254780309
comF family protein
GeneID in NCBI database: | 8209291 | Locus tag: | CLIBASIA_00970 |
Protein GI in NCBI database: | 254780309 | Protein Accession: | YP_003064722.1 |
Gene range: | -(200229, 200408) | Protein Length: | 59aa |
Gene description: | comF family protein | ||
COG prediction: | [R] Predicted amidophosphoribosyltransferases | ||
KEGG prediction: | ComF family protein | ||
SEED prediction: | Competence protein comF | ||
Pathway involved in KEGG: | not defined | ||
Subsystem involved in SEED: | - none - | ||
sequence | sequence profile |
Prediction of Local Sequence Properties
Source | Summary | Result |
---|
|
|
Close Homologs Detected by BLAST or PSI-BLAST
Homolog within the Genome Detected by BLAST
Original result of BLAST against C. L. asiaticus genome
Identity | Alignment graph | Length | Definition | E-value | |
Target | 59 | comF family protein [Candidatus Liberibacter asiaticus | |||
254780409 | 310 | ribose-phosphate pyrophosphokinase [Candidatus Lib | 0.010 |
>gi|254780409|ref|YP_003064822.1| ribose-phosphate pyrophosphokinase [Candidatus Liberibacter asiaticus str. psy62] Length = 310 | Back alignment |
---|
Score = 29.6 bits (65), Expect = 0.010, Method: Composition-based stats. Identities = 16/35 (45%), Positives = 22/35 (62%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49 V G +LIDD+ TG T AA AL + GA++V+ Sbjct: 207 VEGKDCILIDDIVDTGGTLCGAADALYEQGALSVT 241 |
Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations
Original result of PSI-BLAST first 2 iterations
Identity | Alignment graph | Length | Definition | Round | E-value |
Target | 59 | comF family protein [Candidatus Liberibacter asiaticus | |||
315122266 | 214 | competence protein F, putative [Candidatus Liberibacter | 1 | 2e-17 | |
319406072 | 225 | competence protein ComF [Bartonella sp. AR 15-3] Length | 1 | 2e-10 | |
121601823 | 251 | comF family protein [Bartonella bacilliformis KC583] Le | 1 | 5e-10 | |
319408180 | 247 | competence protein ComF [Bartonella schoenbuchensis R1] | 1 | 6e-10 | |
326539594 | 251 | competence protein F [Brucella melitensis M5-90] Length | 1 | 7e-10 | |
306842968 | 262 | competence protein F [Brucella sp. BO2] Length = 262 | 1 | 7e-10 | |
256158382 | 262 | putative competence protein F [Brucella ceti M490/95/1] | 1 | 7e-10 | |
256112214 | 262 | competence protein F [Brucella melitensis bv. 3 str. Et | 1 | 7e-10 | |
254717947 | 262 | protein gntX [Brucella sp. 83/13] Length = 262 | 1 | 7e-10 | |
254700524 | 262 | putative competence protein F [Brucella suis bv. 5 str. | 1 | 7e-10 |
>gi|315122266|ref|YP_004062755.1| competence protein F, putative [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 214 | Back alignment and organism information |
---|
Score = 92.4 bits (228), Expect = 2e-17, Method: Composition-based stats. Identities = 45/59 (76%), Positives = 53/59 (89%) Query: 1 MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59 + NAF+VPQY K++AG KILLIDDVYTTGATA+ AAIALKKAGA ++SILTFSRSLK+ Sbjct: 156 LHNAFHVPQYAQKYIAGFKILLIDDVYTTGATAQYAAIALKKAGAKSISILTFSRSLKN 214 |
Species: Candidatus Liberibacter solanacearum Genus: Candidatus Liberibacter Family: Rhizobiaceae Order: Rhizobiales Class: Alphaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
>gi|319406072|emb|CBI79702.1| competence protein ComF [Bartonella sp. AR 15-3] Length = 225 | Back alignment and organism information |
---|
>gi|121601823|ref|YP_988686.1| comF family protein [Bartonella bacilliformis KC583] Length = 251 | Back alignment and organism information |
---|
>gi|319408180|emb|CBI81833.1| competence protein ComF [Bartonella schoenbuchensis R1] Length = 247 | Back alignment and organism information |
---|
>gi|326539594|gb|ADZ87809.1| competence protein F [Brucella melitensis M5-90] Length = 251 | Back alignment and organism information |
---|
>gi|306842968|ref|ZP_07475602.1| competence protein F [Brucella sp. BO2] Length = 262 | Back alignment and organism information |
---|
>gi|256158382|ref|ZP_05456280.1| putative competence protein F [Brucella ceti M490/95/1] Length = 262 | Back alignment and organism information |
---|
>gi|256112214|ref|ZP_05453135.1| competence protein F [Brucella melitensis bv. 3 str. Ether] Length = 262 | Back alignment and organism information |
---|
>gi|254717947|ref|ZP_05179758.1| protein gntX [Brucella sp. 83/13] Length = 262 | Back alignment and organism information |
---|
>gi|254700524|ref|ZP_05162352.1| putative competence protein F [Brucella suis bv. 5 str. 513] Length = 262 | Back alignment and organism information |
---|
Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch
Conserved Domains in CDD Database Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Original result of RPS-BLASTagainst CDD database part II
Identity | Alignment graph | Length | Definition | E-value |
Target | 59 | comF family protein [Candidatus Liberibacter asiaticus | ||
TIGR00201 | 190 | TIGR00201, comF, comF family protein | 1e-05 | |
PRK11595 | 227 | PRK11595, PRK11595, DNA utilization protein GntX; Provi | 8e-05 | |
PRK02304 | 175 | PRK02304, PRK02304, adenine phosphoribosyltransferase; | 9e-04 | |
COG1040 | 225 | COG1040, ComFC, Predicted amidophosphoribosyltransferas | 5e-09 |
>gnl|CDD|161762 TIGR00201, comF, comF family protein | Back alignment and domain information |
---|
>gnl|CDD|183221 PRK11595, PRK11595, DNA utilization protein GntX; Provisional | Back alignment and domain information |
---|
>gnl|CDD|179411 PRK02304, PRK02304, adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>gnl|CDD|31242 COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
---|
Conserved Domains in CDD Database Detected by HHsearch
Original result of HHsearch against CDD database
Identity | Alignment graph | Length | Definition | Probability |
Target | 59 | comF family protein [Candidatus Liberibacter asiaticus | ||
PRK11595 | 227 | gluconate periplasmic binding protein; Provisional | 99.68 | |
COG1040 | 225 | ComFC Predicted amidophosphoribosyltransferases [Genera | 99.5 | |
TIGR00201 | 207 | comF comF family protein; InterPro: IPR005222 Proteins | 99.36 | |
TIGR01203 | 183 | HGPRTase hypoxanthine phosphoribosyltransferase; InterP | 99.22 | |
COG0634 | 178 | Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nuc | 99.14 | |
PTZ00271 | 211 | hypoxanthine-guanine phosphoribosyltransferase; Provisi | 99.13 | |
PRK09162 | 181 | hypoxanthine-guanine phosphoribosyltransferase; Provisi | 99.1 | |
COG0462 | 314 | PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide | 99.06 | |
PTZ00149 | 231 | hypoxanthine phosphoribosyltransferase; Provisional | 99.04 | |
PRK03675 | 279 | consensus | 99.03 | |
PRK06827 | 381 | phosphoribosylpyrophosphate synthetase; Provisional | 99.03 | |
PTZ00145 | 443 | phosphoribosylpyrophosphate synthetase; Provisional | 99.03 | |
PRK02812 | 331 | ribose-phosphate pyrophosphokinase; Provisional | 99.01 | |
PRK01506 | 317 | consensus | 98.99 | |
PRK05259 | 310 | consensus | 98.99 | |
PRK02269 | 321 | ribose-phosphate pyrophosphokinase; Provisional | 98.99 | |
PRK00553 | 340 | ribose-phosphate pyrophosphokinase; Provisional | 98.99 | |
PRK02270 | 327 | consensus | 98.98 | |
PRK01132 | 286 | consensus | 98.98 | |
PRK01999 | 311 | consensus | 98.98 | |
PRK02458 | 323 | ribose-phosphate pyrophosphokinase; Provisional | 98.98 | |
PRK03092 | 304 | ribose-phosphate pyrophosphokinase; Provisional | 98.97 | |
