254780309

254780309

comF family protein

GeneID in NCBI database:8209291Locus tag:CLIBASIA_00970
Protein GI in NCBI database:254780309Protein Accession:YP_003064722.1
Gene range:-(200229, 200408)Protein Length:59aa
Gene description:comF family protein
COG prediction:[R] Predicted amidophosphoribosyltransferases
KEGG prediction:ComF family protein
SEED prediction:Competence protein comF
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------6
MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD
ccccEEccccccHHHcccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEEccc
ccccEEccccccccccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEEcccc
mrnafnvpqYVSKHVAGLKILLiddvyttgATAKCAAIALKKAGAMTVSILTFSRSLKD
MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD
MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD
MRNAFN*PQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK*
MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD
*RNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD
MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD
MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target59 comF family protein [Candidatus Liberibacter asiaticus
254780409310 ribose-phosphate pyrophosphokinase [Candidatus Lib 0.010
>gi|254780409|ref|YP_003064822.1| ribose-phosphate pyrophosphokinase [Candidatus Liberibacter asiaticus str. psy62] Length = 310 Back     alignment 
 Score = 29.6 bits (65), Expect = 0.010,   Method: Composition-based stats.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVS 49
           V G   +LIDD+  TG T   AA AL + GA++V+
Sbjct: 207 VEGKDCILIDDIVDTGGTLCGAADALYEQGALSVT 241

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target59 comF family protein [Candidatus Liberibacter asiaticus
315122266214 competence protein F, putative [Candidatus Liberibacter 1 2e-17
319406072225 competence protein ComF [Bartonella sp. AR 15-3] Length 1 2e-10
121601823251 comF family protein [Bartonella bacilliformis KC583] Le 1 5e-10
319408180247 competence protein ComF [Bartonella schoenbuchensis R1] 1 6e-10
326539594251 competence protein F [Brucella melitensis M5-90] Length 1 7e-10
306842968262 competence protein F [Brucella sp. BO2] Length = 262 1 7e-10
256158382262 putative competence protein F [Brucella ceti M490/95/1] 1 7e-10
256112214262 competence protein F [Brucella melitensis bv. 3 str. Et 1 7e-10
254717947262 protein gntX [Brucella sp. 83/13] Length = 262 1 7e-10
254700524262 putative competence protein F [Brucella suis bv. 5 str. 1 7e-10
>gi|315122266|ref|YP_004062755.1| competence protein F, putative [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 214 Back     alignment and organism information
 Score = 92.4 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 45/59 (76%), Positives = 53/59 (89%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLKD 59
           + NAF+VPQY  K++AG KILLIDDVYTTGATA+ AAIALKKAGA ++SILTFSRSLK+
Sbjct: 156 LHNAFHVPQYAQKYIAGFKILLIDDVYTTGATAQYAAIALKKAGAKSISILTFSRSLKN 214



