPro: IPR005738 DNA top 100.0
TIGR01057637 topA_arch DNA topoisomerase I; InterPro: IPR005739 DNA 100.0
PRK06319864 DNA topoisomerase I/SWI domain fusion protein; Validate 100.0
PRK05582692 DNA topoisomerase I; Validated 100.0
PRK08938692 DNA topoisomerase I; Validated 100.0
PRK08413733 consensus 100.0
PRK05823691 consensus 100.0
PRK08620726 DNA topoisomerase III; Provisional 100.0
PRK07220740 DNA topoisomerase I; Validated 100.0
COG0550570 TopA Topoisomerase IA [DNA replication, recombination, 100.0
PRK094011176 reverse gyrase; Reviewed 100.0
PRK09031649 DNA topoisomerase III; Provisional 100.0
COG11101187 Reverse gyrase [DNA replication, recombination, and rep 100.0
TIGR010541843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 100.0
KOG1957555 consensus 100.0
PRK05776675 DNA topoisomerase III; Provisional 100.0
pfam01131403 Topoisom_bac DNA topoisomerase. This subfamily of topoi 100.0
cd00186381 TOP1Ac DNA Topoisomerase, subtype IA; DNA-binding, ATP- 100.0
smart00437259 TOP1Ac Bacterial DNA topoisomerase I DNA-binding domain 100.0
COG1754298 Uncharacterized C-terminal domain of topoisomerase IA [ 100.0
cd03363123 TOPRIM_TopoIA_TopoI TOPRIM_TopoIA_TopoI: The topoisomer 100.0
cd03361170 TOPRIM_TopoIA_RevGyr TopoIA_RevGyr : The topoisomerase- 100.0
cd01028142 TOPRIM_TopoIA TOPRIM_TopoIA: topoisomerase-primase (TOP 99.97
cd03362151 TOPRIM_TopoIA_TopoIII TOPRIM_TopoIA_TopoIII: The topois 99.97
LOAD_Toprim98 consensus 99.93
pfam0175189 Toprim Toprim domain. This is a conserved region from D 99.5
COG0353198 RecR Recombinational DNA repair protein (RecF pathway) 96.73
COG4026290 Uncharacterized protein containing TOPRIM domain, poten 96.61
TIGR00615205 recR recombination protein RecR; InterPro: IPR000093 Th 96.21
cd01025112 TOPRIM_recR TOPRIM_recR: topoisomerase-primase (TOPRIM) 96.07
PRK07941933 DNA topoisomerase I; Validated 100.0
PRK07561878 DNA topoisomerase I; Validated 99.98
PRK06599776 DNA topoisomerase I; Validated 99.97
PRK09138 887 DNA topoisomerase I; Validated 99.97
smart0043689 TOP1Bc Bacterial DNA topoisomeraes I ATP-binding domain 99.96
PRK08780783 DNA topoisomerase III; Provisional 99.95
COG1754298 Uncharacterized C-terminal domain of topoisomerase IA [ 99.94
PRK09001869 DNA topoisomerase I; Validated 98.76
smart0049376 TOPRIM topoisomerases, DnaG-type primases, OLD family n 99.43
cd0018883 TOPRIM Topoisomerase-primase domain. This is a nucleoti 97.86
cd0102781 TOPRIM_RNase_M5_like TOPRIM_ RNase M5_like: The topoiso 93.8
PRK09137761 DNA topoisomerase I; Validated 99.27
PRK08413733 consensus 99.26
PRK07219769 DNA topoisomerase I; Validated 99.03
PRK06319864 DNA topoisomerase I/SWI domain fusion protein; Validate 99.19
PRK08938692 DNA topoisomerase I; Validated 99.12
COG0551140 TopA Zn-finger domain associated with topoisomerase typ 98.22
COG0551140 TopA Zn-finger domain associated with topoisomerase typ 97.33
PRK05582692 DNA topoisomerase I; Validated 98.97
pfam0139639 zf-C4_Topoisom Topoisomerase DNA binding C4 zinc finger 98.41
PRK05823691 consensus 98.26
PRK08620726 DNA topoisomerase III; Provisional 97.44
PRK00076197 recR recombination protein RecR; Reviewed 96.88
PRK13844200 recombination protein RecR; Provisional 96.78
COG1658127 Small primase-like proteins (Toprim domain) [DNA replic 93.88
PRK07220740 DNA topoisomerase I; Validated 95.81
PRK05776675 DNA topoisomerase III; Provisional 94.59
PRK08174670 DNA topoisomerase III; Validated 92.33
PRK07726716 DNA topoisomerase III; Provisional 90.9
TIGR01051688 topA_bact DNA topoisomerase I; InterPro: IPR005733 DNA 95.77
PRK07141622 DNA topoisomerase I; Validated 93.74
pfam01131403 Topoisom_bac DNA topoisomerase. This subfamily of topoi 93.57
PRK09031649 DNA topoisomerase III; Provisional 93.12
cd00186381 TOP1Ac DNA Topoisomerase, subtype IA; DNA-binding, ATP- 92.44
smart00437259 TOP1Ac Bacterial DNA topoisomerase I DNA-binding domain 92.99
TIGR01057637 topA_arch DNA topoisomerase I; InterPro: IPR005739 DNA 91.38
pfam0139639 zf-C4_Topoisom Topoisomerase DNA binding C4 zinc finger 91.07
>PRK09138 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK07941 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK07561 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK08780 DNA topoisomerase III; Provisional Back     alignment and domain information
