254780308

254780308

putative membrane-bound lytic murein transglycosylase signal peptide protein

GeneID in NCBI database:8209290Locus tag:CLIBASIA_00965
Protein GI in NCBI database:254780308Protein Accession:YP_003064721.1
Gene range:+(199329, 200195)Protein Length:288aa
Gene description:putative membrane-bound lytic murein transglycosylase signal peptide protein
COG prediction:[M] Membrane-bound lytic murein transglycosylase B
KEGG prediction:putative membrane-bound lytic murein transglycosylase signal peptide protein
SEED prediction:Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Murein Hydrolases;
Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT
ccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHcccHHHHHHHHHHHHHHccccccccccc
cccHHHHHccHHHHHHHHHHHHHHHccccccHHcccccHHcHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHcccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHccHHHHccccccccHHHHHHEEcccccccccccccHHHHHHHHHHHHHHcccccccccccEEcccccccHHHccccHccHHHHHHHccccccccccccc
MSFKKYLLISLLMMVYPMLAqavtqpkkattqfICSDTADRFGEWKSAARARAVregmspktAKHLFADLEYLDTTiardrkmvtsppvsfkdyldglsssEIIAQGIALKKANSRLLINLkkeygvppgILMALWGLethfgetmgktpllsTLATLAYDCRRAKFFTEQFFYALDLVKKgvisshalgatfgeigqfqflpvnVVKYAidadedgkiDLVKSNIDAIASAAKFLAKLGwtkcagyqpgekNFAILKHWNASLNYNKTIAYIAAHidgvpigkgydt
MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARavregmspktakhlfADLEYLDTTiardrkmvtsppVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT
MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT
*******LISLLMMVYPMLAQ******************DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLD***************SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHI***********
MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT
MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG*********
iiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT
MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT
MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target288 putative membrane-bound lytic murein transglycosylase s
315122267171 putative membrane-bound lytic murein transglycosylase s 1 7e-59
241206916290 lytic murein transglycosylase [Rhizobium leguminosarum 1 8e-57
307316137273 lytic murein transglycosylase [Sinorhizobium meliloti A 1 2e-56
15967070273 putative membrane-bound lytic murein transglycosylase s 1 2e-56
86359679274 putative membrane-bound lytic murein transglycosylase p 1 3e-56
209551480273 lytic murein transglycosylase [Rhizobium leguminosarum 1 3e-56
222087909273 membrane-bound lytic murein transglycosylase protein [A 1 3e-56
190893955274 membrane-bound lytic murein transglycosylase [Rhizobium 1 3e-56
159185238271 hypothetical protein Atu2489 [Agrobacterium tumefaciens 1 5e-56
163757436272 putative membrane-bound lytic murein transglycosylase s 1 8e-56
>gi|315122267|ref|YP_004062756.1| putative membrane-bound lytic murein transglycosylase signal peptide protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 171 Back     alignment and organism information
 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 128/166 (77%)

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++K+YGVP GIL+ LWGLE+ FG+ MG+ P  STLATLAYDCRR+  FTEQFF AL+LV 
Sbjct: 5   IQKDYGVPAGILITLWGLESRFGDRMGEVPTFSTLATLAYDCRRSALFTEQFFVALELVN 64

Query: 181 KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           +G+IS+ + GA  GEIG FQFLP NV K+++D D DGK  ++ SNIDAI SAA FL K G
Sbjct: 65  QGIISAESRGALHGEIGPFQFLPSNVKKFSVDGDGDGKASIITSNIDAIESAANFLKKNG 124

Query: 241 WTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGY 286
           WTK  GYQP EKNF ILK WNAS NY K +AYIAAHIDG+ +  GY
Sbjct: 125 WTKNKGYQPKEKNFLILKRWNASTNYIKAVAYIAAHIDGIRLKDGY 170