PRK07199 | 301 | phosphoribosylpyrophosphate synthetase; Provisional | 98.97 | |
PRK04923 | 319 | ribose-phosphate pyrophosphokinase; Provisional | 98.97 | |
PRK00934 | 286 | ribose-phosphate pyrophosphokinase; Provisional | 98.97 | |
PRK04117 | 309 | consensus | 98.96 | |
PRK02039 | 316 | consensus | 98.96 | |
PRK01259 | 309 | ribose-phosphate pyrophosphokinase; Provisional | 98.96 | |
PRK05038 | 315 | consensus | 98.95 | |
PRK04554 | 327 | consensus | 98.95 | |
pfam00156 | 123 | Pribosyltran Phosphoribosyl transferase domain. This fa | 98.87 | |
PRK02277 | 201 | orotate phosphoribosyltransferase-like protein; Provisi | 98.73 | |
COG0034 | 470 | PurF Glutamine phosphoribosylpyrophosphate amidotransfe | 98.62 | |
COG0856 | 203 | Orotate phosphoribosyltransferase homologs [Nucleotide | 98.58 | |
PRK09246 | 503 | amidophosphoribosyltransferase; Provisional | 98.58 | |
PRK08525 | 445 | amidophosphoribosyltransferase; Provisional | 98.55 | |
PRK07631 | 475 | amidophosphoribosyltransferase; Provisional | 98.54 | |
PRK06781 | 471 | amidophosphoribosyltransferase; Provisional | 98.54 | |
PRK07349 | 495 | amidophosphoribosyltransferase; Provisional | 98.53 | |
TIGR01090 | 175 | apt adenine phosphoribosyltransferase; InterPro: IPR005 | 98.53 | |
PRK08341 | 442 | amidophosphoribosyltransferase; Provisional | 98.53 | |
PRK07272 | 484 | amidophosphoribosyltransferase; Provisional | 98.53 | |
PRK05793 | 472 | amidophosphoribosyltransferase; Provisional | 98.53 | |
PRK09123 | 480 | amidophosphoribosyltransferase; Provisional | 98.53 | |
KOG1448 | 316 | consensus | 98.53 | |
PRK06388 | 474 | amidophosphoribosyltransferase; Provisional | 98.51 | |
PRK07847 | 489 | amidophosphoribosyltransferase; Provisional | 98.51 | |
PRK05205 | 176 | bifunctional pyrimidine regulatory protein PyrR uracil | 98.49 | |
KOG0572 | 474 | consensus | 98.45 | |
TIGR01134 | 467 | purF amidophosphoribosyltransferase; InterPro: IPR00585 | 98.44 | |
KOG3367 | 216 | consensus | 98.39 | |
PRK07322 | 178 | adenine phosphoribosyltransferase; Provisional | 98.35 | |
COG2236 | 192 | Predicted phosphoribosyltransferases [General function | 98.26 | |
PRK02304 | 174 | adenine phosphoribosyltransferase; Provisional | 98.21 | |
PRK13811 | 170 | orotate phosphoribosyltransferase; Provisional | 98.2 | |
PRK00455 | 200 | pyrE orotate phosphoribosyltransferase; Validated | 98.18 | |
COG0461 | 201 | PyrE Orotate phosphoribosyltransferase [Nucleotide tran | 98.16 | |
TIGR01367 | 205 | pyrE_Therm orotate phosphoribosyltransferase; InterPro: | 98.16 | |
PRK13812 | 174 | orotate phosphoribosyltransferase; Provisional | 98.15 | |
TIGR01091 | 213 | upp uracil phosphoribosyltransferase; InterPro: IPR0057 | 98.12 | |
PRK13809 | 206 | orotate phosphoribosyltransferase; Provisional | 98.12 | |
PRK13810 | 187 | orotate phosphoribosyltransferase; Provisional | 98.11 | |
PRK12560 | 184 | adenine phosphoribosyltransferase; Provisional | 98.09 | |
PRK05500 | 478 | bifunctional orotidine 5'-phosphate decarboxylase/orota | 98.08 | |
TIGR00336 | 187 | pyrE orotate phosphoribosyltransferase; InterPro: IPR00 | 98.06 | |
COG0503 | 179 | Apt Adenine/guanine phosphoribosyltransferases and rela | 98.04 | |
PRK06031 | 233 | phosphoribosyltransferase; Provisional | 97.99 | |
COG1926 | 220 | Predicted phosphoribosyltransferases [General function | 97.97 | |
PRK00129 | 208 | upp uracil phosphoribosyltransferase; Reviewed | 97.89 | |
TIGR01251 | 316 | ribP_PPkin ribose-phosphate pyrophosphokinase; InterPro | 97.76 | |
COG0035 | 210 | Upp Uracil phosphoribosyltransferase [Nucleotide transp | 97.74 | |
KOG1712 | 183 | consensus | 97.64 | |
PRK08558 | 238 | adenine phosphoribosyltransferase; Provisional | 97.5 | |
PRK09177 | 156 | xanthine-guanine phosphoribosyltransferase; Validated | 97.49 | |
COG2065 | 179 | PyrR Pyrimidine operon attenuation protein/uracil phosp | 97.48 | |
PRK09219 | 189 | xanthine phosphoribosyltransferase; Validated | 97.38 | |
KOG1503 | 354 | consensus | 96.58 | |
PRK09213 | 274 | purine operon repressor; Provisional | 95.0 | |
KOG1017 | 267 | consensus | 94.39 | |
TIGR01743 | 269 | purR_Bsub pur operon repressor; InterPro: IPR010078 Thi | 93.81 | |
TIGR01744 | 191 | XPRTase xanthine phosphoribosyltransferase; InterPro: I | 90.54 |
>PRK11595 gluconate periplasmic binding protein; Provisional | Back alignment and domain information |
---|
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
---|
>TIGR00201 comF comF family protein; InterPro: IPR005222 Proteins in this family are found in bacterial species which posses systems for natural transformation with exogenous DNA (eg Bacillus subtilis, Haemophilus influenzae), and also species without these systems (eg Escherichia coli) | Back alignment and domain information |
---|
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase; InterPro: IPR005904 Phosphoribosyltransferases (PRT) are enzymes that catalyze the synthesis of beta-n-5'-monophosphates from phosphoribosylpyrophosphate (PRPP) and an enzyme specific amine | Back alignment and domain information |
---|
>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] | Back alignment and domain information |
---|
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK03675 consensus | Back alignment and domain information |
---|
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
---|
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
---|
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
---|
>PRK01506 consensus | Back alignment and domain information |
---|
>PRK05259 consensus | Back alignment and domain information |
---|
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
---|
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
---|
>PRK02270 consensus | Back alignment and domain information |
---|
>PRK01132 consensus | Back alignment and domain information |
---|
>PRK01999 consensus | Back alignment and domain information |
---|
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
---|
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
---|
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional | Back alignment and domain information |
---|
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
---|
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
---|
>PRK04117 consensus | Back alignment and domain information |
---|
>PRK02039 consensus | Back alignment and domain information |
---|
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional | Back alignment and domain information |
---|
>PRK05038 consensus | Back alignment and domain information |
---|
>PRK04554 consensus | Back alignment and domain information |
---|
>pfam00156 Pribosyltran Phosphoribosyl transferase domain | Back alignment and domain information |
---|
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional | Back alignment and domain information |
---|
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>PRK09246 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK08525 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK07631 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK06781 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK07349 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>TIGR01090 apt adenine phosphoribosyltransferase; InterPro: IPR005764 Adenine phosphoribosyltransferase (APRTase, 2 | Back alignment and domain information |