>PRK06599 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK09137 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK07219 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK08173 DNA topoisomerase III; Validated Back     alignment and domain information
>KOG1956 consensus Back     alignment and domain information
>TIGR01051 topA_bact DNA topoisomerase I; InterPro: IPR005733 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK09001 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK08174 DNA topoisomerase III; Validated Back     alignment and domain information
>PRK07141 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK07726 DNA topoisomerase III; Provisional Back     alignment and domain information
>TIGR01056 topB DNA topoisomerase III; InterPro: IPR005738 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>TIGR01057 topA_arch DNA topoisomerase I; InterPro: IPR005739 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK06319 DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>PRK05582 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK08938 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK08413 consensus Back     alignment and domain information
>PRK05823 consensus Back     alignment and domain information
>PRK08620 DNA topoisomerase III; Provisional Back     alignment and domain information
>PRK07220 DNA topoisomerase I; Validated Back     alignment and domain information
>COG0550 TopA Topoisomerase IA [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK09031 DNA topoisomerase III; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>KOG1957 consensus Back     alignment and domain information
>PRK05776 DNA topoisomerase III; Provisional Back     alignment and domain information
>pfam01131 Topoisom_bac DNA topoisomerase Back     alignment and domain information
>cd00186 TOP1Ac DNA Topoisomerase, subtype IA; DNA-binding, ATP-binding and catalytic domain of bacterial DNA topoisomerases I and III, and eukaryotic DNA topoisomerase III and eubacterial and archael reverse gyrases Back     alignment and domain information
>smart00437 TOP1Ac Bacterial DNA topoisomerase I DNA-binding domain Back     alignment and domain information
>COG1754 Uncharacterized C-terminal domain of topoisomerase IA [General function prediction only] Back     alignment and domain information
>cd03363 TOPRIM_TopoIA_TopoI TOPRIM_TopoIA_TopoI: The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to Escherichia coli DNA topoisomerase I Back     alignment and domain information
>cd03361 TOPRIM_TopoIA_RevGyr TopoIA_RevGyr : The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to the ATP-dependent reverse gyrase found in archaea and thermophilic bacteria Back     alignment and domain information
>cd01028 TOPRIM_TopoIA TOPRIM_TopoIA: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in the type IA family of DNA topoisomerases (TopoIA) Back     alignment and domain information
>cd03362 TOPRIM_TopoIA_TopoIII TOPRIM_TopoIA_TopoIII: The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to topoisomerase III Back     alignment and domain information
>LOAD_Toprim consensus Back     alignment and domain information
>pfam01751 Toprim Toprim domain Back     alignment and domain information
>COG0353 RecR Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>TIGR00615 recR recombination protein RecR; InterPro: IPR000093 The bacterial protein recR seems to play a role in a recombinational process of DNA repair Back     alignment and domain information
>cd01025 TOPRIM_recR TOPRIM_recR: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in Escherichia coli RecR Back     alignment and domain information
>PRK07941 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK07561 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK06599 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK09138 DNA topoisomerase I; Validated Back     alignment and domain information
>smart00436 TOP1Bc Bacterial DNA topoisomeraes I ATP-binding domain Back     alignment and domain information
>PRK08780 DNA topoisomerase III; Provisional Back     alignment and domain information