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|319406072|emb|CBI79702.1| competence protein ComF [Bartonella sp. AR 15-3] Length = 225 Back     alignment and organism information
>gi|121601823|ref|YP_988686.1| comF family protein [Bartonella bacilliformis KC583] Length = 251 Back     alignment and organism information
>gi|319408180|emb|CBI81833.1| competence protein ComF [Bartonella schoenbuchensis R1] Length = 247 Back     alignment and organism information
>gi|326539594|gb|ADZ87809.1| competence protein F [Brucella melitensis M5-90] Length = 251 Back     alignment and organism information
>gi|306842968|ref|ZP_07475602.1| competence protein F [Brucella sp. BO2] Length = 262 Back     alignment and organism information
>gi|256158382|ref|ZP_05456280.1| putative competence protein F [Brucella ceti M490/95/1] Length = 262 Back     alignment and organism information
>gi|256112214|ref|ZP_05453135.1| competence protein F [Brucella melitensis bv. 3 str. Ether] Length = 262 Back     alignment and organism information
>gi|254717947|ref|ZP_05179758.1| protein gntX [Brucella sp. 83/13] Length = 262 Back     alignment and organism information
>gi|254700524|ref|ZP_05162352.1| putative competence protein F [Brucella suis bv. 5 str. 513] Length = 262 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target59 comF family protein [Candidatus Liberibacter asiaticus
TIGR00201190 TIGR00201, comF, comF family protein 1e-05
PRK11595227 PRK11595, PRK11595, DNA utilization protein GntX; Provi 8e-05
PRK02304175 PRK02304, PRK02304, adenine phosphoribosyltransferase; 9e-04
COG1040225 COG1040, ComFC, Predicted amidophosphoribosyltransferas 5e-09
>gnl|CDD|161762 TIGR00201, comF, comF family protein Back     alignment and domain information
>gnl|CDD|183221 PRK11595, PRK11595, DNA utilization protein GntX; Provisional Back     alignment and domain information
>gnl|CDD|179411 PRK02304, PRK02304, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31242 COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 59 comF family protein [Candidatus Liberibacter asiaticus
PRK11595227 gluconate periplasmic binding protein; Provisional 99.68
COG1040225 ComFC Predicted amidophosphoribosyltransferases [Genera 99.5
TIGR00201207 comF comF family protein; InterPro: IPR005222 Proteins 99.36
TIGR01203183 HGPRTase hypoxanthine phosphoribosyltransferase; InterP 99.22
COG0634178 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nuc 99.14
PTZ00271211 hypoxanthine-guanine phosphoribosyltransferase; Provisi 99.13
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Provisi 99.1
COG0462314 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide 99.06
PTZ00149231 hypoxanthine phosphoribosyltransferase; Provisional 99.04
PRK03675279 consensus 99.03
PRK06827381 phosphoribosylpyrophosphate synthetase; Provisional 99.03
PTZ00145443 phosphoribosylpyrophosphate synthetase; Provisional 99.03
PRK02812331 ribose-phosphate pyrophosphokinase; Provisional 99.01
PRK01506317 consensus 98.99
PRK05259310 consensus 98.99
PRK02269321 ribose-phosphate pyrophosphokinase; Provisional 98.99
PRK00553340 ribose-phosphate pyrophosphokinase; Provisional 98.99
PRK02270327 consensus 98.98
PRK01132286 consensus 98.98
PRK01999311 consensus 98.98
PRK02458323 ribose-phosphate pyrophosphokinase; Provisional 98.98
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 98.97
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisional 98.97
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 98.97
PRK00934286 ribose-phosphate pyrophosphokinase; Provisional 98.97
PRK04117309 consensus 98.96
PRK02039316 consensus 98.96
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 98.96
PRK05038315 consensus 98.95
PRK04554327 consensus 98.95
pfam00156123 Pribosyltran Phosphoribosyl transferase domain. This fa 98.87
PRK02277201 orotate phosphoribosyltransferase-like protein; Provisi 98.73
COG0034470 PurF Glutamine phosphoribosylpyrophosphate amidotransfe 98.62
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleotide 98.58
PRK09246 503 amidophosphoribosyltransferase; Provisional 98.58
PRK08525445 amidophosphoribosyltransferase; Provisional 98.55
PRK07631475 amidophosphoribosyltransferase; Provisional 98.54
PRK06781471 amidophosphoribosyltransferase; Provisional 98.54
PRK07349495 amidophosphoribosyltransferase; Provisional 98.53
TIGR01090175 apt adenine phosphoribosyltransferase; InterPro: IPR005 98.53
PRK08341442 amidophosphoribosyltransferase; Provisional 98.53
PRK07272484 amidophosphoribosyltransferase; Provisional 98.53
PRK05793472 amidophosphoribosyltransferase; Provisional 98.53
PRK09123480 amidophosphoribosyltransferase; Provisional 98.53
KOG1448316 consensus 98.53
PRK06388474 amidophosphoribosyltransferase; Provisional 98.51
PRK07847 489 amidophosphoribosyltransferase; Provisional 98.51
PRK05205176 bifunctional pyrimidine regulatory protein PyrR uracil 98.49
KOG0572474 consensus 98.45
TIGR01134467 purF amidophosphoribosyltransferase; InterPro: IPR00585 98.44
KOG3367216 consensus 98.39
PRK07322178 adenine phosphoribosyltransferase; Provisional 98.35
COG2236192 Predicted phosphoribosyltransferases [General function 98.26
PRK02304174 adenine phosphoribosyltransferase; Provisional 98.21
PRK13811170 orotate phosphoribosyltransferase; Provisional 98.2
PRK00455200 pyrE orotate phosphoribosyltransferase; Validated 98.18
COG0461201 PyrE Orotate phosphoribosyltransferase [Nucleotide tran 98.16
TIGR01367205 pyrE_Therm orotate phosphoribosyltransferase; InterPro: 98.16
PRK13812174 orotate phosphoribosyltransferase; Provisional 98.15
TIGR01091213 upp uracil phosphoribosyltransferase; InterPro: IPR0057 98.12
PRK13809206 orotate phosphoribosyltransferase; Provisional 98.12
PRK13810187 orotate phosphoribosyltransferase; Provisional 98.11
PRK12560184 adenine phosphoribosyltransferase; Provisional 98.09
PRK05500478 bifunctional orotidine 5'-phosphate decarboxylase/orota 98.08
TIGR00336187 pyrE orotate phosphoribosyltransferase; InterPro: IPR00 98.06
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and rela 98.04
PRK06031233 phosphoribosyltransferase; Provisional 97.99
COG1926220 Predicted phosphoribosyltransferases [General function 97.97
PRK00129208 upp uracil phosphoribosyltransferase; Reviewed 97.89
TIGR01251316 ribP_PPkin ribose-phosphate pyrophosphokinase; InterPro 97.76
COG0035210 Upp Uracil phosphoribosyltransferase [Nucleotide transp 97.74
KOG1712183 consensus 97.64
PRK08558238 adenine phosphoribosyltransferase; Provisional 97.5
PRK09177156 xanthine-guanine phosphoribosyltransferase; Validated 97.49
COG2065179 PyrR Pyrimidine operon attenuation protein/uracil phosp 97.48
PRK09219189 xanthine phosphoribosyltransferase; Validated 97.38
KOG1503354 consensus 96.58
PRK09213274 purine operon repressor; Provisional 95.0