---|
>PRK08341 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK07272 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK05793 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK09123 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>KOG1448 consensus | Back alignment and domain information |
---|
>PRK06388 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK07847 amidophosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>KOG0572 consensus | Back alignment and domain information |
---|
>TIGR01134 purF amidophosphoribosyltransferase; InterPro: IPR005854 Purine nucleotides are synthesised both via the de novo pathway and via the salvage pathway and are vital for cell functions and cell proliferation through DNA and RNA syntheses and ATP energy supply | Back alignment and domain information |
---|
>KOG3367 consensus | Back alignment and domain information |
---|
>PRK07322 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
---|
>PRK02304 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK13811 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated | Back alignment and domain information |
---|
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase; InterPro: IPR006273 This group of sequences are a distinct clade of orotate phosphoribosyltransferases | Back alignment and domain information |
---|
>PRK13812 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>TIGR01091 upp uracil phosphoribosyltransferase; InterPro: IPR005765 The enzyme uracil phosphoribosyltransferase (UPRT, 2 | Back alignment and domain information |
---|
>PRK13809 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK13810 orotate phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK12560 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated | Back alignment and domain information |
---|
>TIGR00336 pyrE orotate phosphoribosyltransferase; InterPro: IPR004467 Orotate phosphoribosyl transferase (OPRTase) is involved in the biosynthesis of pyrimidine nucleotides | Back alignment and domain information |
---|
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>PRK06031 phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] | Back alignment and domain information |
---|
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed | Back alignment and domain information |
---|
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase; InterPro: IPR005946 Synonyms: phosphoribosylpyrophosphate synthetase Phosphoribosyldiphosphate synthetase (PRPPsase, 2 | Back alignment and domain information |
---|
>COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>KOG1712 consensus | Back alignment and domain information |
---|
>PRK08558 adenine phosphoribosyltransferase; Provisional | Back alignment and domain information |
---|
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated | Back alignment and domain information |
---|
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>PRK09219 xanthine phosphoribosyltransferase; Validated | Back alignment and domain information |
---|
>KOG1503 consensus | Back alignment and domain information |
---|
>PRK09213 purine operon repressor; Provisional | Back alignment and domain information |
---|
>KOG1017 consensus | Back alignment and domain information |
---|
>TIGR01743 purR_Bsub pur operon repressor; InterPro: IPR010078 This entry represents the pur operon repressor PurR of low-GC Gram-positive bacteria | Back alignment and domain information |
---|
>TIGR01744 XPRTase xanthine phosphoribosyltransferase; InterPro: IPR010079 This entry represent a xanthine-specific phosphoribosyltransferase of Bacillus subtilis and closely related proteins from other species, mostly from other Gram-positive bacteria | Back alignment and domain information |
---|
Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch
Homologous Structures Detected by PSI-BLAST against Nonredundant Database
Identity | Alignment graph | Length | Definition | E-value |
Target | 59 | comF family protein [Candidatus Liberibacter asiaticus | ||
3h83_A | 204 | 2.06 Angstrom Resolution Structure Of A Hypoxanthin | 7e-08 | |
3ohp_A | 177 | Crystal Structure Of Hgprt From Vibrio Cholerae Len | 1e-07 | |
1dkr_A | 317 | Crystal Structures Of Bacillus Subtilis Phosphoribo | 2e-07 | |
1ao0_A | 459 | Glutamine Phosphoribosylpyrophosphate (Prpp) Amidot | 3e-07 | |
1gph_1 | 465 | Structure Of The Allosteric Regulatory Enzyme Of Pu | 4e-07 | |
1hgx_A | 183 | Hypoxanthine-Guanine-Xanthine Phosphoribosyltransfe | 5e-07 | |
2ywt_A | 181 | Crystal Structure Of Hypoxanthine-Guanine Phosphori | 1e-06 | |
1r3u_A | 205 | Crystal Structure Of Hypoxanthine-Guanine Phosphori | 2e-06 | |
1ecf_A | 504 | Escherichia Coli Glutamine Phosphoribosylpyrophosph | 2e-06 | |
3dah_A | 319 | 2.3 A Crystal Structure Of Ribose-Phosphate Pyropho | 2e-06 | |
1u9y_A | 284 | Crystal Structure Of Phosphoribosyl Diphosphate Syn | 3e-06 | |
1vdm_A | 153 | Crystal Structure Of Purine Phosphoribosyltransfera | 3e-06 | |
2geb_A | 185 | Crystal Structure Of The Thermoanaerobacter Tengcon | 3e-06 | |
1j7j_A | 178 | Crystal Structure Of The Hprt From Salmonella Typhi | 1e-05 | |
1g9s_A | 182 | Crystal Structure Of A Complex Between E.Coli Hprt | 1e-05 | |
1qk3_A | 233 | Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribos | 3e-05 | |
1dbr_A | 231 | Hypoxanthine Guanine Xanthine Length = 231 | 4e-05 | |
1cjb_A | 231 | Malarial Purine Phosphoribosyltransferase Length = | 4e-05 | |
3mbi_A | 287 | Crystal Structure Of The Phosphoribosylpyrophosphat | 6e-05 | |
3lpn_A | 286 | Crystal Structure Of The Phosphoribosylpyrophosphat | 7e-05 | |
2h06_A | 326 | Crystal Structure Of Human Phosphoribosyl Pyrophosp | 1e-04 | |
2h07_A | 326 | Crystal Structure Of Human Phosphoribosyl Pyrophosp | 2e-04 | |
2h08_A | 326 | Crystal Structure Of Human Phosphoribosyl Pyrophosp | 2e-04 | |
1qk5_A | 233 | Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribos | 2e-04 | |
3o7m_A | 186 | 1.98 Angstrom Resolution Crystal Structure Of A Hyp | 8e-04 | |
2vfa_A | 229 | Crystal Structure Of A Chimera Of Plasmodium Falcip | 0.002 | |
1i5e_A | 209 | Crystal Structure Of Bacillus Caldolyticus Uracil P | 0.002 |
>gi|237640661|pdb|3H83|A Chain A, 2.06 Angstrom Resolution Structure Of A Hypoxanthine- Guanine Phosphoribosyltransferase (Hpt-1) From Bacillus Anthracis Str. 'ames Ancestor' Length = 204 | Back alignment and structure |
Score = 60.7 bits (147), Expect = 7e-08, Method: Composition-based stats. Identities = 12/51 (23%), Positives = 22/51 (43%) Query: 3 NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 + + + V G IL+++D+ +G T K A +V I+T Sbjct: 102 GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL 152 |
gi|305677892|pdb|3OHP|A Chain A, Crystal Structure Of Hgprt From Vibrio Cholerae Length = 177 | Back alignment and structure |
gi|7546199|pdb|1DKR|A Chain A, Crystal Structures Of Bacillus Subtilis Phosphoribosylpyrophosphate Synthetase: Molecular Basis Of Allosteric Inhibition And Activation. Length = 317 | Back alignment and structure |
>gi|2624597|pdb|1AO0|A Chain A, Glutamine Phosphoribosylpyrophosphate (Prpp) Amidotransferase From B. Subtilis Complexed With Adp And Gmp Length = 459 | Back alignment and structure |
>gi|576138|pdb|1GPH|1 Chain 1, Structure Of The Allosteric Regulatory Enzyme Of Purine Biosynthesis Length = 465 | Back alignment and structure |