>COG1754 Uncharacterized C-terminal domain of topoisomerase IA [General function prediction only] Back     alignment and domain information
>PRK09001 DNA topoisomerase I; Validated Back     alignment and domain information
>smart00493 TOPRIM topoisomerases, DnaG-type primases, OLD family nucleases and RecR proteins Back     alignment and domain information
>cd00188 TOPRIM Topoisomerase-primase domain Back     alignment and domain information
>cd01027 TOPRIM_RNase_M5_like TOPRIM_ RNase M5_like: The topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain found in Ribonuclease M5: (RNase M5) and other small primase-like proteins from bacteria and archaea Back     alignment and domain information
>PRK09137 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK08413 consensus Back     alignment and domain information
>PRK07219 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK06319 DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>PRK08938 DNA topoisomerase I; Validated Back     alignment and domain information
>COG0551 TopA Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0551 TopA Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05582 DNA topoisomerase I; Validated Back     alignment and domain information
>pfam01396 zf-C4_Topoisom Topoisomerase DNA binding C4 zinc finger Back     alignment and domain information
>PRK05823 consensus Back     alignment and domain information
>PRK08620 DNA topoisomerase III; Provisional Back     alignment and domain information
>PRK00076 recR recombination protein RecR; Reviewed Back     alignment and domain information
>PRK13844 recombination protein RecR; Provisional Back     alignment and domain information
>COG1658 Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07220 DNA topoisomerase I; Validated Back     alignment and domain information
>PRK05776 DNA topoisomerase III; Provisional Back     alignment and domain information
>PRK08174 DNA topoisomerase III; Validated Back     alignment and domain information
>PRK07726 DNA topoisomerase III; Provisional Back     alignment and domain information
>TIGR01051 topA_bact DNA topoisomerase I; InterPro: IPR005733 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK07141 DNA topoisomerase I; Validated Back     alignment and domain information
>pfam01131 Topoisom_bac DNA topoisomerase Back     alignment and domain information
>PRK09031 DNA topoisomerase III; Provisional Back     alignment and domain information
>cd00186 TOP1Ac DNA Topoisomerase, subtype IA; DNA-binding, ATP-binding and catalytic domain of bacterial DNA topoisomerases I and III, and eukaryotic DNA topoisomerase III and eubacterial and archael reverse gyrases Back     alignment and domain information
>smart00437 TOP1Ac Bacterial DNA topoisomerase I DNA-binding domain Back     alignment and domain information
>TIGR01057 topA_arch DNA topoisomerase I; InterPro: IPR005739 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>pfam01396 zf-C4_Topoisom Topoisomerase DNA binding C4 zinc finger Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target837 DNA topoisomerase I [Candidatus Liberibacter asiaticus
1cy1_A599 Complex Of E.Coli Dna Topoisomerase I With 5'ptptpt 1e-126
1ecl_A597 Amino Terminal 67kda Domain Of Escherichia Coli Dna 1e-126
1mw8_X592 Crystal Structure Of A Complex Between H365r Mutant 1e-125
3pwt_A596 Crystal Structure Of Mutant E.Coli Topoisomerase Ia 1e-124
3px7_A595 Crystal Structure Of Covalent Complex Of Topoisomer 1e-124
2o19_A659 Structure Of E. Coli Topoisomersae Iii In Complex W 2e-68
1d6m_A653 Crystal Structure Of E. Coli Dna Topoisomerase Iii 2e-68
1i7d_A659 Noncovalent Complex Of E.Coli Dna Topoisomerase Iii 2e-68
1gku_B1054 Reverse Gyrase From Archaeoglobus Fulgidus Length = 3e-65
1gl9_B1054 Archaeoglobus Fulgidus Reverse Gyrase Complexed Wit 4e-65
2gai_A633 Structure Of Full Length Topoisomerase I From Therm 1e-108
1cy9_A264 Crystal Structure Of The 30 Kda Fragment Of E. Coli 2e-22
>gi|7245299|pdb|1CY1|A Chain A, Complex Of E.Coli Dna Topoisomerase I With 5'ptptpt Length = 599 Back     alignment and structure
 Score =  456 bits (1174), Expect = e-126,   Method: Composition-based stats.
 Identities = 242/605 (40%), Positives = 349/605 (57%), Gaps = 54/605 (8%)