KOG1017267 consensus 94.39
TIGR01743269 purR_Bsub pur operon repressor; InterPro: IPR010078 Thi 93.81
TIGR01744191 XPRTase xanthine phosphoribosyltransferase; InterPro: I 90.54
>PRK11595 gluconate periplasmic binding protein; Provisional Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>TIGR00201 comF comF family protein; InterPro: IPR005222 Proteins in this family are found in bacterial species which posses systems for natural transformation with exogenous DNA (eg Bacillus subtilis, Haemophilus influenzae), and also species without these systems (eg Escherichia coli) Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase; InterPro: IPR005904 Phosphoribosyltransferases (PRT) are enzymes that catalyze the synthesis of beta-n-5'-monophosphates from phosphoribosylpyrophosphate (PRPP) and an enzyme specific amine Back     alignment and domain information
>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK03675 consensus Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK01506 consensus Back     alignment and domain information
>PRK05259 consensus Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK02270 consensus Back     alignment and domain information
>PRK01132 consensus Back     alignment and domain information
>PRK01999 consensus Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK04117 consensus Back     alignment and domain information
>PRK02039 consensus Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK05038 consensus Back     alignment and domain information
>PRK04554 consensus Back     alignment and domain information
>pfam00156 Pribosyltran Phosphoribosyl transferase domain Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09246 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08525 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06781 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase; InterPro: IPR005764 Adenine phosphoribosyltransferase (APRTase, 2 Back     alignment and domain information
>PRK08341 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07272 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05793 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG1448 consensus Back     alignment and domain information
>PRK06388 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07847 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG0572 consensus Back     alignment and domain information
>TIGR01134 purF amidophosphoribosyltransferase; InterPro: IPR005854 Purine nucleotides are synthesised both via the de novo pathway and via the salvage pathway and are vital for cell functions and cell proliferation through DNA and RNA syntheses and ATP energy supply Back     alignment and domain information
>KOG3367 consensus Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase; InterPro: IPR006273 This group of sequences are a distinct clade of orotate phosphoribosyltransferases Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01091 upp uracil phosphoribosyltransferase; InterPro: IPR005765 The enzyme uracil phosphoribosyltransferase (UPRT, 2 Back     alignment and domain information
>PRK13809 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13810 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK12560 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase; InterPro: IPR004467 Orotate phosphoribosyl transferase (OPRTase) is involved in the biosynthesis of pyrimidine nucleotides Back     alignment and domain information
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase; InterPro: IPR005946 Synonyms: phosphoribosylpyrophosphate synthetase Phosphoribosyldiphosphate synthetase (PRPPsase, 2 Back     alignment and domain information
>COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1712 consensus Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09219 xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>KOG1503 consensus Back     alignment and domain information
>PRK09213 purine operon repressor; Provisional Back     alignment and domain information
>KOG1017 consensus Back     alignment and domain information
>TIGR01743 purR_Bsub pur operon repressor; InterPro: IPR010078 This entry represents the pur operon repressor PurR of low-GC Gram-positive bacteria Back     alignment and domain information
>TIGR01744 XPRTase xanthine phosphoribosyltransferase; InterPro: IPR010079 This entry represent a xanthine-specific phosphoribosyltransferase of Bacillus subtilis and closely related proteins from other species, mostly from other Gram-positive bacteria Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target59 comF family protein [Candidatus Liberibacter asiaticus
3h83_A204 2.06 Angstrom Resolution Structure Of A Hypoxanthin 7e-08
3ohp_A177 Crystal Structure Of Hgprt From Vibrio Cholerae Len 1e-07
1dkr_A317 Crystal Structures Of Bacillus Subtilis Phosphoribo 2e-07
1ao0_A459 Glutamine Phosphoribosylpyrophosphate (Prpp) Amidot 3e-07
1gph_1465 Structure Of The Allosteric Regulatory Enzyme Of Pu 4e-07
1hgx_A183 Hypoxanthine-Guanine-Xanthine Phosphoribosyltransfe 5e-07
2ywt_A181 Crystal Structure Of Hypoxanthine-Guanine Phosphori 1e-06
1r3u_A205 Crystal Structure Of Hypoxanthine-Guanine Phosphori 2e-06
1ecf_A 504 Escherichia Coli Glutamine Phosphoribosylpyrophosph 2e-06
3dah_A319 2.3 A Crystal Structure Of Ribose-Phosphate Pyropho 2e-06
1u9y_A284 Crystal Structure Of Phosphoribosyl Diphosphate Syn 3e-06
1vdm_A153 Crystal Structure Of Purine Phosphoribosyltransfera 3e-06
2geb_A185 Crystal Structure Of The Thermoanaerobacter Tengcon 3e-06
1j7j_A178 Crystal Structure Of The Hprt From Salmonella Typhi 1e-05
1g9s_A182 Crystal Structure Of A Complex Between E.Coli Hprt 1e-05
1qk3_A233 Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribos 3e-05
1dbr_A231 Hypoxanthine Guanine Xanthine Length = 231 4e-05
1cjb_A231 Malarial Purine Phosphoribosyltransferase Length = 4e-05
3mbi_A287 Crystal Structure Of The Phosphoribosylpyrophosphat 6e-05
3lpn_A286 Crystal Structure Of The Phosphoribosylpyrophosphat 7e-05
2h06_A326 Crystal Structure Of Human Phosphoribosyl Pyrophosp 1e-04
2h07_A326 Crystal Structure Of Human Phosphoribosyl Pyrophosp 2e-04
2h08_A326 Crystal Structure Of Human Phosphoribosyl Pyrophosp 2e-04
1qk5_A233 Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribos 2e-04
3o7m_A186 1.98 Angstrom Resolution Crystal Structure Of A Hyp 8e-04
2vfa_A229 Crystal Structure Of A Chimera Of Plasmodium Falcip 0.002
1i5e_A209 Crystal Structure Of Bacillus Caldolyticus Uracil P 0.002
>gi|237640661|pdb|3H83|A Chain A, 2.06 Angstrom Resolution Structure Of A Hypoxanthine- Guanine Phosphoribosyltransferase (Hpt-1) From Bacillus Anthracis Str. 'ames Ancestor' Length = 204 Back     alignment and structure 
 Score = 60.7 bits (147), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 22/51 (43%)