gi|1827785|pdb|1HGX|A Chain A, Hypoxanthine-Guanine-Xanthine Phosphoribosyltransferase (Hgxprtase) Length = 183 | Back alignment and structure |
>gi|56553634|pdb|1R3U|A Chain A, Crystal Structure Of Hypoxanthine-Guanine Phosphoribosyltransferase From Thermoanaerobacter Tengcongensis Length = 205 | Back alignment and structure |
>gi|1943557|pdb|1ECF|A Chain A, Escherichia Coli Glutamine Phosphoribosylpyrophosphate (Prpp) Amidotransferase Length = 504 | Back alignment and structure |
>gi|190016457|pdb|3DAH|A Chain A, 2.3 A Crystal Structure Of Ribose-Phosphate Pyrophosphokinase From Burkholderia Pseudomallei Length = 319 | Back alignment and structure |
gi|75765288|pdb|1U9Y|A Chain A, Crystal Structure Of Phosphoribosyl Diphosphate Synthase From Methanocaldococcus Jannaschii Length = 284 | Back alignment and structure |
gi|67463841|pdb|1VDM|A Chain A, Crystal Structure Of Purine Phosphoribosyltransferase From Pyrococcus Horikoshii Ot3 Length = 153 | Back alignment and structure |
>gi|145579368|pdb|2GEB|A Chain A, Crystal Structure Of The Thermoanaerobacter Tengcongensis Hypoxanthine-Guanine Phosphoribosyltransferase L160i Mutant: Insights Into The Inhibitor Design Length = 185 | Back alignment and structure |
gi|34810925|pdb|1J7J|A Chain A, Crystal Structure Of The Hprt From Salmonella Typhimurium Length = 178 | Back alignment and structure |
>gi|23200063|pdb|1G9S|A Chain A, Crystal Structure Of A Complex Between E.Coli Hprt And Imp Length = 182 | Back alignment and structure |
>gi|6435648|pdb|1QK3|A Chain A, Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribosyltransferase Gmp Complex Length = 233 | Back alignment and structure |
>gi|2781198|pdb|1DBR|A Chain A, Hypoxanthine Guanine Xanthine Length = 231 | Back alignment and structure |
gi|5821998|pdb|1CJB|A Chain A, Malarial Purine Phosphoribosyltransferase Length = 231 | Back alignment and structure |
>gi|329666092|pdb|3MBI|A Chain A, Crystal Structure Of The Phosphoribosylpyrophosphate (Prpp) Synthetase From Thermoplasma Volcanium In Complex With Adp-Mg2+ And Ribose 5- Phosphate Length = 287 | Back alignment and structure |
gi|322812383|pdb|3LPN|A Chain A, Crystal Structure Of The Phosphoribosylpyrophosphate (Prpp) Synthetase From Thermoplasma Volcanium In Complex With An Atp Analog (Ampcpp). Length = 286 | Back alignment and structure |
>gi|118137847|pdb|2H06|A Chain A, Crystal Structure Of Human Phosphoribosyl Pyrophosphate Synthetase 1 Length = 326 | Back alignment and structure |
>gi|118137849|pdb|2H07|A Chain A, Crystal Structure Of Human Phosphoribosyl Pyrophosphate Synthetase 1 Mutant S132a Length = 326 | Back alignment and structure |
>gi|118137851|pdb|2H08|A Chain A, Crystal Structure Of Human Phosphoribosyl Pyrophosphate Synthetase 1 Mutant Y146m Length = 326 | Back alignment and structure |
>gi|6435656|pdb|1QK5|A Chain A, Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribosyltransferase With Xmp, Pyrophosphate And Two Mg2+ Ions Length = 233 | Back alignment and structure |
>gi|305677852|pdb|3O7M|A Chain A, 1.98 Angstrom Resolution Crystal Structure Of A Hypoxanthine-Guanine Phosphoribosyltransferase (Hpt-2) From Bacillus Anthracis Str. 'ames Ancestor' Length = 186 | Back alignment and structure |
>gi|190613413|pdb|2VFA|A Chain A, Crystal Structure Of A Chimera Of Plasmodium Falciparum And Human Hypoxanthine-Guanine Phosphoribosyl Transferases Length = 229 | Back alignment and structure |
gi|21465610|pdb|1I5E|A Chain A, Crystal Structure Of Bacillus Caldolyticus Uracil Phosphoribosyltransferase With Bound Ump Length = 209 | Back alignment and structure |
Homologous Structures in PDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
Identity | Alignment graph | Length | Definition | E-value |
Target | 59 | comF family protein [Candidatus Liberibacter asiaticus | ||
1vch_A | 175 | Phosphoribosyltransferase-related protein; structural g | 3e-04 | |
1o57_A | 291 | PUR operon repressor; purine operon repressor, helix-tu | 0.002 | |
2wns_A | 205 | Orotate phosphoribosyltransferase; alternative splicing | 0.002 | |
1qb7_A | 236 | APRT, adenine phosphoribosyltransferase; dinucleotide b | 0.003 | |
1l1q_A | 186 | Adenine phosphoribosyltransferase; aprtase, giardia lam | 0.004 |
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Length = 175 | Back alignment and structure |
---|
Score = 38.9 bits (90), Expect = 3e-04 Identities = 9/39 (23%), Positives = 19/39 (48%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53 + +++L+ DV +G T + + +AG V+ L Sbjct: 118 LLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAV 156 |
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Length = 291 | Back alignment and structure |
---|
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Length = 205 | Back alignment and structure |
---|
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Length = 236 | Back alignment and structure |
---|
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Length = 186 | Back alignment and structure |
---|
Homologous Structures in PDB70 Database Detected by HHsearch
Original result of HHsearch against PDB70 database
Identity | Alignment graph | Length | Definition | Probability |
Target | 59 | comF family protein [Candidatus Liberibacter asiaticus | ||
2ji4_A | 379 | Phosphoribosyl pyrophosphate synthetase-associated prot | 99.06 | |
1wd5_A | 208 | Hypothetical protein TT1426; structural genomics, riken | 99.05 | |
1pzm_A | 211 | HGPRT, hypoxanthine-guanine phosphoribosyltransferase; | 99.04 | |
3hvu_A | 204 | Hypoxanthine phosphoribosyltransferase; hypoxantine-gua | 99.02 | |
1tc1_A | 220 | Protein (hypoxanthine phosphoribosyltransferase); trans | 98.99 | |
3dah_A | 319 | Ribose-phosphate pyrophosphokinase; seattle structural | 98.99 | |
1fsg_A | 233 | HGPRTASE, hypoxanthine-guanine phosphoribosyltransferas | 98.99 | |
2h06_A | 326 | Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthe | 98.99 | |
1cjb_A | 231 | Protein (hypoxanthine-guanine phosphoribosyltransferase | 98.99 | |
1yfz_A | 205 | Hypoxanthine-guanine phosphoribosyltransferase; protein | 98.98 | |
1dku_A | 317 | Protein (phosphoribosyl pyrophosphate synthetase); open | 98.97 | |
1vdm_A | 153 | Purine phosphoribosyltransferase; structural genomics, | 98.97 | |
2jbh_A | 225 | HHGP; glycosyltransferase, PRTFDC1, transferase, purine | 98.96 | |
3o7m_A | 186 | Hypoxanthine phosphoribosyltransferase; hypoxanthine-gu | 98.95 | |
1u9y_A | 284 | RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthas | 98.95 | |
1z7g_A | 217 | HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltra | 98.94 | |
2geb_A | 185 | Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, | 98.93 | |
3ohp_A | 177 | Hypoxanthine phosphoribosyltransferase; structural geno | 98.92 | |
2ywu_A | 181 | Hypoxanthine-guanine phosphoribosyltransferase; rossman | 98.9 | |
1hgx_A | 183 | HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyl | 98.89 | |
1a3c_A | 181 | PYRR, pyrimidine operon regulatory protein PYRR; transc | 98.88 | |
1vch_A | 175 | Phosphoribosyltransferase-related protein; structural g | 98.87 | |
1ufr_A | 181 | TT1027, PYR mRNA-binding attenuation protein; pyrimidin | 98.84 | |
1dqn_A | 230 | Guanine phosphoribosyltransferase; protein-inhibitor co | 98.7 | |
1w30_A | 201 | PYRR bifunctional protein; transferase, glycosyltransfe | 98.69 | |
