254780311

254780311

hypothetical protein CLIBASIA_00980

GeneID in NCBI database:8209294Locus tag:CLIBASIA_00980
Protein GI in NCBI database:254780311Protein Accession:YP_003064724.1
Gene range:-(201484, 202017)Protein Length:177aa
Gene description:hypothetical protein
COG prediction:[O] Peroxiredoxin
KEGG prediction:hypothetical protein
SEED prediction:Expressed protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK
ccccccccEEEEEEccccccccccccccccccHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHcccccEEEEEcccHHHHHHHccEEcccccccccccEEEEEEEEccEEEEEEEccccccccccccEEEccHHHHHHHHHHccc
ccccccccEEEEEEcccccccccccccEEEEEHHHHccccEEEEEEEcccccHHHHHcHHHHHHHcHHHHHcccccEEEEEEcccHHHHHHHHHHcccccEEEEcccccHHHHHcccEEcccccccccccHHHHEEEcccEEEEEEEcccccccccccccEcccHHHHHHHHcHccc
MIRFQIPQVVFHMRVAtvlpdgskafqwkdvntqdlfagKRVFlfalpgaftptcsdhqlpgfeKIYDDLRCEGIEEVYCLSVNDAFVMNAWGkkleiknvkllpdgsgeftrKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWfveegfsdncatdpyeisspeNVLKVIRESKK
mirfqipqvvFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKkleiknvkllpdgSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSdncatdpyeisspenvlkvireskk
MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK
****QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIR****
MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK
****QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRES**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK
MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK
MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target177 hypothetical protein CLIBASIA_00980 [Candidatus Liberib
315122265176 hypothetical protein CKC_02585 [Candidatus Liberibacter 1 3e-77
49476039174 hypothetical protein BH13580 [Bartonella henselae str. 1 5e-66
163868799174 hypothetical protein Btr_1726 [Bartonella tribocorum CI 1 5e-66
121602101175 putative peroxiredoxin [Bartonella bacilliformis KC583] 1 7e-66
240850983173 putative peroxiredoxin [Bartonella grahamii as4aup] Len 1 8e-66
319406170174 conserved hypothetical protein [Bartonella sp. AR 15-3] 1 1e-65
319407644174 conserved hypothetical protein [Bartonella sp. 1-1C] Le 1 2e-65
319404663174 conserved hypothetical protein [Bartonella rochalimae A 1 3e-65
319409223174 conserved hypothetical protein [Bartonella schoenbuchen 1 2e-64
49474601174 hypothetical protein BQ10800 [Bartonella quintana str. 1 4e-64
>gi|315122265|ref|YP_004062754.1| hypothetical protein CKC_02585 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 176 Back     alignment and organism information
 Score =  291 bits (745), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 135/176 (76%), Positives = 154/176 (87%)

Query: 1   MIRFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQL 60
           MI F+IP V+F  RV     DGS +F+WKDV+T++LF+ K+VFL ALPGAFTPTCS+ QL
Sbjct: 1   MIDFKIPHVIFRTRVKKTALDGSSSFEWKDVSTEELFSKKKVFLCALPGAFTPTCSNSQL 60

Query: 61  PGFEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVY 120
           PGFEKIYDDL  EGIE+VYCLSVND+FVMNAWGK L IKNVKLLPDGSGEFTRKMGMLVY
Sbjct: 61  PGFEKIYDDLISEGIEDVYCLSVNDSFVMNAWGKSLGIKNVKLLPDGSGEFTRKMGMLVY 120

Query: 121 KDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESK 176
           KDN+GFG+RSWRYGALI DM+++ WF+E+GFSDNC TDPYEISSPENVLK IR SK
Sbjct: 121 KDNLGFGVRSWRYGALIDDMIIQHWFIEKGFSDNCPTDPYEISSPENVLKFIRASK 176


