254780310

254780310

hypothetical protein CLIBASIA_00975

GeneID in NCBI database:8209292Locus tag:CLIBASIA_00975
Protein GI in NCBI database:254780310Protein Accession:YP_003064723.1
Gene range:-(200604, 200963)Protein Length:119aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI
cHHHHHHHHHHHHHHHHHHcccccHHHcccccccccccHHHHHcccccccccccccccccccccccHHHHcccccHHHEEEcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHccc
cccHHHHHHHHHHHHHcEcccccccccEEEEEccEEEEcccccccEEEEccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcc
MPAIIQTVKSIIIELFHciypsicpiysRIINLRFClcghcwskiHFITATEHILknnkdnidkdplksmqkdlpltqirsVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI
MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKDNIDKDPLKSmqkdlpltqirsvTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI
MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI
********KSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEK*
MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI
MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI
MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI
MPAIIQTVKSIIIELFHCIYPSICPIYSRIINLRFCLCGHCWSKIHFITATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTLYCDMSCVLVRLLKYHDRTDLAIMMAQWMFRVLEKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target119 hypothetical protein CLIBASIA_00975 [Candidatus Liberib
315122266 214 competence protein F, putative [Candidatus Liberibacter 1 1e-25
86136799 242 competence protein F, putative [Roseobacter sp. MED193] 1 5e-09
126738463 242 competence protein F, putative [Roseobacter sp. SK209-2 1 1e-08
90420200 249 competence protein F [Aurantimonas manganoxydans SI85-9 1 2e-07
304394136 273 competence protein F [Ahrensia sp. R2A130] Length = 273 1 7e-07
319781332 266 phosphoribosyltransferase [Mesorhizobium ciceri biovar 1 8e-07
159185776 263 competence protein F [Agrobacterium tumefaciens str. C5 1 1e-06
163867840 261 competence protein ComF [Bartonella tribocorum CIP 1054 1 2e-06
254464782 242 competence protein F [Rhodobacterales bacterium Y4I] Le 1 2e-06
49475199 262 competence protein comF [Bartonella henselae str. Houst 1 2e-06
>gi|315122266|ref|YP_004062755.1| competence protein F, putative [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 214 Back     alignment and organism information
 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 73/90 (81%)

Query: 30  IINLRFCLCGHCWSKIHFITATEHILKNNKDNIDKDPLKSMQKDLPLTQIRSVTLYCDMS 89
           +I+ RFCLC  CWSKI+FI++    L+N  + I++ PL+ +++DL L  IRSV +YCD+S
Sbjct: 1   MIDRRFCLCAFCWSKINFISSATQNLENIDNIINEKPLELLRQDLRLIPIRSVVVYCDIS 60

Query: 90  CVLVRLLKYHDRTDLAIMMAQWMFRVLEKI 119
           CVLVRLLKYHDRTDLAIMMAQWMFRV +++
Sbjct: 61  CVLVRLLKYHDRTDLAIMMAQWMFRVGKEL 90


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86136799|ref|ZP_01055377.1| competence protein F, putative [Roseobacter sp. MED193] Length = 242 Back     alignment and organism information
>gi|126738463|ref|ZP_01754168.1| competence protein F, putative [Roseobacter sp. SK209-2-6] Length = 242 Back     alignment and organism information
>gi|90420200|ref|ZP_01228108.1| competence protein F [Aurantimonas manganoxydans SI85-9A1] Length = 249 Back     alignment and organism information
>gi|304394136|ref|ZP_07376059.1| competence protein F [Ahrensia sp. R2A130] Length = 273 Back     alignment and organism information
>gi|319781332|ref|YP_004140808.1| phosphoribosyltransferase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 266 Back     alignment and organism information
>gi|159185776|ref|NP_357098.2| competence protein F [Agrobacterium tumefaciens str. C58] Length = 263 Back     alignment and organism information
>gi|163867840|ref|YP_001609044.1| competence protein ComF [Bartonella tribocorum CIP 105476] Length = 261 Back     alignment and organism information
>gi|254464782|ref|ZP_05078193.1| competence protein F [Rhodobacterales bacterium Y4I] Length = 242 Back     alignment and organism information
>gi|49475199|ref|YP_033240.1| competence protein comF [Bartonella henselae str. Houston-1] Length = 262 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target119 hypothetical protein CLIBASIA_00975 [Candidatus Liberib
COG1040 225 COG1040, ComFC, Predicted amidophosphoribosyltransferas 0.001
>gnl|CDD|31242 COG1040, ComFC, Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 119 hypothetical protein CLIBASIA_00975 [Candidatus Liberib
PRK11595 227 gluconate periplasmic binding protein; Provisional 99.9
COG1040 225 ComFC Predicted amidophosphoribosyltransferases [Genera 99.65
TIGR00201 207 comF comF family protein; InterPro: IPR005222 Proteins 99.3
TIGR00143 799 hypF [NiFe] hydrogenase maturation protein HypF; InterP 91.03
>PRK11595 gluconate periplasmic binding protein; Provisional Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>TIGR00201 comF comF family protein; InterPro: IPR005222 Proteins in this family are found in bacterial species which posses systems for natural transformation with exogenous DNA (eg Bacillus subtilis, Haemophilus influenzae), and also species without these systems (eg Escherichia coli) Back     alignment and domain information
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF; InterPro: IPR004421 The large subunit of [NiFe]-hydrogenase, as well as other nickel metalloenzymes, is synthesized as a precursor devoid of the metalloenzyme active site Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00