Query: 3   NAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
               + + +   V G  IL+++D+  +G T        K   A +V I+T 
Sbjct: 102 GEVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL 152
gi|305677892|pdb|3OHP|A Chain A, Crystal Structure Of Hgprt From Vibrio Cholerae Length = 177 Back     alignment and structure
gi|7546199|pdb|1DKR|A Chain A, Crystal Structures Of Bacillus Subtilis Phosphoribosylpyrophosphate Synthetase: Molecular Basis Of Allosteric Inhibition And Activation. Length = 317 Back     alignment and structure
>gi|2624597|pdb|1AO0|A Chain A, Glutamine Phosphoribosylpyrophosphate (Prpp) Amidotransferase From B. Subtilis Complexed With Adp And Gmp Length = 459 Back     alignment and structure
>gi|576138|pdb|1GPH|1 Chain 1, Structure Of The Allosteric Regulatory Enzyme Of Purine Biosynthesis Length = 465 Back     alignment and structure
gi|1827785|pdb|1HGX|A Chain A, Hypoxanthine-Guanine-Xanthine Phosphoribosyltransferase (Hgxprtase) Length = 183 Back     alignment and structure
>gi|56553634|pdb|1R3U|A Chain A, Crystal Structure Of Hypoxanthine-Guanine Phosphoribosyltransferase From Thermoanaerobacter Tengcongensis Length = 205 Back     alignment and structure
>gi|1943557|pdb|1ECF|A Chain A, Escherichia Coli Glutamine Phosphoribosylpyrophosphate (Prpp) Amidotransferase Length = 504 Back     alignment and structure
>gi|190016457|pdb|3DAH|A Chain A, 2.3 A Crystal Structure Of Ribose-Phosphate Pyrophosphokinase From Burkholderia Pseudomallei Length = 319 Back     alignment and structure
gi|75765288|pdb|1U9Y|A Chain A, Crystal Structure Of Phosphoribosyl Diphosphate Synthase From Methanocaldococcus Jannaschii Length = 284 Back     alignment and structure
gi|67463841|pdb|1VDM|A Chain A, Crystal Structure Of Purine Phosphoribosyltransferase From Pyrococcus Horikoshii Ot3 Length = 153 Back     alignment and structure
>gi|145579368|pdb|2GEB|A Chain A, Crystal Structure Of The Thermoanaerobacter Tengcongensis Hypoxanthine-Guanine Phosphoribosyltransferase L160i Mutant: Insights Into The Inhibitor Design Length = 185 Back     alignment and structure
gi|34810925|pdb|1J7J|A Chain A, Crystal Structure Of The Hprt From Salmonella Typhimurium Length = 178 Back     alignment and structure
>gi|23200063|pdb|1G9S|A Chain A, Crystal Structure Of A Complex Between E.Coli Hprt And Imp Length = 182 Back     alignment and structure
>gi|6435648|pdb|1QK3|A Chain A, Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribosyltransferase Gmp Complex Length = 233 Back     alignment and structure
>gi|2781198|pdb|1DBR|A Chain A, Hypoxanthine Guanine Xanthine Length = 231 Back     alignment and structure
gi|5821998|pdb|1CJB|A Chain A, Malarial Purine Phosphoribosyltransferase Length = 231 Back     alignment and structure
>gi|329666092|pdb|3MBI|A Chain A, Crystal Structure Of The Phosphoribosylpyrophosphate (Prpp) Synthetase From Thermoplasma Volcanium In Complex With Adp-Mg2+ And Ribose 5- Phosphate Length = 287 Back     alignment and structure
gi|322812383|pdb|3LPN|A Chain A, Crystal Structure Of The Phosphoribosylpyrophosphate (Prpp) Synthetase From Thermoplasma Volcanium In Complex With An Atp Analog (Ampcpp). Length = 286 Back     alignment and structure
>gi|118137847|pdb|2H06|A Chain A, Crystal Structure Of Human Phosphoribosyl Pyrophosphate Synthetase 1 Length = 326 Back     alignment and structure
>gi|118137849|pdb|2H07|A Chain A, Crystal Structure Of Human Phosphoribosyl Pyrophosphate Synthetase 1 Mutant S132a Length = 326 Back     alignment and structure
>gi|118137851|pdb|2H08|A Chain A, Crystal Structure Of Human Phosphoribosyl Pyrophosphate Synthetase 1 Mutant Y146m Length = 326 Back     alignment and structure
>gi|6435656|pdb|1QK5|A Chain A, Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribosyltransferase With Xmp, Pyrophosphate And Two Mg2+ Ions Length = 233 Back     alignment and structure
>gi|305677852|pdb|3O7M|A Chain A, 1.98 Angstrom Resolution Crystal Structure Of A Hypoxanthine-Guanine Phosphoribosyltransferase (Hpt-2) From Bacillus Anthracis Str. 'ames Ancestor' Length = 186 Back     alignment and structure
>gi|190613413|pdb|2VFA|A Chain A, Crystal Structure Of A Chimera Of Plasmodium Falciparum And Human Hypoxanthine-Guanine Phosphoribosyl Transferases Length = 229 Back     alignment and structure
gi|21465610|pdb|1I5E|A Chain A, Crystal Structure Of Bacillus Caldolyticus Uracil Phosphoribosyltransferase With Bound Ump Length = 209 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target59 comF family protein [Candidatus Liberibacter asiaticus
1vch_A175 Phosphoribosyltransferase-related protein; structural g 3e-04
1o57_A291 PUR operon repressor; purine operon repressor, helix-tu 0.002
2wns_A205 Orotate phosphoribosyltransferase; alternative splicing 0.002
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleotide b 0.003
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardia lam 0.004
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Length = 175 Back     alignment and structure
 Score = 38.9 bits (90), Expect = 3e-04
 Identities = 9/39 (23%), Positives = 19/39 (48%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTF 53
           +   +++L+ DV  +G T +     + +AG   V+ L  
Sbjct: 118 LLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLAV 156
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Length = 291 Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Length = 205 Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Length = 236 Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Length = 186 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target59 comF family protein [Candidatus Liberibacter asiaticus
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated prot 99.06
1wd5_A208 Hypothetical protein TT1426; structural genomics, riken 99.05
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransferase; 99.04
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxantine-gua 99.02
1tc1_A220 Protein (hypoxanthine phosphoribosyltransferase); trans 98.99
3dah_A319 Ribose-phosphate pyrophosphokinase; seattle structural 98.99
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltransferas 98.99
2h06_A326 Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthe 98.99
1cjb_A231 Protein (hypoxanthine-guanine phosphoribosyltransferase 98.99
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; protein 98.98
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); open 98.97
1vdm_A153 Purine phosphoribosyltransferase; structural genomics, 98.97
2jbh_A225 HHGP; glycosyltransferase, PRTFDC1, transferase, purine 98.96
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthine-gu 98.95
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthas 98.95
1z7g_A217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltra 98.94
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, 98.93
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural geno 98.92
2ywu_A181 Hypoxanthine-guanine phosphoribosyltransferase; rossman 98.9
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyl 98.89
1a3c_A181 PYRR, pyrimidine operon regulatory protein PYRR; transc 98.88
1vch_A175 Phosphoribosyltransferase-related protein; structural g 98.87
1ufr_A181 TT1027, PYR mRNA-binding attenuation protein; pyrimidin 98.84
1dqn_A230 Guanine phosphoribosyltransferase; protein-inhibitor co 98.7
1w30_A201 PYRR bifunctional protein; transferase, glycosyltransfe 98.69
2jky_A213 Hypoxanthine-guanine phosphoribosyltransferase; nucleus 98.59
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single doma 98.55
1ecf_A 504 Glutamine phosphoribosylpyrophosphate amidotransferase; 98.53
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleotide b 98.47
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransferase; 98.46
2p1z_A180 Phosphoribosyltransferase; structural genomics, PSI-2, 98.45
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabolism, 98.45
2wns_A205 Orotate phosphoribosyltransferase; alternative splicing 98.42
1o57_A291 PUR operon repressor; purine operon repressor, helix-tu 98.42
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; rossm 98.4
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, oprtas 98.4
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosyltransf 98.38
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; pyrim 98.37
2dy0_A190 APRT, adenine phosphoribosyltransferase; structural gen 98.36
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid, str 98.36
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardia lam 98.3
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; glyco 98.3
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; struc 98.24
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; pyrim 98.2
1lh0_A213 OMP synthase; loop closure, monomer closure, orotate ph 98.06
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; purin 98.02
2ehj_A208 Uracil phosphoribosyltransferase; structural genomics, 97.94
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structural ge 97.89
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; HET: 97.78
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salvage, o 97.78
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosyltran 97.5
2e55_A208 Uracil phosphoribosyltransferase; structural genomics, 97.46
3dmp_A217 Uracil phosphoribosyltransferase; structural genomics, 97.32
1xtt_A216 Probable uracil phosphoribosyltransferase; tetramer, ty 97.03
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
Probab=99.06  E-value=3.1e-10  Score=75.59  Aligned_cols=46  Identities=24%  Similarity=0.320  Sum_probs=42.4