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|49476039|ref|YP_034080.1| hypothetical protein BH13580 [Bartonella henselae str. Houston-1] Length = 174 Back     alignment and organism information
>gi|163868799|ref|YP_001610023.1| hypothetical protein Btr_1726 [Bartonella tribocorum CIP 105476] Length = 174 Back     alignment and organism information
>gi|121602101|ref|YP_989434.1| putative peroxiredoxin [Bartonella bacilliformis KC583] Length = 175 Back     alignment and organism information
>gi|240850983|ref|YP_002972383.1| putative peroxiredoxin [Bartonella grahamii as4aup] Length = 173 Back     alignment and organism information
>gi|319406170|emb|CBI79807.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 174 Back     alignment and organism information
>gi|319407644|emb|CBI81293.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 174 Back     alignment and organism information
>gi|319404663|emb|CBI78265.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 174 Back     alignment and organism information
>gi|319409223|emb|CBI82867.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 174 Back     alignment and organism information
>gi|49474601|ref|YP_032643.1| hypothetical protein BQ10800 [Bartonella quintana str. Toulouse] Length = 174 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target177 hypothetical protein CLIBASIA_00980 [Candidatus Liberib
cd03013155 cd03013, PRX5_like, Peroxiredoxin (PRX) family, PRX5-li 1e-43
KOG0541171 KOG0541, KOG0541, KOG0541, Alkyl hydroperoxide reductas 3e-31
cd02971140 cd02971, PRX_family, Peroxiredoxin (PRX) family; compos 2e-20
pfam08534142 pfam08534, Redoxin, Redoxin 5e-18
COG0678165 COG0678, AHP1, Peroxiredoxin [Posttranslational modific 5e-52
pfam00578124 pfam00578, AhpC-TSA, AhpC/TSA family 2e-10
COG0450194 COG0450, AhpC, Peroxiredoxin [Posttranslational modific 7e-08
cd03018149 cd03018, PRX_AhpE_like, Peroxiredoxin (PRX) family, Ahp 2e-06
cd03015173 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, Typic 2e-05
cd03014143 cd03014, PRX_Atyp2cys, Peroxiredoxin (PRX) family, Atyp 4e-05
COG1225157 COG1225, Bcp, Peroxiredoxin [Posttranslational modifica 7e-05
cd03017140 cd03017, PRX_BCP, Peroxiredoxin (PRX) family, Bacteriof 2e-04
PRK13189222 PRK13189, PRK13189, peroxiredoxin; Provisional 2e-04
cd03016203 cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PR 3e-04
TIGR03137187 TIGR03137, AhpC, peroxiredoxin 0.002
PRK13191215 PRK13191, PRK13191, putative peroxiredoxin; Provisional 0.003
PRK13190202 PRK13190, PRK13190, putative peroxiredoxin; Provisional 0.001
>gnl|CDD|48562 cd03013, PRX5_like, Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>gnl|CDD|35761 KOG0541, KOG0541, KOG0541, Alkyl hydroperoxide reductase/peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48520 cd02971, PRX_family, Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>gnl|CDD|149549 pfam08534, Redoxin, Redoxin Back     alignment and domain information
>gnl|CDD|31022 COG0678, AHP1, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|144244 pfam00578, AhpC-TSA, AhpC/TSA family Back     alignment and domain information
>gnl|CDD|30799 COG0450, AhpC, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48567 cd03018, PRX_AhpE_like, Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>gnl|CDD|48564 cd03015, PRX_Typ2cys, Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>gnl|CDD|48563 cd03014, PRX_Atyp2cys, Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>gnl|CDD|31418 COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48566 cd03017, PRX_BCP, Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>gnl|CDD|183884 PRK13189, PRK13189, peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|48565 cd03016, PRX_1cys, Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>gnl|CDD|163149 TIGR03137, AhpC, peroxiredoxin Back     alignment and domain information
>gnl|CDD|183885 PRK13191, PRK13191, putative peroxiredoxin; Provisional Back     alignment and domain information