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241206916|ref|YP_002978012.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 290 Back     alignment and organism information
>gi|307316137|ref|ZP_07595581.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83] Length = 273 Back     alignment and organism information
>gi|15967070|ref|NP_387423.1| putative membrane-bound lytic murein transglycosylase signal peptide protein [Sinorhizobium meliloti 1021] Length = 273 Back     alignment and organism information
>gi|86359679|ref|YP_471571.1| putative membrane-bound lytic murein transglycosylase protein [Rhizobium etli CFN 42] Length = 274 Back     alignment and organism information
>gi|209551480|ref|YP_002283397.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 273 Back     alignment and organism information
>gi|222087909|ref|YP_002546447.1| membrane-bound lytic murein transglycosylase protein [Agrobacterium radiobacter K84] Length = 273 Back     alignment and organism information
>gi|190893955|ref|YP_001980497.1| membrane-bound lytic murein transglycosylase [Rhizobium etli CIAT 652] Length = 274 Back     alignment and organism information
>gi|159185238|ref|NP_355437.2| hypothetical protein Atu2489 [Agrobacterium tumefaciens str. C58] Length = 271 Back     alignment and organism information
>gi|163757436|ref|ZP_02164525.1| putative membrane-bound lytic murein transglycosylase signal peptide protein [Hoeflea phototrophica DFL-43] Length = 272 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target288 putative membrane-bound lytic murein transglycosylase s
TIGR02283300 TIGR02283, MltB_2, lytic murein transglycosylase 1e-51
TIGR02282290 TIGR02282, MltB, lytic murein transglycosylase B 2e-26
PRK10760359 PRK10760, PRK10760, murein hydrolase B; Provisional 6e-20
TIGR02283300 TIGR02283, MltB_2, lytic murein transglycosylase 0.001
COG2951343 COG2951, MltB, Membrane-bound lytic murein transglycosy 3e-44
>gnl|CDD|162796 TIGR02283, MltB_2, lytic murein transglycosylase Back     alignment and domain information
>gnl|CDD|162795 TIGR02282, MltB, lytic murein transglycosylase B Back     alignment and domain information
>gnl|CDD|182706 PRK10760, PRK10760, murein hydrolase B; Provisional Back     alignment and domain information
>gnl|CDD|162796 TIGR02283, MltB_2, lytic murein transglycosylase Back     alignment and domain information
>gnl|CDD|32773 COG2951, MltB, Membrane-bound lytic murein transglycosylase B [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 288 putative membrane-bound lytic murein transglycosylase s
TIGR02283313 MltB_2 lytic murein transglycosylase; InterPro: IPR0119 100.0
PRK10760357 murein hydrolase B; Provisional 100.0
COG2951343 MltB Membrane-bound lytic murein transglycosylase B [Ce 100.0
TIGR02282323 MltB lytic murein transglycosylase B; InterPro: IPR0117 100.0
cd00254113 LT_GEWL Lytic Transglycosylase (LT) and Goose Egg White 99.19
pfam01464117 SLT Transglycosylase SLT domain. This family is distant 98.89
PRK11671360 mltC murein transglycosylase C; Provisional 98.3
PRK10783 449 mltD membrane-bound lytic murein transglycosylase D; Pr 98.26
COG0741296 MltE Soluble lytic murein transglycosylase and related 97.18
COG1705201 FlgJ Muramidase (flagellum-specific) [Cell motility and 91.3
PRK11619645 lytic murein transglycosylase; Provisional 97.95
PRK10859507 putative transglycosylase; Provisional 97.82
cd01021166 GEWL Goose Egg White Lysozyme domain. Eukaryotic "goose 96.69
pfam01832136 Glucosaminidase Mannosyl-glycoprotein endo-beta-N-acety 95.37
smart00047147 LYZ2 Lysozyme subfamily 2. Eubacterial enzymes distantl 95.15
PRK12709318 flgJ peptidoglycan hydrolase; Provisional 95.0
PRK05684313 flgJ peptidoglycan hydrolase; Validated 94.84
PRK12713339 flgJ peptidoglycan hydrolase; Provisional 94.04
PRK12712344 flgJ peptidoglycan hydrolase; Provisional 93.18
PRK12710291 flgJ peptidoglycan hydrolase; Provisional 91.64
>TIGR02283 MltB_2 lytic murein transglycosylase; InterPro: IPR011970 Proteins of this entries are closely related to the MltB family lytic murein transglycosylases described by IPR011757 from INTERPRO and are likewise all proteobacterial, although that family and this one form clearly distinct clades Back     alignment and domain information
>PRK10760 murein hydrolase B; Provisional Back     alignment and domain information
>COG2951 MltB Membrane-bound lytic murein transglycosylase B [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02282 MltB lytic murein transglycosylase B; InterPro: IPR011757 This family consists of lytic murein transglycosylases (murein hydrolases) related to MltB (P41052 from SWISSPROT), which is a 38 kDa membrane-bound lipoprotein in Escherichia coli Back     alignment and domain information
>cd00254 LT_GEWL Lytic Transglycosylase (LT) and Goose Egg White Lysozyme (GEWL) domain Back     alignment and domain information
>pfam01464 SLT Transglycosylase SLT domain Back     alignment and domain information
>PRK11671 mltC murein transglycosylase C; Provisional Back     alignment and domain information
>PRK10783 mltD membrane-bound lytic murein transglycosylase D; Provisional Back     alignment and domain information
>COG0741 MltE Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1705 FlgJ Muramidase (flagellum-specific) [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PRK10859 putative transglycosylase; Provisional Back     alignment and domain information
>cd01021 GEWL Goose Egg White Lysozyme domain Back     alignment and domain information
>pfam01832 Glucosaminidase Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase Back     alignment and domain information
>smart00047 LYZ2 Lysozyme subfamily 2 Back     alignment and domain information
>PRK12709 flgJ peptidoglycan hydrolase; Provisional Back     alignment and domain information
>PRK05684 flgJ peptidoglycan hydrolase; Validated Back     alignment and domain information
>PRK12713 flgJ peptidoglycan hydrolase; Provisional Back     alignment and domain information
>PRK12712 flgJ peptidoglycan hydrolase; Provisional Back     alignment and domain information
>PRK12710 flgJ peptidoglycan hydrolase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target288 putative membrane-bound lytic murein transglycosylase s
1qus_A322 1.7 A Resolution Structure Of The Soluble Lytic Tra 6e-37
1ltm_A320 Accelerated X-Ray Structure Elucidation Of A 36 Kda 7e-37
>gi|6137550|pdb|1QUS|A Chain A, 1.7 A Resolution Structure Of The Soluble Lytic Transglycosylase Slt35 From Escherichia Coli Length = 322 Back     alignment and structure
 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 60/288 (20%), Positives = 106/288 (36%), Gaps = 65/288 (22%)