Query: 3   VIIVESPAKAKTISKYLGSNYKVLSSFGHIRDLPAK------------------------ 38
           ++IVESPAKAKTI+KYLGS+Y V SS GHIRDLP                          
Sbjct: 7   LVIVESPAKAKTINKYLGSDYVVKSSVGHIRDLPTSGSAAKKSADSTSTKTAKKPKKDER 66

Query: 39  -----KGSVLPEKEFEMIWNIDPSSQKHLQNIIHAVKSSTILILATDPDREGEAISWHVL 93
                +  V P   +E  + + P  +K +  +    + +  + LATD DREGEAI+WH+ 
Sbjct: 67  GALVNRMGVDPWHNWEAHYEVLPGKEKVVSELKQLAEKADHIYLATDLDREGEAIAWHLR 126

Query: 94  DVLRQKNLIEKTKIQRVSFNAITKQVVLNAMKSPRDINLDLVNAYLARRALDYLVGFNLS 153
           +V+      +  +  RV FN ITK  +  A   P ++N+D VNA  ARR +D +VG+ +S
Sbjct: 127 EVIG----GDDARYSRVVFNEITKNAIRQAFNKPGELNIDRVNAQQARRFMDRVVGYMVS 182

Query: 154 PILWQKLPGARSAGRVQSVALRLICNRENQIESFVSEEYWSLSVLLETPRNDKFTAHLTD 213
           P+LW+K+    SAGRVQSVA+RL+  RE +I++FV EE+W +     TP  +     +T 
Sbjct: 183 PLLWKKIARGLSAGRVQSVAVRLVVEREREIKAFVPEEFWEVDASTTTPSGEALALQVTH 242

Query: 214 FNGQRIEKKSISNKKEADDLISFVKKATYSVEKIENKPIKRNPWPAFTTSTLQQVASSRL 273
            N +        NK++    +S ++KA YSV + E+KP    P   F TSTLQQ AS+RL
Sbjct: 243 QNDKPFRP---VNKEQTQAAVSLLEKARYSVLEREDKPTTSKPGAPFITSTLQQAASTRL 299

Query: 274 GFSASHTMRIAQKLYEGIDVNGEIVGLITYMRTDGVHMSPDALEAVRRSITSHYGDHYLP 333
           GF    TM +AQ+LYE         G ITYMRTD  ++S DA+  VR  I+ ++G  YLP
Sbjct: 300 GFGVKKTMMMAQRLYE--------AGYITYMRTDSTNLSQDAVNMVRGYISDNFGKKYLP 351

Query: 334 EKPRIYSSKSKNAQEAHEAIRPNDFDFLPSKMKQFLDSDQFQLYNLIWKRSVASQMASAK 393
           E P  Y+SK  N+QEAHEAIRP+D + +   +K  +++D  +LY LIW++ VA QM  AK
Sbjct: 352 ESPNQYASKE-NSQEAHEAIRPSDVNVMAESLK-DMEADAQKLYQLIWRQFVACQMTPAK 409