2jky_A | 213 | Hypoxanthine-guanine phosphoribosyltransferase; nucleus | 98.59 | |
1g2q_A | 187 | Adenine phosphoribosyltransferase 1; dimer, single doma | 98.55 | |
1ecf_A | 504 | Glutamine phosphoribosylpyrophosphate amidotransferase; | 98.53 | |
1qb7_A | 236 | APRT, adenine phosphoribosyltransferase; dinucleotide b | 98.47 | |
1ao0_A | 459 | Glutamine phosphoribosylpyrophosphate amidotransferase; | 98.46 | |
2p1z_A | 180 | Phosphoribosyltransferase; structural genomics, PSI-2, | 98.45 | |
1y0b_A | 197 | Xanthine phosphoribosyltransferase; purine metabolism, | 98.45 | |
2wns_A | 205 | Orotate phosphoribosyltransferase; alternative splicing | 98.42 | |
1o57_A | 291 | PUR operon repressor; purine operon repressor, helix-tu | 98.42 | |
2yzk_A | 178 | OPRT, oprtase, orotate phosphoribosyltransferase; rossm | 98.4 | |
2ps1_A | 226 | Orotate phosphoribosyltransferase 1; alpha beta, oprtas | 98.4 | |
1zn8_A | 180 | APRT, adenine phosphoribosyltransferase; glycosyltransf | 98.38 | |
3m3h_A | 234 | OPRT, oprtase, orotate phosphoribosyltransferase; pyrim | 98.37 | |
2dy0_A | 190 | APRT, adenine phosphoribosyltransferase; structural gen | 98.36 | |
3mjd_A | 232 | Orotate phosphoribosyltransferase; IDP02311, csgid, str | 98.36 | |
1l1q_A | 186 | Adenine phosphoribosyltransferase; aprtase, giardia lam | 98.3 | |
3dez_A | 243 | OPRT, oprtase, orotate phosphoribosyltransferase; glyco | 98.3 | |
2aee_A | 211 | OPRT, oprtase, orotate phosphoribosyltransferase; struc | 98.24 | |
3n2l_A | 238 | OPRT, oprtase, orotate phosphoribosyltransferase; pyrim | 98.2 | |
1lh0_A | 213 | OMP synthase; loop closure, monomer closure, orotate ph | 98.06 | |
1nul_A | 152 | XPRT, xanthine-guanine phosphoribosyltransferase; purin | 98.02 | |
2ehj_A | 208 | Uracil phosphoribosyltransferase; structural genomics, | 97.94 | |
1o5o_A | 221 | Uracil phosphoribosyltransferase; TM0721, structural ge | 97.89 | |
1i5e_A | 209 | Uracil phosphoribosyltransferase; salvage pathway; HET: | 97.78 | |
1v9s_A | 208 | Uracil phosphoribosyltransferase; pyrimidine salvage, o | 97.78 | |
1bd3_D | 243 | Uprtase, uracil phosphoribosyltransferase; glycosyltran | 97.5 | |
2e55_A | 208 | Uracil phosphoribosyltransferase; structural genomics, | 97.46 | |
3dmp_A | 217 | Uracil phosphoribosyltransferase; structural genomics, | 97.32 | |
1xtt_A | 216 | Probable uracil phosphoribosyltransferase; tetramer, ty | 97.03 |
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* | Back alignment and structure |
---|
Probab=99.06 E-value=3.1e-10 Score=75.59 Aligned_cols=46 Identities=24% Similarity=0.320 Sum_probs=42.4 Q ss_pred HCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC Q ss_conf 0028975999920045738899999999978997899999983068 Q gi|254780309|r 13 KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58 (59) Q Consensus 13 ~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~ 58 (59) .+++||+|+|||||++||.|+.++++.|++.||++|++++.+..++ T Consensus 268 GDVkGk~vIIVDDiIdTGgTl~~aa~~Lk~~GA~~V~~~~THgvfs 313 (379) T 2ji4_A 268 GDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLS 313 (379) T ss_dssp SCCTTSEEEEEEEEECSCHHHHHHHHHHHHTTCCEEEEEEEEECCC T ss_pred ECEEEEEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC T ss_conf 0120038999543433126699999999976998379999797688 |
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
---|
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 | Back alignment and structure |
---|
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxantine-guanine phosphoribosyltransferase, 2-(N- morpholino)ethanesulfonic acid (MES); HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* | Back alignment and structure |
---|
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* | Back alignment and structure |
---|
>3dah_A Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
---|
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii RH} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A | Back alignment and structure |
---|
>2h06_A Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthetase 1, phosphoribosyl pyrophosphate synthetase 1, transferase; 2.20A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h07_A 2h08_A | Back alignment and structure |
---|
>1cjb_A Protein (hypoxanthine-guanine phosphoribosyltransferase); malaria, purine salvage, transition state inhibitor; HET: IRP; 2.00A {Plasmodium falciparum} SCOP: c.61.1.1 | Back alignment and structure |
---|
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis MB4} SCOP: c.61.1.1 PDB: 1r3u_A* | Back alignment and structure |
---|
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* | Back alignment and structure |
---|
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 | Back alignment and structure |
---|
>2jbh_A HHGP; glycosyltransferase, PRTFDC1, transferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} | Back alignment and structure |
---|
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} | Back alignment and structure |
---|
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* | Back alignment and structure |
---|
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* | Back alignment and structure |
---|
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
---|
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A | Back alignment and structure |
---|
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 | Back alignment and structure |
---|
>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding protein, pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* | Back alignment and structure |
---|
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
---|
>1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 | Back alignment and structure |
---|
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* | Back alignment and structure |
---|
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 | Back alignment and structure |
---|
>2jky_A Hypoxanthine-guanine phosphoribosyltransferase; nucleus, cytoplasm, magnesium, GMP complex, FLIP peptide-plane, glycosyltransferase; HET: 5GP; 2.3A {Saccharomyces cerevisiae} PDB: 2jkz_A* | Back alignment and structure |
---|
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A | Back alignment and structure |
---|
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransferase; purine biosynthesis, glycosyltransferase, glutamine amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* | Back alignment and structure |
---|
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* | Back alignment and structure |
---|
>1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* | Back alignment and structure |
---|
>2p1z_A Phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.44A {Corynebacterium diphtheriae NCTC13129} | Back alignment and structure |
---|
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, structural genomics, PSI, protein structure initative; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* | Back alignment and structure |
---|
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} | Back alignment and structure |
---|
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* | Back alignment and structure |
---|
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} | Back alignment and structure |
---|
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* | Back alignment and structure |
---|