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKM--------VTSPPVSFKDYLDGLSSSEIIAQ 106
           + G   +  + + +  + LD+ +               + P  ++  Y     + + +  
Sbjct: 31  KHGFDRQQLQEILSQAKRLDSVLRLMDNQAPTTSVKPPSGPNGAWLRYRKKFITPDNVQN 90

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY-DCRRA 165
           G+         L    + YGVPP I++ + G+ET +G  MGKT +L  LATL++   RRA
Sbjct: 91  GVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRA 150

Query: 166 KFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
           ++F+ +    L + +       +  G+  G +G  QF+P +  +YA+D   DG I+L   
Sbjct: 151 EYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLW-D 209

Query: 225 NIDAIASAAKFLAKLGWTK----------------------------------------- 243
            +DAI S A +    GW K                                         
Sbjct: 210 PVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGN 269

Query: 244 -----------CAGYQPGE--KNFAILKHWNASLNYNKTIAYIAAHID 278
                        GYQ      NF  +  +N S +Y   +  +   + 
Sbjct: 270 HQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVA 317


>gi|157831890|pdb|1LTM|A Chain A, Accelerated X-Ray Structure Elucidation Of A 36 Kda MuramidaseTRANSGLYCOSYLASE USING WARP Length = 320 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target288 putative membrane-bound lytic murein transglycosylase s
1qus_A322 Lytic murein transglycosylase B; alpha-helical protein 4e-37
>1qus_A Lytic murein transglycosylase B; alpha-helical protein with AN five-stranded antiparallel beta-sheet, hydrolase; HET: BCN; 1.70A {Escherichia coli} SCOP: d.2.1.6 PDB: 1d0k_A* 1d0m_A* 1qdr_A* 1qdt_A 1d0l_A* 1qut_A* 1ltm_A* Length = 322 Back     alignment and structure
 Score =  150 bits (379), Expect = 4e-37
 Identities = 57/233 (24%), Positives = 100/233 (42%), Gaps = 13/233 (5%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--------SFKDYLDGLSSSEII 104
             + G   +  + + +  + LD+ +        +  V        ++  Y     + + +
Sbjct: 29  VNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPTTSVKPPSGPNGAWLRYRKKFITPDNV 88

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-CR 163
             G+         L    + YGVPP I++ + G+ET +G  MGKT +L  LATL+++  R
Sbjct: 89  QNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPR 148

Query: 164 RAKFFTEQFFYAL-DLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           RA++F+ +    L     +     +  G+  G +G  QF+P +  +YA+D   DG I+L 
Sbjct: 149 RAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINL- 207