Q ss_pred             HCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC
Q ss_conf             0028975999920045738899999999978997899999983068
Q gi|254780309|r   13 KHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK   58 (59)
Q Consensus        13 ~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~   58 (59)
                      .+++||+|+|||||++||.|+.++++.|++.||++|++++.+..++
T Consensus       268 GDVkGk~vIIVDDiIdTGgTl~~aa~~Lk~~GA~~V~~~~THgvfs  313 (379)
T 2ji4_A          268 GDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLS  313 (379)
T ss_dssp             SCCTTSEEEEEEEEECSCHHHHHHHHHHHHTTCCEEEEEEEEECCC
T ss_pred             ECEEEEEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             0120038999543433126699999999976998379999797688
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxantine-guanine phosphoribosyltransferase, 2-(N- morpholino)ethanesulfonic acid (MES); HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii RH} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Back     alignment and structure
>2h06_A Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthetase 1, phosphoribosyl pyrophosphate synthetase 1, transferase; 2.20A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h07_A 2h08_A Back     alignment and structure
>1cjb_A Protein (hypoxanthine-guanine phosphoribosyltransferase); malaria, purine salvage, transition state inhibitor; HET: IRP; 2.00A {Plasmodium falciparum} SCOP: c.61.1.1 Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis MB4} SCOP: c.61.1.1 PDB: 1r3u_A* Back     alignment and structure
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Back     alignment and structure
>2jbh_A HHGP; glycosyltransferase, PRTFDC1, transferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Back     alignment and structure
>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding protein, pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* Back     alignment and structure
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Back     alignment and structure
>2jky_A Hypoxanthine-guanine phosphoribosyltransferase; nucleus, cytoplasm, magnesium, GMP complex, FLIP peptide-plane, glycosyltransferase; HET: 5GP; 2.3A {Saccharomyces cerevisiae} PDB: 2jkz_A* Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Back     alignment and structure
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransferase; purine biosynthesis, glycosyltransferase, glutamine amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Back     alignment and structure
>1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.44A {Corynebacterium diphtheriae NCTC13129} Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, structural genomics, PSI, protein structure initative; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Back     alignment and structure
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, polymorphism, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Back     alignment and structure
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, protein structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Escherichia coli} Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomics, JCSG, PSI, protein structure initiative; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics; 2.10A {Thermus thermophilus HB8} SCOP: c.61.1.1 Back     alignment and structure
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.15A {Aquifex aeolicus} Back     alignment and structure
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