>gnl|CDD|106159 PRK13190, PRK13190, putative peroxiredoxin; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 177 hypothetical protein CLIBASIA_00980 [Candidatus Liberib
COG0678165 AHP1 Peroxiredoxin [Posttranslational modification, pro 100.0
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfami 100.0
KOG0541171 consensus 100.0
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, prot 100.0
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys P 99.97
TIGR03137187 AhpC peroxiredoxin. This gene contains two invariant cy 99.97
PTZ00253199 tryparedoxin peroxidase; Provisional 99.97
PRK13190202 putative peroxiredoxin; Provisional 99.97
PRK00522168 tpx thiol peroxidase; Provisional 99.97
PTZ00137194 2-Cys peroxiredoxin; Provisional 99.97
PRK09437156 bcp thioredoxin-dependent thiol peroxidase; Reviewed 99.97
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamil 99.97
PRK13189215 peroxiredoxin; Provisional 99.97
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys 99.97
PRK10382187 alkyl hydroperoxide reductase subunit C; Provisional 99.96
PRK13599215 putative peroxiredoxin; Provisional 99.96
PRK13191230 putative peroxiredoxin; Provisional 99.96
COG0450194 AhpC Peroxiredoxin [Posttranslational modification, pro 99.96
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like sub 99.95
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of the 99.94
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin co 99.92
KOG0855211 consensus 99.89
pfam08534142 Redoxin Redoxin. This family of redoxins includes perox 99.87
KOG0852196 consensus 99.77
COG2077158 Tpx Peroxiredoxin [Posttranslational modification, prot 99.77
KOG0854224 consensus 99.75
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetic 99.64
PRK03147176 thiol-disulfide oxidoreductase; Provisional 99.56
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known as Cc 98.72
cd02966116 TlpA_like_family TlpA-like family; composed of TlpA, Re 98.71
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfami 98.24
TIGR00385175 dsbE periplasmic protein thiol:disulfide oxidoreductase 97.87
TIGR02661189 MauD methylamine dehydrogenase accessory protein MauD; 96.97
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved in bio 96.94
pfam05988211 DUF899 Bacterial protein of unknown function (DUF899). 95.39
PTZ00256183 glutathione peroxidase; Provisional 93.98
KOG2792280 consensus 93.57
pfam00578124 AhpC-TSA AhpC/TSA family. This family contains proteins 99.72
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetic 99.37
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for 98.44
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c Oxida 98.17
cd02967114 mauD Methylamine utilization (mau) D family; mauD prote 98.07
pfam02630159 SCO1-SenC SCO1/SenC. This family is involved in biogene 97.71
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, Try 97.62
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; compo 97.05
>COG0678 AHP1 Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>KOG0541 consensus Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK00522 tpx thiol peroxidase; Provisional Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>KOG0855 consensus Back     alignment and domain information
>pfam08534 Redoxin Redoxin Back     alignment and domain information
>KOG0852 consensus Back     alignment and domain information
>COG2077 Tpx Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0854 consensus Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily; InterPro: IPR004799 Periplasmic protein thiol:disulphide oxidoreductase is involved in the biogenesis of c-type cytochromes as well as in disulphide bond formation in some periplasmic proteins Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD; InterPro: IPR013478 MauD appears critical to proper formation of the small subunit of methylamine dehydrogenase, which has both an unusual tryptophan tryptophylquinone cofactor and multiple disulphide bonds Back     alignment and domain information