Query: 223 KSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAA 275
              +DAI S A +    GW K  G Q                    +I+ +AA
Sbjct: 208 WDPVDAIGSVANYFKAHGWVK--GDQVAVMANGQAPGLPNGFKTKYSISQLAA 258


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target288 putative membrane-bound lytic murein transglycosylase s
1qus_A322 Lytic murein transglycosylase B; alpha-helical protein 100.0
3gxr_A187 Goose-type lysozyme 1; atlantic COD, FISH lysozyme, act 98.82
1gbs_A185 Australian black SWAN egg white lysozyme; hydrolase (O- 98.73
3fi7_A183 LMO1076 protein; listeria monocytogenes, autolysin, N a 96.54
3mgw_A181 Lysozyme G; salmon, goose-type, differential scanning c 98.78
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); alpha-s 98.35
2zyc_A170 Peptidoglycan hydrolase FLGJ; 1.74A {Sphingomonas SP} 96.46
>1qus_A Lytic murein transglycosylase B; alpha-helical protein with AN five-stranded antiparallel beta-sheet, hydrolase; HET: BCN; 1.70A {Escherichia coli} SCOP: d.2.1.6 PDB: 1d0k_A* 1d0m_A* 1qdr_A* 1qdt_A 1d0l_A* 1qut_A* 1ltm_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=578.64  Aligned_cols=238  Identities=24%  Similarity=0.422  Sum_probs=219.5

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCHHHHHHCCCCC--------CCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8999999999999839998999998608777702333202566--------66777989998764001357999998532
Q gi|254780308|r   42 FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV--------TSPPVSFKDYLDGLSSSEIIAQGIALKKA  113 (288)
Q Consensus        42 F~~wl~~l~~~A~~~Gis~~tl~~~f~~~~~~~~VI~~dr~Qp--------~ef~~t~~~Y~~~~vs~~Ri~~Gr~~~~~  113 (288)
                      ..++...+...+.++|+++++++.+|++++++++||++|++|+        +++++||.+|++++|++.||+.|++++++
T Consensus        18 ~p~~~~fi~~~a~~~g~~~~~l~~~f~~~k~~~~vi~~~~~q~~~~~~~~p~~~~~~w~~Y~~~~v~~~ri~~G~~~~~~   97 (322)
T 1qus_A           18 NPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPTTSVKPPSGPNGAWLRYRKKFITPDNVQNGVVFWNQ   97 (322)
T ss_dssp             CHHHHHHHHHHHHHHCCCHHHHHHHHTTCCCCHHHHHHHHCC----------CCSCHHHHHHTTTCSHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHCCHHHHHHHHHHHHH
T ss_conf             98899999999998099999999999719576999998863675444688512367799999985899999999999999


Q ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHCCC-CHHHHHHHHHHHHHHHHHCCCCCHHC-CCC
Q ss_conf             3469999999838998894452310022101025641899998753275-31566547899999986438777000-367
Q gi|254780308|r  114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRAKFFTEQFFYALDLVKKGVISSHA-LGA  191 (288)
Q Consensus       114 ~~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~~G~~~vl~aLaTLA~d~-RR~~ff~~el~a~l~~~~~g~~~~~~-~GS  191 (288)
                      |+++|++||++|||||+||+|||||||+||+++|+++|+++|+||||++ ||++||++||+++|+|++++++++.. +||
T Consensus        98 ~~~~l~~ie~~yGVp~~ii~AiwGvET~yG~~~G~~~v~~aLaTLA~~~~rr~~ff~~eL~~~l~i~~~~~~~~~~l~GS  177 (322)
T 1qus_A           98 YEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGS  177 (322)
T ss_dssp             THHHHHHHHHHHCCCHHHHHHHHHHHHTTTTCCCCEEHHHHHHHHHHSCGGGHHHHHHHHHHHHHHHHHTTCCGGGCEEC
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHEEEECCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             99999999999795988875620355310124588618999999997246157789999999999987079885768535


Q ss_pred             CCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC----------------------
Q ss_conf             5235786665522444215367899987887898889999999999729888589764----------------------
Q gi|254780308|r  192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP----------------------  249 (288)
Q Consensus       192 ~aGa~G~~QFmPs~~~~yavD~dgdG~~dl~~~~~Da~aS~AnyL~~~GW~~g~~~~~----------------------  249 (288)
                      |||||||||||||||++||||||||||+|||++ +|||||+||||++|||++|+||..                      
T Consensus       178 wAGAmG~~QFMPSsy~~yAvD~DgDG~~Diwn~-~DaiaS~ANYL~~~GW~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~  256 (322)
T 1qus_A          178 FAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDP-VDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQL  256 (322)
T ss_dssp             TTCCBTTTTBCHHHHHHHCCCCSSSSCCCTTSH-HHHHHHHHHHHHHTTCCTTCCSEEEEESCCTTSCCEEEEEEEHHHH
T ss_pred             HHHHCCCCCCCHHHHHHHCCCCCCCCCCCCCCC-HHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHH
T ss_conf             244457875043678751637799986553683-2159899999998299889955898257654464567621129999