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, polymorphism, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* | Back alignment and structure |
---|
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* | Back alignment and structure |
---|
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} | Back alignment and structure |
---|
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} | Back alignment and structure |
---|
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* | Back alignment and structure |
---|
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} | Back alignment and structure |
---|
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, protein structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 | Back alignment and structure |
---|
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} | Back alignment and structure |
---|
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A | Back alignment and structure |
---|
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* | Back alignment and structure |
---|
>2ehj_A Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Escherichia coli} | Back alignment and structure |
---|
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomics, JCSG, PSI, protein structure initiative; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 | Back alignment and structure |
---|
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 | Back alignment and structure |
---|
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics; 2.10A {Thermus thermophilus HB8} SCOP: c.61.1.1 | Back alignment and structure |
---|
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* | Back alignment and structure |
---|
>2e55_A Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.15A {Aquifex aeolicus} | Back alignment and structure |
---|
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} | Back alignment and structure |
---|
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* | Back alignment and structure |
---|
Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch
Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
Identity | Alignment graph | Length | Definition | E-value |
59 | comF family protein [Candidatus Liberibacter asiaticus | |||
d1vcha1 | 174 | c.61.1.1 (A:2-175) Putative phosphoribosyltransferase T | 6e-04 |
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Length = 174 | Back information, alignment and structure |
---|
class: Alpha and beta proteins (a/b) fold: PRTase-like superfamily: PRTase-like family: Phosphoribosyltransferases (PRTases) domain: Putative phosphoribosyltransferase TTHA1613 species: Thermus thermophilus [TaxId: 274] Score = 36.6 bits (84), Expect = 6e-04 Identities = 9/38 (23%), Positives = 19/38 (50%) Query: 15 VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52 + +++L+ DV +G T + + +AG V+ L Sbjct: 117 LLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLA 154 |
Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
Identity | Alignment graph | Length | Definition | Probability |
Target | 59 | comF family protein [Candidatus Liberibacter asiaticus | ||
d1wd5a_ | 208 | Putative phosphoribosyltransferase TT1426 (TTHA1462) {T | 99.06 | |
d2c4ka2 | 184 | PRPP synthetase-associated protein 1 {Human (Homo sapie | 99.03 | |
d1u9ya2 | 129 | Phosphoribosylpyrophosphate synthetase {Methanocaldococ | 99.01 | |
d1fsga_ | 233 | Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii | 98.99 | |
d1cjba_ | 228 | Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falc | 98.98 | |
d1z7ga1 | 214 | Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sap | 98.97 | |
d1pzma_ | 183 | Hypoxanthine-guanine-xanthine PRTase {Leishmania tarent | 98.97 | |
d1yfza1 | 178 | Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter t | 98.96 | |
d1ufra_ | 178 | Pyrimidine operon regulator PyrR {Thermus thermophilus | 98.95 | |
d1dkua2 | 149 | Phosphoribosylpyrophosphate synthetase {Bacillus subtil | 98.95 | |
d1vdma1 | 153 | Pprobable purine phosphoribosyltransferase PH0095 {Pyro | 98.94 | |
d1tc1a_ | 184 | Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} | 98.92 | |
d1a3ca_ | 178 | Pyrimidine operon regulator PyrR {Bacillus subtilis [Ta | 98.88 | |
d1j7ja_ | 172 | Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 903 | 98.87 | |
d1hgxa_ | 173 | Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas fo | 98.87 | |
d1w30a_ | 182 | Pyrimidine operon regulator PyrR {Mycobacterium tubercu | 98.85 | |
d1vcha1 | 174 | Putative phosphoribosyltransferase TTHA1613 {Thermus th | 98.84 | |
d1dqna_ | 230 | Guanine PRTase {Giardia lamblia [TaxId: 5741]} | 98.69 | |
d1gph11 | 231 | Glutamine PRPP amidotransferase, C-terminal domain {Bac | 98.62 | |
d1g2qa_ | 178 | Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae | 98.54 | |
d1ecfa1 | 243 | Glutamine PRPP amidotransferase, C-terminal domain {Esc | 98.54 | |
d1qb7a_ | 236 | Adenine PRTase {Leishmania donovani [TaxId: 5661]} | 98.48 | |
d1zn7a1 | 178 | Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} | 98.46 | |
d1y0ba1 | 191 | Xanthine phosphoribosyltransferase {Bacillus subtilis [ | 98.45 | |
d1o57a2 | 202 | Pur operon repressor (PurR), C-terminal domain {Bacillu | 98.44 | |
d1l1qa_ | 181 | Adenine PRTase {Giardia lamblia [TaxId: 5741]} | 98.3 | |
d2aeea1 | 208 | Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} | 98.25 | |
d1lh0a_ | 213 | Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} | 98.1 | |
d1nula_ | 150 | Xanthine-guanine PRTase (XPRTase) {Escherichia coli [Ta | 97.92 | |
d1i5ea_ | 208 | Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394] | 97.86 | |
d1o5oa_ | 210 | Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} | 97.81 | |
d1v9sa1 | 208 | Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} | 97.73 | |
d1bd3a_ | 224 | Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} | 97.62 | |
d1xtta1 | 215 | Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 228 | 97.06 |
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
class: Alpha and beta proteins (a/b) fold: PRTase-like superfamily: PRTase-like family: Phosphoribosyltransferases (PRTases) domain: Putative phosphoribosyltransferase TT1426 (TTHA1462) species: Thermus thermophilus [TaxId: 274] Probab=99.06 E-value=1.2e-10 Score=76.50 Aligned_cols=43 Identities=23% Similarity=0.288 Sum_probs=39.4 Q ss_pred HHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEE Q ss_conf 1002897599992004573889999999997899789999998 Q gi|254780309|r 12 SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS 54 (59) Q Consensus 12 ~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~la 54 (59) ..+++||+|+||||+++||+|+.++++.|+++||++|++++.. T Consensus 115 ~~~v~gk~ViLVDD~I~TG~T~~aa~~~L~~~ga~~V~~a~~v 157 (208) T d1wd5a_ 115 KAARKGRDVVLVDDGVATGASMEAALSVVFQEGPRRVVVAVPV 157 (208) T ss_dssp CCCCTTSEEEEECSCBSSCHHHHHHHHHHHTTCCSEEEEEEEE T ss_pred CCCCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEECC T ss_conf 7345898899970400135789999999995699889996034 |
>d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
---|
>d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
---|
>d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
---|
>d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} | Back information, alignment and structure |
---|
>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} | Back information, alignment and structure |