IdentityAlignment graphLength Definition E-value
Target 59 comF family protein [Candidatus Liberibacter asiaticus
d1vcha1174 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase T 6e-04
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Putative phosphoribosyltransferase TTHA1613
species: Thermus thermophilus [TaxId: 274]

 Score = 36.6 bits (84), Expect = 6e-04
 Identities = 9/38 (23%), Positives = 19/38 (50%)

Query: 15  VAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILT 52
           +   +++L+ DV  +G T +     + +AG   V+ L 
Sbjct: 117 LLNQRVVLVSDVVASGETMRAMEKMVLRAGGHVVARLA 154

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

IdentityAlignment graphLength Definition Probability
Target59 comF family protein [Candidatus Liberibacter asiaticus
d1wd5a_208 Putative phosphoribosyltransferase TT1426 (TTHA1462) {T 99.06
d2c4ka2184 PRPP synthetase-associated protein 1 {Human (Homo sapie 99.03
d1u9ya2129 Phosphoribosylpyrophosphate synthetase {Methanocaldococ 99.01
d1fsga_233 Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii 98.99
d1cjba_228 Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falc 98.98
d1z7ga1214 Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sap 98.97
d1pzma_183 Hypoxanthine-guanine-xanthine PRTase {Leishmania tarent 98.97
d1yfza1178 Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter t 98.96
d1ufra_178 Pyrimidine operon regulator PyrR {Thermus thermophilus 98.95
d1dkua2149 Phosphoribosylpyrophosphate synthetase {Bacillus subtil 98.95
d1vdma1153 Pprobable purine phosphoribosyltransferase PH0095 {Pyro 98.94
d1tc1a_184 Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} 98.92
d1a3ca_178 Pyrimidine operon regulator PyrR {Bacillus subtilis [Ta 98.88
d1j7ja_172 Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 903 98.87
d1hgxa_173 Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas fo 98.87
d1w30a_182 Pyrimidine operon regulator PyrR {Mycobacterium tubercu 98.85
d1vcha1174 Putative phosphoribosyltransferase TTHA1613 {Thermus th 98.84
d1dqna_230 Guanine PRTase {Giardia lamblia [TaxId: 5741]} 98.69
d1gph11231 Glutamine PRPP amidotransferase, C-terminal domain {Bac 98.62
d1g2qa_178 Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae 98.54
d1ecfa1243 Glutamine PRPP amidotransferase, C-terminal domain {Esc 98.54
d1qb7a_236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 98.48
d1zn7a1178 Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} 98.46
d1y0ba1191 Xanthine phosphoribosyltransferase {Bacillus subtilis [ 98.45
d1o57a2202 Pur operon repressor (PurR), C-terminal domain {Bacillu 98.44
d1l1qa_181 Adenine PRTase {Giardia lamblia [TaxId: 5741]} 98.3
d2aeea1208 Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} 98.25
d1lh0a_213 Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} 98.1
d1nula_150 Xanthine-guanine PRTase (XPRTase) {Escherichia coli [Ta 97.92
d1i5ea_208 Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394] 97.86
d1o5oa_210 Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} 97.81
d1v9sa1208 Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} 97.73
d1bd3a_224 Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} 97.62
d1xtta1215 Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 228 97.06
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Putative phosphoribosyltransferase TT1426 (TTHA1462)
species: Thermus thermophilus [TaxId: 274]

Probab=99.06  E-value=1.2e-10  Score=76.50  Aligned_cols=43  Identities=23%  Similarity=0.288  Sum_probs=39.4

Q ss_pred             HHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             1002897599992004573889999999997899789999998
Q gi|254780309|r   12 SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS   54 (59)
Q Consensus        12 ~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~la   54 (59)
                      ..+++||+|+||||+++||+|+.++++.|+++||++|++++..
T Consensus       115 ~~~v~gk~ViLVDD~I~TG~T~~aa~~~L~~~ga~~V~~a~~v  157 (208)
T d1wd5a_         115 KAARKGRDVVLVDDGVATGASMEAALSVVFQEGPRRVVVAVPV  157 (208)
T ss_dssp             CCCCTTSEEEEECSCBSSCHHHHHHHHHHHTTCCSEEEEEEEE
T ss_pred             CCCCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             7345898899970400135789999999995699889996034
>d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} Back     information, alignment and structure
>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} Back     information, alignment and structure
>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Back     information, alignment and structure
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against MMDB70 database

IdentityAlignment graphLength Definition E-value
Target 59 comF family protein [Candidatus Liberibacter asiat
1nul_A_9-131123 (A:9-131) XPRT, xanthine-guanine phosphoribosyltra 6e-04
1hgx_A_18-155138 (A:18-155) HGXPRTASE, hypoxanthine-guanine-xanthin 7e-04
1j7j_A_12-150139 (A:12-150) HPRT, hypoxanthine phosphoribosyltransf 0.001
1pzm_A_31-176146 (A:31-176) HGPRT, hypoxanthine-guanine phosphoribo 0.003
3dez_A_100-18384 (A:100-183) OPRT, oprtase, orotate phosphoribosylt 0.003
>1nul_A (A:9-131) XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli}Length = 123 Back     alignment and structure
 Score = 37.6 bits (87), Expect = 6e-04
 Identities = 12/48 (25%), Positives = 18/48 (37%)