Q ss_pred             --------------------------------CCHHHHHHHHHHCHHHHHHHHHHHHHHHCCC
Q ss_conf             --------------------------------5345899998526289999999999996899
Q gi|254780308|r  250 --------------------------------GEKNFAILKHWNASLNYNKTIAYIAAHIDGV  280 (288)
Q Consensus       250 --------------------------------~~~n~~~~~~~n~s~~y~~~v~~~a~~~~g~  280 (288)
                                                      +.+||+||++||+|..|+++|++||++|.++
T Consensus       257 ~~~Gv~~~~~~~~~~~~~~l~l~~g~~~~~~L~~~NF~vI~~yN~S~~YAlaV~~Lad~I~~~  319 (322)
T 1qus_A          257 AAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALA  319 (322)
T ss_dssp             HHTTCEESSCCTTCCEEEEEEEECSSSEEEEEECHHHHHHHTTSSCHHHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCCCCCCCCCCCCEEECCCCCCCEEEEECCCHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             875887688898645574575458888716997578999988418498999999999999873



>3gxr_A Goose-type lysozyme 1; atlantic COD, FISH lysozyme, active site residues, substrate binding sites, surface potential, muramidase activity; HET: NAG; 1.70A {Gadus morhua} PDB: 3gxk_A* Back     alignment and structure
>1gbs_A Australian black SWAN egg white lysozyme; hydrolase (O-glycosyl); 1.50A {Cygnus atratus} SCOP: d.2.1.5 PDB: 1lsp_A* 153l_A 154l_A* Back     alignment and structure
>3fi7_A LMO1076 protein; listeria monocytogenes, autolysin, N acetylglucosaminidase, peptidoglycan hydrolase, autoinhibition, GH73; 2.35A {Undefined} Back     alignment and structure
>3mgw_A Lysozyme G; salmon, goose-type, differential scanning calorime refolding, thermal tolerance, innate immunity, hydrolase; 1.75A {Salmo salar} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2zyc_A Peptidoglycan hydrolase FLGJ; 1.74A {Sphingomonas SP} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 288 putative membrane-bound lytic murein transglycosylase s
d1qusa_322 d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT 1e-22
>d1qusa_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli [TaxId: 562]} Length = 322 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Lysozyme-like
superfamily: Lysozyme-like
family: Bacterial muramidase, catalytic domain
domain: 36 kDa soluble lytic transglycosylase, SLT35
species: Escherichia coli [TaxId: 562]
 Score =  101 bits (251), Expect = 1e-22
 Identities = 53/233 (22%), Positives = 95/233 (40%), Gaps = 13/233 (5%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--------SFKDYLDGLSSSEII 104
             + G   +  + + +  + LD+ +        +  V        ++  Y     + + +
Sbjct: 29  VNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPTTSVKPPSGPNGAWLRYRKKFITPDNV 88

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
             G+         L    + YGVPP I++ + G+ET +G  MGKT +L  LATL+++  R
Sbjct: 89  QNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPR 148

Query: 165 AKFFTEQFFYALDLV--KKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
              +         L+   +     +  G+  G +G  QF+P +  +YA+D   DG I+ +
Sbjct: 149 RAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHIN-L 207

Query: 223 KSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAA 275
              +DAI S A +    GW K  G Q                    +I+ +AA
Sbjct: 208 WDPVDAIGSVANYFKAHGWVK--GDQVAVMANGQAPGLPNGFKTKYSISQLAA 258


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target288 putative membrane-bound lytic murein transglycosylase s
d1qusa_322 36 kDa soluble lytic transglycosylase, SLT35 {Escherich 100.0
d1qsaa2168 70 kDa soluble lytic transglycosylase, SLT70 {Escherich 98.84
d1gbsa_185 Lysozyme {Australian black swan (Cygnus atratus) [TaxId 98.81
>d1qusa_ d.2.1.6 (A:) 36 kDa soluble lytic transglycosylase, SLT35 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Lysozyme-like
superfamily: Lysozyme-like
family: Bacterial muramidase, catalytic domain
domain: 36 kDa soluble lytic transglycosylase, SLT35
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=581.42  Aligned_cols=237  Identities=24%  Similarity=0.424  Sum_probs=218.8