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>pfam05988 DUF899 Bacterial protein of unknown function (DUF899) Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>KOG2792 consensus Back     alignment and domain information
>pfam00578 AhpC-TSA AhpC/TSA family Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>pfam02630 SCO1-SenC SCO1/SenC Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target177 hypothetical protein CLIBASIA_00980 [Candidatus Liberib
1nm3_A241 Crystal Structure Of Heamophilus Influenza Hybrid-P 2e-27
1tp9_A162 Prx D (Type Ii) From Populus Tremula Length = 162 6e-24
2wfc_A167 Crystal Structure Of Peroxiredoxin 5 From Arenicola 2e-19
1xiy_A182 Crystal Structure Of Plasmodium Falciparum Antioxid 5e-18
2vl2_A172 Oxidized And Reduced Forms Of Human Peroxiredoxin 5 2e-16
3mng_A173 Wild Type Human Prxv With Dtt Bound As A Competitiv 3e-16
1oc3_A172 Human Peroxiredoxin 5 Length = 172 3e-16
1hd2_A161 Human Peroxiredoxin 5 Length = 161 3e-16
1urm_A172 Human Peroxiredoxin 5, C47s Mutant Length = 172 5e-16
2pwj_A171 Structure Of A Mitochondrial Type Ii Peroxiredoxin 2e-15
2vl9_A173 Oxidized Form Of Human Peroxiredoxin 5 Length = 173 3e-15
2ywn_A157 Crystal Structure Of Peroxiredoxin-Like Protein Fro 1e-09
2cx3_A164 Crystal Structure Of A Bacterioferritin Comigratory 5e-08
3hjp_A164 The Crystal Structure Of Bcp4 From Sulfolobus Solfa 9e-08
3drn_A161 The Crystal Structure Of Bcp1 From Sulfolobus Sulfa 3e-07
2jsy_A167 Solution Structure Of Tpx In The Oxidized State Len 1e-06
3gkk_A163 Insights Into The Alkyl Peroxide Reduction Activity 2e-06
3gkn_A163 Insights Into The Alkyl Peroxide Reduction Activity 7e-06
3gkm_A163 Insights Into The Alkyl Peroxide Reduction Activity 8e-06
1y25_A165 Structure Of Mycobacterial Thiol Peroxidase Tpx Len 1e-05
1zye_A220 Crystal Strucutre Analysis Of Bovine Mitochondrial 4e-05
2h01_A192 Py00414- Plasmodium Yoelii Thioredoxin Peroxidase I 5e-05
1xvq_A175 Crystal Structure Of Thiol Peroxidase From Mycobact 6e-05
1psq_A163 Structure Of A Probable Thiol Peroxidase From Strep 1e-04
1xcc_A220 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 2 1e-04
3ixr_A179 Crystal Structure Of Xylella Fastidiosa Prxq C47s M 4e-04
2rii_A199 Crystal Structure Of Human Peroxiredoxin I In Compl 4e-04
1yf1_A186 Structural And Biochemical Analysis Of The Link Bet 7e-04
1e2y_A188 Tryparedoxin Peroxidase From Crithidia Fasciculata 8e-04
3hy2_A206 Crystal Structure Of Sulfiredoxin In Complex With P 8e-04
1qq2_A199 Crystal Structure Of A Mammalian 2-Cys Peroxiredoxi 9e-04
1yf0_A186 Structural And Biochemical Analysis Of The Link Bet 9e-04
1we0_A187 Crystal Structure Of Peroxiredoxin (Ahpc) From Amph 0.001
3emp_A186 Crystal Structure Of The S-Acetanilide Modified For 0.001
1yep_A186 Structural And Biochemical Analysis Of The Link Bet 0.001
1yex_A186 Structural And Biochemical Analysis Of The Link Bet 0.002
2z9s_A199 Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXI 0.002
1n8j_A186 Crystal Structure Of Ahpc With Active Site Cysteine 0.003
1qxh_A167 Crystal Structure Of Escherichia Coli Thiol Peroxid 0.004
1xvw_A160 Crystal Structure Of Ahpe From Mycobacterium Tuberc 9e-06
1xxu_A153 Crystal Structure Of Ahpe From Mycrobacterium Tuber 4e-05
3a5w_A249 Peroxiredoxin (Wild Type) From Aeropyrum Pernix K1 9e-05
3a2v_A249 Peroxiredoxin (C207s) From Aeropyrum Pernix K1 Comp 9e-05
2e2g_A250 Crystal Structure Of Archaeal Peroxiredoxin, Thiore 9e-05
1x0r_A249 Thioredoxin Peroxidase From Aeropyrum Pernix K1 Len 1e-04
2v2g_A233 Crystal Structure Of The C45s Mutant Of The Peroxir 1e-04
3a2w_A249 Peroxiredoxin (C50s) From Aeropytum Pernix K1 (Pero 2e-04
2zct_A249 Oxidation Of Archaeal Peroxiredoxin Involves A Hype 2e-04
2e2m_A250 Crystal Structure Of Archaeal Peroxiredoxin, Thiore 2e-04
2cv4_A250 Crystal Structure Of An Archaeal Peroxiredoxin From 3e-04
1prx_A224 Horf6 A Novel Human Peroxidase Enzyme Length = 224 3e-04
>gi|29726703|pdb|1NM3|A Chain A, Crystal Structure Of Heamophilus Influenza Hybrid-Prx5 Length = 241 Back     alignment and structure
 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 69/175 (39%), Positives = 101/175 (57%), Gaps = 13/175 (7%)