Query: 1   MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTV 48
             N   +         G   ++IDD+  TG TA        KA  +T+
Sbjct: 57  HDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTI 104
>1hgx_A (A:18-155) HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus}Length = 138 Back     alignment and structure
>1j7j_A (A:12-150) HPRT, hypoxanthine phosphoribosyltransferase; glycosyltransferase, nucleotide metabolism, purine salvage; 2.30A {Salmonella typhimurium}Length = 139 Back     alignment and structure
>1pzm_A (A:31-176) HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae}Length = 146 Back     alignment and structure
>3dez_A (A:100-183) OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, magnesium, pyrimidine biosynthesis; 2.40A {Streptococcus mutans}Length = 84 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

Original result of HHsearch against MMDB70 database

IdentityAlignment graphLength Definition Probability
Target59 comF family protein [Candidatus Liberibacter asiaticus
2ji4_A_176-351176 Phosphoribosyl pyrophosphate synthetase-associated 99.29
1vch_A_175 Phosphoribosyltransferase-related protein; structu 99.26
1ao0_A_242-459218 Glutamine phosphoribosylpyrophosphate amidotransfe 99.13
1tc1_A_15-160146 Protein (hypoxanthine phosphoribosyltransferase); 99.12
2jbh_A_225 HHGP; glycosyltransferase, PRTFDC1, transferase, p 99.09
1pzm_A_31-176146 HGPRT, hypoxanthine-guanine phosphoribosyltransfer 99.09
1w30_A_201 PYRR bifunctional protein; transferase, glycosyltr 99.08
1hgx_A_18-155138 HGXPRTASE, hypoxanthine-guanine-xanthine phosphori 99.06
3hvu_A_38-174137 Hypoxanthine phosphoribosyltransferase; hypoxantin 99.06
2geb_A_20-156137 Hypoxanthine-guanine phosphoribosyltransferase; HG 99.04
1g2q_A_187 Adenine phosphoribosyltransferase 1; dimer, single 99.04
1zn8_A_180 APRT, adenine phosphoribosyltransferase; glycosylt 99.02
1ecf_A_258-459202 Glutamine phosphoribosylpyrophosphate amidotransfe 99.01
1a3c_A_181 PYRR, pyrimidine operon regulatory protein PYRR; t 99.01
1i5e_A_1-8_70-209148 Uracil phosphoribosyltransferase; salvage pathway; 99.0
1yfz_A_39-176138 Hypoxanthine-guanine phosphoribosyltransferase; pr 99.0
1z7g_A_217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos 98.99
1j7j_A_12-150139 HPRT, hypoxanthine phosphoribosyltransferase; glyc 98.98
1y0b_A_197 Xanthine phosphoribosyltransferase; purine metabol 98.98
1vdm_A_153 Purine phosphoribosyltransferase; structural genom 98.97
1cjb_A_231 Protein (hypoxanthine-guanine phosphoribosyltransf 98.97
1o57_A_77-291215 PUR operon repressor; purine operon repressor, hel 98.94
1wd5_A_208 Hypothetical protein TT1426; structural genomics, 98.93
2dy0_A_190 APRT, adenine phosphoribosyltransferase; structura 98.91
1l1q_A_186 Adenine phosphoribosyltransferase; aprtase, giardi 98.9
1qb7_A_1-215215 APRT, adenine phosphoribosyltransferase; dinucleot 98.9
1fsg_A_233 HGPRTASE, hypoxanthine-guanine phosphoribosyltrans 98.9
1ufr_A_11-155145 TT1027, PYR mRNA-binding attenuation protein; pyri 98.9
1lh0_A_40-184145 OMP synthase; loop closure, monomer closure, orota 98.89
2ps1_A_1-20_44-207184 Orotate phosphoribosyltransferase 1; alpha beta, o 98.89
2ywu_A_181 Hypoxanthine-guanine phosphoribosyltransferase; ro 98.88
2wns_A_39-171133 Orotate phosphoribosyltransferase; alternative spl 98.86
2ehj_A_208 Uracil phosphoribosyltransferase; structural genom 98.86
2p1z_A_180 Phosphoribosyltransferase; structural genomics, PS 98.85
2yzk_A_1-10_35-178154 OPRT, oprtase, orotate phosphoribosyltransferase; 98.85
1o5o_A_221 Uracil phosphoribosyltransferase; TM0721, structur 98.82
1u9y_A_143-270128 RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy 98.81
1v9s_A_208 Uracil phosphoribosyltransferase; pyrimidine salva 98.81
3dez_A_100-18384 OPRT, oprtase, orotate phosphoribosyltransferase; 98.78
2h06_A_148-292145 Ribose-phosphate pyrophosphokinase I; PRS1, PRPP s 98.76
2jky_A_10-185176 Hypoxanthine-guanine phosphoribosyltransferase; nu 98.75
2aee_A_68-174107 OPRT, oprtase, orotate phosphoribosyltransferase; 98.75
2e55_A_208 Uracil phosphoribosyltransferase; structural genom 98.73
1xtt_A_216 Probable uracil phosphoribosyltransferase; tetrame 98.71
1dqn_A_60-175116 Guanine phosphoribosyltransferase; protein-inhibit 98.69
1nul_A_9-131123 XPRT, xanthine-guanine phosphoribosyltransferase; 98.69
3dah_A_153-295143 Ribose-phosphate pyrophosphokinase; seattle struct 98.68
1bd3_D_243 Uprtase, uracil phosphoribosyltransferase; glycosy 98.66
1dku_A_154-295142 Protein (phosphoribosyl pyrophosphate synthetase); 98.65
3dmp_A_217 Uracil phosphoribosyltransferase; structural genom 98.65
>2ji4_A (A:176-351) Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
Probab=99.29  E-value=7e-12  Score=85.26  Aligned_cols=52  Identities=25%  Similarity=0.312  Sum_probs=45.8