---|
>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
---|
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
---|
>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
---|
>d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
---|
>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
---|
>d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
---|
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
---|
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} | Back information, alignment and structure |
---|
>d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
---|
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} | Back information, alignment and structure |
---|
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
---|
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
---|
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} | Back information, alignment and structure |
---|
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
---|
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
---|
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
---|
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
---|
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
---|
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
---|
Homologous Domains in MMDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against MMDB70 database
Identity | Alignment graph | Length | Definition | E-value |
Target | 59 | comF family protein [Candidatus Liberibacter asiat | ||
1nul_A_9-131 | 123 | (A:9-131) XPRT, xanthine-guanine phosphoribosyltra | 6e-04 | |
1hgx_A_18-155 | 138 | (A:18-155) HGXPRTASE, hypoxanthine-guanine-xanthin | 7e-04 | |
1j7j_A_12-150 | 139 | (A:12-150) HPRT, hypoxanthine phosphoribosyltransf | 0.001 | |
1pzm_A_31-176 | 146 | (A:31-176) HGPRT, hypoxanthine-guanine phosphoribo | 0.003 | |
3dez_A_100-183 | 84 | (A:100-183) OPRT, oprtase, orotate phosphoribosylt | 0.003 |
>1nul_A (A:9-131) XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli}Length = 123 | Back alignment and structure |
---|
Score = 37.6 bits (87), Expect = 6e-04 Identities = 12/48 (25%), Positives = 18/48 (37%) Query: 1 MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48 N + G ++IDD+ TG TA KA +T+ Sbjct: 57 HDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTI 104 |
>1hgx_A (A:18-155) HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus}Length = 138 | Back alignment and structure |
---|
>1j7j_A (A:12-150) HPRT, hypoxanthine phosphoribosyltransferase; glycosyltransferase, nucleotide metabolism, purine salvage; 2.30A {Salmonella typhimurium}Length = 139 | Back alignment and structure |
---|
>1pzm_A (A:31-176) HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae}Length = 146 | Back alignment and structure |
---|
>3dez_A (A:100-183) OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, magnesium, pyrimidine biosynthesis; 2.40A {Streptococcus mutans}Length = 84 | Back alignment and structure |
---|
Homologous Domains in MMDB70 Database Detected by HHsearch
Original result of HHsearch against MMDB70 database
Identity | Alignment graph | Length | Definition | Probability |
Target | 59 | comF family protein [Candidatus Liberibacter asiaticus | ||
2ji4_A_176-351 | 176 | Phosphoribosyl pyrophosphate synthetase-associated | 99.29 | |
1vch_A_ | 175 | Phosphoribosyltransferase-related protein; structu | 99.26 | |
1ao0_A_242-459 | 218 | Glutamine phosphoribosylpyrophosphate amidotransfe | 99.13 | |
1tc1_A_15-160 | 146 | Protein (hypoxanthine phosphoribosyltransferase); | 99.12 | |
2jbh_A_ | 225 | HHGP; glycosyltransferase, PRTFDC1, transferase, p | 99.09 | |
1pzm_A_31-176 | 146 | HGPRT, hypoxanthine-guanine phosphoribosyltransfer | 99.09 | |
1w30_A_ | 201 | PYRR bifunctional protein; transferase, glycosyltr | 99.08 | |
1hgx_A_18-155 | 138 | HGXPRTASE, hypoxanthine-guanine-xanthine phosphori | 99.06 | |
3hvu_A_38-174 | 137 | Hypoxanthine phosphoribosyltransferase; hypoxantin | 99.06 | |
2geb_A_20-156 | 137 | Hypoxanthine-guanine phosphoribosyltransferase; HG | 99.04 | |
1g2q_A_ | 187 | Adenine phosphoribosyltransferase 1; dimer, single | 99.04 | |
1zn8_A_ | 180 | APRT, adenine phosphoribosyltransferase; glycosylt | 99.02 | |
1ecf_A_258-459 | 202 | Glutamine phosphoribosylpyrophosphate amidotransfe | 99.01 | |
1a3c_A_ | 181 | PYRR, pyrimidine operon regulatory protein PYRR; t | 99.01 | |
1i5e_A_1-8_70-209 | 148 | Uracil phosphoribosyltransferase; salvage pathway; | 99.0 | |
1yfz_A_39-176 | 138 | Hypoxanthine-guanine phosphoribosyltransferase; pr | 99.0 | |
1z7g_A_ | 217 | HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos | 98.99 | |
1j7j_A_12-150 | 139 | HPRT, hypoxanthine phosphoribosyltransferase; glyc | 98.98 | |
1y0b_A_ | 197 | Xanthine phosphoribosyltransferase; purine metabol | 98.98 | |
1vdm_A_ | 153 | Purine phosphoribosyltransferase; structural genom | 98.97 | |
1cjb_A_ | 231 | Protein (hypoxanthine-guanine phosphoribosyltransf | 98.97 | |
1o57_A_77-291 | 215 | PUR operon repressor; purine operon repressor, hel | 98.94 | |
1wd5_A_ | 208 | Hypothetical protein TT1426; structural genomics, | 98.93 | |
2dy0_A_ | 190 | APRT, adenine phosphoribosyltransferase; structura | 98.91 | |
1l1q_A_ | 186 | Adenine phosphoribosyltransferase; aprtase, giardi | 98.9 | |
1qb7_A_1-215 | 215 | APRT, adenine phosphoribosyltransferase; dinucleot | 98.9 | |
1fsg_A_ | 233 | HGPRTASE, hypoxanthine-guanine phosphoribosyltrans | 98.9 | |
1ufr_A_11-155 | 145 | TT1027, PYR mRNA-binding attenuation protein; pyri | 98.9 | |
1lh0_A_40-184 | 145 | OMP synthase; loop closure, monomer closure, orota | 98.89 | |
2ps1_A_1-20_44-207 | 184 | Orotate phosphoribosyltransferase 1; alpha beta, o | 98.89 | |
2ywu_A_ | 181 | Hypoxanthine-guanine phosphoribosyltransferase; ro | 98.88 | |
2wns_A_39-171 | 133 | Orotate phosphoribosyltransferase; alternative spl | 98.86 | |
2ehj_A_ | 208 | Uracil phosphoribosyltransferase; structural genom | 98.86 | |
2p1z_A_ | 180 | Phosphoribosyltransferase; structural genomics, PS | 98.85 | |
2yzk_A_1-10_35-178 | 154 | OPRT, oprtase, orotate phosphoribosyltransferase; | 98.85 | |
1o5o_A_ | 221 | Uracil phosphoribosyltransferase; TM0721, structur | 98.82 | |
1u9y_A_143-270 | 128 | RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy | 98.81 | |
1v9s_A_ | 208 | Uracil phosphoribosyltransferase; pyrimidine salva | 98.81 | |
3dez_A_100-183 | 84 | OPRT, oprtase, orotate phosphoribosyltransferase; | 98.78 | |
2h06_A_148-292 | 145 | Ribose-phosphate pyrophosphokinase I; PRS1, PRPP s | 98.76 | |
2jky_A_10-185 | 176 | Hypoxanthine-guanine phosphoribosyltransferase; nu | 98.75 | |
2aee_A_68-174 | 107 | OPRT, oprtase, orotate phosphoribosyltransferase; | 98.75 | |
2e55_A_ | 208 | Uracil phosphoribosyltransferase; structural genom | 98.73 | |
1xtt_A_ | 216 | Probable uracil phosphoribosyltransferase; tetrame | 98.71 | |
1dqn_A_60-175 | 116 | Guanine phosphoribosyltransferase; protein-inhibit | 98.69 | |
1nul_A_9-131 | 123 | XPRT, xanthine-guanine phosphoribosyltransferase; | 98.69 | |
3dah_A_153-295 | 143 | Ribose-phosphate pyrophosphokinase; seattle struct | 98.68 | |
1bd3_D_ | 243 | Uprtase, uracil phosphoribosyltransferase; glycosy | 98.66 | |
1dku_A_154-295 | 142 | Protein (phosphoribosyl pyrophosphate synthetase); | 98.65 | |
3dmp_A_ | 217 | Uracil phosphoribosyltransferase; structural genom | 98.65 |