Query: 394 FERTTVNIIATYNDQIGHLRTTGSLLCFDGFLKVWENQYDQEKNSEEDILLPYISANEQL 453
           ++ TT+ + A        L+  G +L FDG+ KV           +ED +LP ++  + L
Sbjct: 410 YDSTTLTVGA----GDFRLKARGRILRFDGWTKVMPALRK----GDEDRILPAVNKGDAL 461

Query: 454 IATETNASQHFTEPPPRYSESSLIKKMEEIGIGRPSTYATILETLYKRKYVIAEKRKILP 513
              E   +QHFT+PP R+SE+SL+K++E+ GIGRPSTYA+I+ T+  R YV  E R+   
Sbjct: 462 TLVELTPAQHFTKPPARFSEASLVKELEKRGIGRPSTYASIISTIQDRGYVRVENRRFYA 521

Query: 514 QNTGRIVTAFLENFFSQYVEYDFTADLEEKLDEISTGKLNWKEVLHEFWEEFIEKIDSIK 573
           +  G IVT  LE  F + + YDFTA +E  LD+++  +  WK VL  F+ +F +++D  +
Sbjct: 522 EKMGEIVTDRLEENFRELMNYDFTAQMENSLDQVANHEAEWKAVLDHFFSDFTQQLDKAE 581

Query: 574 KLRIS 578
           K    
Sbjct: 582 KDPEE 586


>gi|157830925|pdb|1ECL|A Chain A, Amino Terminal 67kda Domain Of Escherichia Coli Dna Topoisomerase I (Residues 2-590 Of Mature Protein) Cloning Artifact Adds Two Residues To The Amino-Terminus Which Were Not Observed In The Experimental Electron Density (Gly-2, Ser-1) Length = 597 Back     alignment and structure
>gi|38492440|pdb|1MW8|X Chain X, Crystal Structure Of A Complex Between H365r Mutant Of 67 Kda N-Terminal Fragment Of E. Coli Dna Topoisomerase I And 5'-Acttcgggatg-3' Length = 592 Back     alignment and structure
>gi|315583657|pdb|3PWT|A Chain A, Crystal Structure Of Mutant E.Coli Topoisomerase Ia Length = 596 Back     alignment and structure
>gi|329666169|pdb|3PX7|A Chain A, Crystal Structure Of Covalent Complex Of Topoisomerase 1a With Substrate Length = 595 Back     alignment and structure
>gi|145579927|pdb|2O19|A Chain A, Structure Of E. Coli Topoisomersae Iii In Complex With An 8- Base Single Stranded Oligonucleotide. Frozen In Glycerol At Ph 5.5 Length = 659 Back     alignment and structure
gi|11514602|pdb|1D6M|A Chain A, Crystal Structure Of E. Coli Dna Topoisomerase Iii Length = 653 Back     alignment and structure
>gi|14719499|pdb|1I7D|A Chain A, Noncovalent Complex Of E.Coli Dna Topoisomerase Iii With An 8-Base Single-Stranded Dna Oligonucleotide Length = 659 Back     alignment and structure
>gi|20149845|pdb|1GKU|B Chain B, Reverse Gyrase From Archaeoglobus Fulgidus Length = 1054 Back     alignment and structure
>gi|20149846|pdb|1GL9|B Chain B, Archaeoglobus Fulgidus Reverse Gyrase Complexed With Adpnp Length = 1054 Back     alignment and structure
>gi|99032438|pdb|2GAI|A Chain A, Structure Of Full Length Topoisomerase I From Thermotoga Maritima In Triclinic Crystal Form Length = 633 Back     alignment and structure
>gi|7245304|pdb|1CY9|A Chain A, Crystal Structure Of The 30 Kda Fragment Of E. Coli Dna Topoisomerase I. Monoclinic Form Length = 264 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target837 DNA topoisomerase I [Candidatus Liberibacter asiaticus