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCHHHHHHCCCCC--------CCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999839998999998608777702333202566--------667779899987640013579999985323
Q gi|254780308|r   43 GEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV--------TSPPVSFKDYLDGLSSSEIIAQGIALKKAN  114 (288)
Q Consensus        43 ~~wl~~l~~~A~~~Gis~~tl~~~f~~~~~~~~VI~~dr~Qp--------~ef~~t~~~Y~~~~vs~~Ri~~Gr~~~~~~  114 (288)
                      .+....+...|.++|+++++++++|++++++++||++|++|+        +++++||.+|++++|++.||++|++++++|
T Consensus        19 p~v~~Fi~~la~~~G~s~~~l~~~f~~~k~~~~vi~~~~~q~~~~~~~~p~~~~~~w~~Y~~~~v~~~ri~~g~~~~~~~   98 (322)
T d1qusa_          19 PNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPTTSVKPPSGPNGAWLRYRKKFITPDNVQNGVVFWNQY   98 (322)
T ss_dssp             HHHHHHHHHHHHHHCCCHHHHHHHHTTCCCCHHHHHHHHCC----------CCSCHHHHHHTTTCSHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             87999999999982989999999997284668899987614654446886013676999998857999999999999999


Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHCCCCCHHC-CCCC
Q ss_conf             46999999983899889445231002210102564189999875327-531566547899999986438777000-3675
Q gi|254780308|r  115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-CRRAKFFTEQFFYALDLVKKGVISSHA-LGAT  192 (288)
Q Consensus       115 ~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~~G~~~vl~aLaTLA~d-~RR~~ff~~el~a~l~~~~~g~~~~~~-~GS~  192 (288)
                      +++|++||++||||++||+|||||||+||+++|+++|++|||||||| +||++||++||+++|+|++++++++.. +|||
T Consensus        99 ~~~l~~~e~~yGV~~~ii~aiwgvET~yG~~~G~~~v~~aLaTLAf~~~rR~~ff~~EL~a~L~i~~~~~~~~~~l~GSw  178 (322)
T d1qusa_          99 EDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSF  178 (322)
T ss_dssp             HHHHHHHHHHHCCCHHHHHHHHHHHHTTTTCCCCEEHHHHHHHHHHSCGGGHHHHHHHHHHHHHHHHHTTCCGGGCEECT
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHCHHHHCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
T ss_conf             99999999985988778777776450332432777303234556641664143430899999999874276754345674


Q ss_pred             CCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCC-----------------------
Q ss_conf             235786665522444215367899987887898889999999999729888589764-----------------------
Q gi|254780308|r  193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP-----------------------  249 (288)
Q Consensus       193 aGa~G~~QFmPs~~~~yavD~dgdG~~dl~~~~~Da~aS~AnyL~~~GW~~g~~~~~-----------------------  249 (288)
                      ||||||||||||||++|||||||||++|||++ +|||+|+||||++|||++|+||..                       
T Consensus       179 AGAmG~~QFmPSsy~~yavD~DgDG~~Diwn~-~DaiaS~ANYL~~~GW~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~  257 (322)
T d1qusa_         179 AGAMGYGQFMPSSYKQYAVDFSGDGHINLWDP-VDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLA  257 (322)
T ss_dssp             TCCBTTTTBCHHHHHHHCCCCSSSSCCCTTSH-HHHHHHHHHHHHHTTCCTTCCSEEEEESCCTTSCCEEEEEEEHHHHH
T ss_pred             CCCCCCCCCCHHHHHHHHHHCCCCCCEEECCC-HHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCCHHHHH
T ss_conf             31247653044899977552379852010363-12375799999981987798568983576654645676445599998