>2ji4_A (A:176-351) Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* | Back alignment and structure |
---|
Probab=99.29 E-value=7e-12 Score=85.26 Aligned_cols=52 Identities=25% Similarity=0.312 Sum_probs=45.8 Q ss_pred ECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC Q ss_conf 2510210028975999920045738899999999978997899999983068 Q gi|254780309|r 7 VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK 58 (59) Q Consensus 7 i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~ 58 (59) ........++||+|+||||++|||+|+.++++.|+++||++|++++++.... T Consensus 87 ~~~~~~~~~~gk~VliVDDii~TG~Tl~~~~~~L~~~Ga~~V~~~~~~~~~~ 138 (176) T 2ji4_A 87 PPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLS 138 (176) T ss_dssp -CCCEESCCTTSEEEEEEEEECSCHHHHHHHHHHHHTTCCEEEEEEEEECCC T ss_pred CCEEEEEECCCCEEEEECCHHCCHHHHHHHHHHHHHCCCCEEEEEEECCCCC T ss_conf 2203565117978999664110278799999999865998379999798688 |
>1vch_A (A:) Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} | Back alignment and structure |
---|
>1ao0_A (A:242-459) Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} | Back alignment and structure |
---|
>1tc1_A (A:15-160) Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} | Back alignment and structure |
---|
>2jbh_A (A:) HHGP; glycosyltransferase, PRTFDC1, transferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} | Back alignment and structure |
---|
>1pzm_A (A:31-176) HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} | Back alignment and structure |
---|
>1w30_A (A:) PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} | Back alignment and structure |
---|
>1hgx_A (A:18-155) HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} | Back alignment and structure |
---|
>3hvu_A (A:38-174) Hypoxanthine phosphoribosyltransferase; hypoxantine-guanine phosphoribosyltransferase, 2-(N- morpholino)ethanesulfonic acid (MES); HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* | Back alignment and structure |
---|
>2geb_A (A:20-156) Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
---|
>1g2q_A (A:) Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>1zn8_A (A:) APRT, adenine phosphoribosyltransferase; glycosyltransferase, polymorphism, purine salvage; HET: AMP; 1.76A {Homo sapiens} | Back alignment and structure |
---|
>1ecf_A (A:258-459) Glutamine phosphoribosylpyrophosphate amidotransferase; purine biosynthesis, glycosyltransferase, glutamine amidotransferase; HET: PIN; 2.00A {Escherichia coli} | Back alignment and structure |
---|
>1a3c_A (A:) PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding protein, pyrimidine biosynthesis; 1.60A {Bacillus subtilis} | Back alignment and structure |
---|
>1i5e_A (A:1-8,A:70-209) Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} | Back alignment and structure |
---|
>1yfz_A (A:39-176) Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis MB4} | Back alignment and structure |
---|
>1z7g_A (A:) HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} | Back alignment and structure |
---|
>1j7j_A (A:12-150) HPRT, hypoxanthine phosphoribosyltransferase; glycosyltransferase, nucleotide metabolism, purine salvage; 2.30A {Salmonella typhimurium} | Back alignment and structure |
---|
>1y0b_A (A:) Xanthine phosphoribosyltransferase; purine metabolism, structural genomics, PSI, protein structure initative; HET: G4P; 1.80A {Bacillus subtilis} | Back alignment and structure |
---|
>1vdm_A (A:) Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} | Back alignment and structure |
---|
>1cjb_A (A:) Protein (hypoxanthine-guanine phosphoribosyltransferase); malaria, purine salvage, transition state inhibitor; HET: IRP; 2.00A {Plasmodium falciparum} | Back alignment and structure |
---|
>1o57_A (A:77-291) PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} | Back alignment and structure |
---|
>1wd5_A (A:) Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} | Back alignment and structure |
---|
>2dy0_A (A:) APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} | Back alignment and structure |
---|
>1l1q_A (A:) Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} | Back alignment and structure |
---|
>1qb7_A (A:1-215) APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} | Back alignment and structure |
---|
>1fsg_A (A:) HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii RH} | Back alignment and structure |
---|
>1ufr_A (A:11-155) TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} | Back alignment and structure |
---|
>1lh0_A (A:40-184) OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
---|
>2ps1_A (A:1-20,A:44-207) Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* | Back alignment and structure |
---|
>2wns_A (A:39-171) Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} | Back alignment and structure |
---|
>2ehj_A (A:) Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Escherichia coli} | Back alignment and structure |
---|
>2p1z_A (A:) Phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.44A {Corynebacterium diphtheriae NCTC13129} | Back alignment and structure |
---|
>2yzk_A (A:1-10,A:35-178) OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} | Back alignment and structure |
---|
>1o5o_A (A:) Uracil phosphoribosyltransferase; TM0721, structural genomics, JCSG, PSI, protein structure initiative; HET: U5P; 2.30A {Thermotoga maritima} | Back alignment and structure |
---|
>1u9y_A (A:143-270) RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} | Back alignment and structure |
---|
>1v9s_A (A:) Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics; 2.10A {Thermus thermophilus HB8} | Back alignment and structure |
---|
>3dez_A (A:100-183) OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, magnesium, pyrimidine biosynthesis; 2.40A {Streptococcus mutans} | Back alignment and structure |
---|
>2h06_A (A:148-292) Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthetase 1, phosphoribosyl pyrophosphate synthetase 1, transferase; 2.20A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h07_A 2h08_A | Back alignment and structure |
---|
>2jky_A (A:10-185) Hypoxanthine-guanine phosphoribosyltransferase; nucleus, cytoplasm, magnesium, GMP complex, FLIP peptide-plane, glycosyltransferase; HET: 5GP; 2.3A {Saccharomyces cerevisiae} PDB: 2jkz_A* | Back alignment and structure |
---|
>2aee_A (A:68-174) OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, protein structure initiative; 1.95A {Streptococcus pyogenes} | Back alignment and structure |
---|
>2e55_A (A:) Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.15A {Aquifex aeolicus} | Back alignment and structure |
---|
>1xtt_A (A:) Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
---|
>1dqn_A (A:60-175) Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia lamblia} | Back alignment and structure |
---|
>1nul_A (A:9-131) XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli} | Back alignment and structure |
---|
>3dah_A (A:153-295) Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
---|
>1bd3_D (D:) Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} | Back alignment and structure |
---|
>1dku_A (A:154-295) Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} | Back alignment and structure |
---|
>3dmp_A (A:) Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} | Back alignment and structure |
---|