Q ss_pred             ECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC
Q ss_conf             2510210028975999920045738899999999978997899999983068
Q gi|254780309|r    7 VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK   58 (59)
Q Consensus         7 i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~   58 (59)
                      ........++||+|+||||++|||+|+.++++.|+++||++|++++++....
T Consensus        87 ~~~~~~~~~~gk~VliVDDii~TG~Tl~~~~~~L~~~Ga~~V~~~~~~~~~~  138 (176)
T 2ji4_A           87 PPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLS  138 (176)
T ss_dssp             -CCCEESCCTTSEEEEEEEEECSCHHHHHHHHHHHHTTCCEEEEEEEEECCC
T ss_pred             CCEEEEEECCCCEEEEECCHHCCHHHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             2203565117978999664110278799999999865998379999798688
>1vch_A (A:) Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} Back     alignment and structure
>1ao0_A (A:242-459) Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} Back     alignment and structure
>1tc1_A (A:15-160) Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} Back     alignment and structure
>2jbh_A (A:) HHGP; glycosyltransferase, PRTFDC1, transferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Back     alignment and structure
>1pzm_A (A:31-176) HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} Back     alignment and structure
>1w30_A (A:) PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} Back     alignment and structure
>1hgx_A (A:18-155) HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} Back     alignment and structure
>3hvu_A (A:38-174) Hypoxanthine phosphoribosyltransferase; hypoxantine-guanine phosphoribosyltransferase, 2-(N- morpholino)ethanesulfonic acid (MES); HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>2geb_A (A:20-156) Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1g2q_A (A:) Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zn8_A (A:) APRT, adenine phosphoribosyltransferase; glycosyltransferase, polymorphism, purine salvage; HET: AMP; 1.76A {Homo sapiens} Back     alignment and structure
>1ecf_A (A:258-459) Glutamine phosphoribosylpyrophosphate amidotransferase; purine biosynthesis, glycosyltransferase, glutamine amidotransferase; HET: PIN; 2.00A {Escherichia coli} Back     alignment and structure
>1a3c_A (A:) PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding protein, pyrimidine biosynthesis; 1.60A {Bacillus subtilis} Back     alignment and structure
>1i5e_A (A:1-8,A:70-209) Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} Back     alignment and structure
>1yfz_A (A:39-176) Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis MB4} Back     alignment and structure
>1z7g_A (A:) HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} Back     alignment and structure
>1j7j_A (A:12-150) HPRT, hypoxanthine phosphoribosyltransferase; glycosyltransferase, nucleotide metabolism, purine salvage; 2.30A {Salmonella typhimurium} Back     alignment and structure
>1y0b_A (A:) Xanthine phosphoribosyltransferase; purine metabolism, structural genomics, PSI, protein structure initative; HET: G4P; 1.80A {Bacillus subtilis} Back     alignment and structure
>1vdm_A (A:) Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} Back     alignment and structure
>1cjb_A (A:) Protein (hypoxanthine-guanine phosphoribosyltransferase); malaria, purine salvage, transition state inhibitor; HET: IRP; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1o57_A (A:77-291) PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} Back     alignment and structure
>1wd5_A (A:) Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} Back     alignment and structure
>2dy0_A (A:) APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
>1l1q_A (A:) Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} Back     alignment and structure
>1qb7_A (A:1-215) APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} Back     alignment and structure
>1fsg_A (A:) HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii RH} Back     alignment and structure
>1ufr_A (A:11-155) TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} Back     alignment and structure
>1lh0_A (A:40-184) OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2ps1_A (A:1-20,A:44-207) Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Back     alignment and structure
>2wns_A (A:39-171) Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>2ehj_A (A:) Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Escherichia coli} Back     alignment and structure
>2p1z_A (A:) Phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.44A {Corynebacterium diphtheriae NCTC13129} Back     alignment and structure
>2yzk_A (A:1-10,A:35-178) OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1o5o_A (A:) Uracil phosphoribosyltransferase; TM0721, structural genomics, JCSG, PSI, protein structure initiative; HET: U5P; 2.30A {Thermotoga maritima} Back     alignment and structure
>1u9y_A (A:143-270) RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} Back     alignment and structure
>1v9s_A (A:) Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics; 2.10A {Thermus thermophilus HB8} Back     alignment and structure
>3dez_A (A:100-183) OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, magnesium, pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>2h06_A (A:148-292) Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthetase 1, phosphoribosyl pyrophosphate synthetase 1, transferase; 2.20A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h07_A 2h08_A Back     alignment and structure
>2jky_A (A:10-185) Hypoxanthine-guanine phosphoribosyltransferase; nucleus, cytoplasm, magnesium, GMP complex, FLIP peptide-plane, glycosyltransferase; HET: 5GP; 2.3A {Saccharomyces cerevisiae} PDB: 2jkz_A* Back     alignment and structure
>2aee_A (A:68-174) OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, protein structure initiative; 1.95A {Streptococcus pyogenes} Back     alignment and structure
>2e55_A (A:) Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.15A {Aquifex aeolicus} Back     alignment and structure
>1xtt_A (A:) Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1dqn_A (A:60-175) Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia lamblia} Back     alignment and structure
>1nul_A (A:9-131) XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli} Back     alignment and structure
>3dah_A (A:153-295) Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1bd3_D (D:) Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} Back     alignment and structure
>1dku_A (A:154-295) Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} Back     alignment and structure
>3dmp_A (A:) Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} Back     alignment and structure