Q ss_pred             -------------------------------CCHHHHHHHHHHCHHHHHHHHHHHHHHHCCC
Q ss_conf             -------------------------------5345899998526289999999999996899
Q gi|254780308|r  250 -------------------------------GEKNFAILKHWNASLNYNKTIAYIAAHIDGV  280 (288)
Q Consensus       250 -------------------------------~~~n~~~~~~~n~s~~y~~~v~~~a~~~~g~  280 (288)
                                                     +.+||+||++||+|..|+++|++||++|.++
T Consensus       258 ~~Gv~~~~~~~~~~~~~~l~l~~g~~~~~~l~~~NF~vI~rYN~S~~YAlaV~~La~~I~~~  319 (322)
T d1qusa_         258 AAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALA  319 (322)
T ss_dssp             HTTCEESSCCTTCCEEEEEEEECSSSEEEEEECHHHHHHHTTSSCHHHHHHHHHHHHHHHHH
T ss_pred             HCCCCCCCCCCCCCCCCEEECCCCCCCEEEEECCCHHHHHHHHCCHHHHHHHHHHHHHHHHH
T ss_conf             65787677888545464475348888616997578999987318498999999999999863



>d1qsaa2 d.2.1.6 (A:451-618) 70 kDa soluble lytic transglycosylase, SLT70 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gbsa_ d.2.1.5 (A:) Lysozyme {Australian black swan (Cygnus atratus) [TaxId: 8868]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 288 putative membrane-bound lytic murein transglycosyl
1qus_A_1-65_130-228164 (A:1-65,A:130-228) Lytic murein transglycosylase B 1e-14
1qus_A_66-129_301-32286 (A:66-129,A:301-322) Lytic murein transglycosylase 1e-11
>1qus_A (A:1-65,A:130-228) Lytic murein transglycosylase B; alpha-helical protein with AN five-stranded antiparallel beta-sheet, hydrolase; HET: BCN; 1.70A {Escherichia coli}Length = 164 Back     alignment and structure
 Score = 74.9 bits (184), Expect = 1e-14
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 145 TMGKTPLLSTLATLAYDC-RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFL 202
            MGKT +L  LATL+++  RRA++F+ +    L + +        L G+  G +G  QF+
Sbjct: 65  VMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFM 124

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           P +  +YA+D   DG I+L     DAI S A +    GW K
Sbjct: 125 PSSYKQYAVDFSGDGHINLWDPV-DAIGSVANYFKAHGWVK 164


>1qus_A (A:66-129,A:301-322) Lytic murein transglycosylase B; alpha-helical protein with AN five-stranded antiparallel beta-sheet, hydrolase; HET: BCN; 1.70A {Escherichia coli}Length = 86 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target288 putative membrane-bound lytic murein transglycosylase s
1qus_A_1-65_130-228164 Lytic murein transglycosylase B; alpha-helical pro 99.92
1qus_A_66-129_301-32286 Lytic murein transglycosylase B; alpha-helical pro 99.86
3bkh_A_88-268181 Phikz144, lytic transglycosylase; bacteriophage, e 99.08
3gxr_A_187 Goose-type lysozyme 1; atlantic COD, FISH lysozyme 98.96
1gbs_A_185 Australian black SWAN egg white lysozyme; hydrolas 98.86
1qsa_A_447-618172 Protein (soluble lytic transglycosylase SLT70); al 98.6
3b72_A_147 Lysozyme C; hen egg-white lysozyme, protein-SDS co 97.24
2fbd_A_122 Lysozyme 1; digestive lysozime, hydrolase; HET: PE 96.42
2vb1_A_129 Lysozyme C; antimicrobial, triclinic HEWL, atomic 96.53
2zyc_A_1-38_91-170118 Peptidoglycan hydrolase FLGJ; 1.74A {Sphingomonas 96.09
3fi7_A_26-72_139-18392 LMO1076 protein; listeria monocytogenes, autolysin 96.01
>1qus_A (A:1-65,A:130-228) Lytic murein transglycosylase B; alpha-helical protein with AN five-stranded antiparallel beta-sheet, hydrolase; HET: BCN; 1.70A {Escherichia coli} Back     alignment and structure
Probab=99.92  E-value=3.6e-24  Score=166.25  Aligned_cols=144  Identities=26%  Similarity=0.441  Sum_probs=126.2

Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999983999899999860877770233320256666777989998764001357999998532346999999
Q gi|254780308|r   43 GEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK  122 (288)
Q Consensus        43 ~~wl~~l~~~A~~~Gis~~tl~~~f~~~~~~~~VI~~dr~Qp~ef~~t~~~Y~~~~vs~~Ri~~Gr~~~~~~~~~L~~ie  122 (288)
                      .+--..+-+.+.++|+++..+..+|+++++...||++.-+|.|..                                   
T Consensus        19 ~~~~~fi~~m~~~~~f~~~~l~~~~~~~~~~~~~~~l~~~~a~~~-----------------------------------   63 (164)
T 1qus_A           19 PNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPTT-----------------------------------   63 (164)
T ss_dssp             HHHHHHHHHHHHHHCCCHHHHHHHHTTCCCCHHHHHHHHCC---------------------------------------
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHHHHHHCCCCCC-----------------------------------
T ss_conf             779999999999829899999999971957688999876256534-----------------------------------


Q ss_pred             HHHCCCHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHCCCCCHHC-CCCCCCCCCCCC
Q ss_conf             983899889445231002210102564189999875327-531566547899999986438777000-367523578666
Q gi|254780308|r  123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-CRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQ  200 (288)
Q Consensus       123 ~~yGV~~~ii~AiwGiET~yG~~~G~~~vl~aLaTLA~d-~RR~~ff~~el~a~l~~~~~g~~~~~~-~GS~aGa~G~~Q  200 (288)
                                           +.+|++++++++++++|+ ++|.+++..+|+++|..+.++.-..+. .+|++||+|+||
T Consensus        64 ---------------------~~~g~~~~~~a~~~la~~~~~r~~~~~~~l~Aai~ai~~~ES~f~p~a~S~aGA~GLMQ  122 (164)
T 1qus_A           64 ---------------------SVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQ  122 (164)
T ss_dssp             -----------------------CCCEEHHHHHHHHHHSCGGGHHHHHHHHHHHHHHHHHTTCCGGGCEECTTCCBTTTT
T ss_pred             ---------------------CCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHCCCCC
T ss_conf             ---------------------46588638999999996456288899999999999987259985778754445557875


Q ss_pred             CCHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             5522444215367899987887898889999999999729888
Q gi|254780308|r  201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK  243 (288)
Q Consensus       201 FmPs~~~~yavD~dgdG~~dl~~~~~Da~aS~AnyL~~~GW~~  243 (288)
                      |||+|+..|++|+|+||+.|+|+ +.|+|.+.++||+.+||++
T Consensus       123 imP~T~~~~g~d~~~~g~~dl~d-P~dnI~aga~YL~~LgWqr  164 (164)
T 1qus_A          123 FMPSSYKQYAVDFSGDGHINLWD-PVDAIGSVANYFKAHGWVK  164 (164)
T ss_dssp             BCHHHHHHHCCCCSSSSCCCTTS-HHHHHHHHHHHHHHTTCCT
T ss_pred             CCCHHHHHCCCCCCCCCCCCCCC-CHHHHHHHHHHHHHHCCCC
T ss_conf             03146874153779998666568-1336999999999828999



>1qus_A (A:66-129,A:301-322) Lytic murein transglycosylase B; alpha-helical protein with AN five-stranded antiparallel beta-sheet, hydrolase; HET: BCN; 1.70A {Escherichia coli} Back     alignment and structure
>3bkh_A (A:88-268) Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A* Back     alignment and structure
>3gxr_A (A:) Goose-type lysozyme 1; atlantic COD, FISH lysozyme, active site residues, substrate binding sites, surface potential, muramidase activity; HET: NAG; 1.70A {Gadus morhua} PDB: 3gxk_A* Back     alignment and structure
>1gbs_A (A:) Australian black SWAN egg white lysozyme; hydrolase (O-glycosyl); 1.50A {Cygnus atratus} Back     alignment and structure
>1qsa_A (A:447-618) Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} Back     alignment and structure
>3b72_A (A:) Lysozyme C; hen egg-white lysozyme, protein-SDS complex, MPD, allergen, antimicrobial, bacteriolytic enzyme glycosidase, hydrolase; 1.50A {Gallus gallus} Back     alignment and structure
>2fbd_A (A:) Lysozyme 1; digestive lysozime, hydrolase; HET: PEG; 1.90A {Musca domestica} PDB: 2h5z_A* 3cb7_A Back     alignment and structure
>2vb1_A (A:) Lysozyme C; antimicrobial, triclinic HEWL, atomic resolution, allergen, hydrolase, glycosidase, bacteriolytic enzyme; HET: EDO; 0.65A {Gallus gallus} Back     alignment and structure
>2zyc_A (A:1-38,A:91-170) Peptidoglycan hydrolase FLGJ; 1.74A {Sphingomonas SP} Back     alignment and structure
>3fi7_A (A:26-72,A:139-183) LMO1076 protein; listeria monocytogenes, autolysin, N acetylglucosaminidase, peptidoglycan hydrolase, autoinhibition, GH73; 2.35A {Undefined} Back     alignment and structure