Query: 3   RFQIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPG 62
             ++PQV F  R             W DV T +LF  K V +F+LPGAFTPTCS   LP 
Sbjct: 6   GKKVPQVTFRTRQGDK---------WVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPR 56

Query: 63  FEKIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKD 122
           + ++    +  G++++  +SVND FV NAW +  + +N+  +PDG+GEFT   G LV K+
Sbjct: 57  YNELAPVFKKYGVDDILVVSVNDTFVXNAWKEDEKSENISFIPDGNGEFTEGXGXLVGKE 116

Query: 123 NVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           ++GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  +  LK +    +
Sbjct: 117 DLGFGKRSWRYSXLVKNGVVEKXFIEP----NEPGDPFKVSDADTXLKYLAPQHQ 167


>gi|66360171|pdb|1TP9|A Chain A, Prx D (Type Ii) From Populus Tremula Length = 162 Back     alignment and structure
>gi|296278281|pdb|2WFC|A Chain A, Crystal Structure Of Peroxiredoxin 5 From Arenicola Marina Length = 167 Back     alignment and structure
>gi|61680402|pdb|1XIY|A Chain A, Crystal Structure Of Plasmodium Falciparum Antioxidant Protein (1-Cys Peroxiredoxin) Length = 182 Back     alignment and structure
>gi|197304975|pdb|2VL2|A Chain A, Oxidized And Reduced Forms Of Human Peroxiredoxin 5 Length = 172 Back     alignment and structure
>gi|302148804|pdb|3MNG|A Chain A, Wild Type Human Prxv With Dtt Bound As A Competitive Inhibitor Length = 173 Back     alignment and structure
>gi|46015018|pdb|1OC3|A Chain A, Human Peroxiredoxin 5 Length = 172 Back     alignment and structure
>gi|15826629|pdb|1HD2|A Chain A, Human Peroxiredoxin 5 Length = 161 Back     alignment and structure
>gi|55670364|pdb|1URM|A Chain A, Human Peroxiredoxin 5, C47s Mutant Length = 172 Back     alignment and structure
>gi|189095941|pdb|2PWJ|A Chain A, Structure Of A Mitochondrial Type Ii Peroxiredoxin From Pisum Sativum Length = 171 Back     alignment and structure
>gi|197304981|pdb|2VL9|A Chain A, Oxidized Form Of Human Peroxiredoxin 5 Length = 173 Back     alignment and structure
>gi|159795627|pdb|2YWN|A Chain A, Crystal Structure Of Peroxiredoxin-Like Protein From Sulfolobus Tokodaii Length = 157 Back     alignment and structure
>gi|85544451|pdb|2CX3|A Chain A, Crystal Structure Of A Bacterioferritin Comigratory Protein Peroxiredoxin From The Aeropyrum Pernix K1 (Form-1 Crystal) Length = 164 Back     alignment and structure
>gi|296863456|pdb|3HJP|A Chain A, The Crystal Structure Of Bcp4 From Sulfolobus Solfataricus Length = 164 Back     alignment and structure
>gi|226887715|pdb|3DRN|A Chain A, The Crystal Structure Of Bcp1 From Sulfolobus Sulfataricus Length = 161 Back     alignment and structure
gi|194368468|pdb|2JSY|A Chain A, Solution Structure Of Tpx In The Oxidized State Length = 167 Back     alignment and structure
>gi|240104460|pdb|3GKK|A Chain A, Insights Into The Alkyl Peroxide Reduction Activity Of Xanthomonas Campestris Bacterioferritin Comigratory Protein From The Trapped IntermediateLIGAND COMPLEX STRUCTURES Length = 163 Back     alignment and structure
>gi|240104462|pdb|3GKN|A Chain A, Insights Into The Alkyl Peroxide Reduction Activity Of Xanthomonas Campestris Bacterioferritin Comigratory Protein From The Trapped IntermediateLIGAND COMPLEX STRUCTURES Length = 163 Back     alignment and structure
>gi|240104461|pdb|3GKM|A Chain A, Insights Into The Alkyl Peroxide Reduction Activity Of Xanthomonas Campestris Bacterioferritin Comigratory Protein From The Trapped IntermediateLIGAND COMPLEX STRUCTURES Length = 163 Back     alignment and structure
>gi|83753706|pdb|1Y25|A Chain A, Structure Of Mycobacterial Thiol Peroxidase Tpx Length = 165 Back     alignment and structure
>gi|78101145|pdb|1ZYE|A Chain A, Crystal Strucutre Analysis Of Bovine Mitochondrial Peroxiredoxin Iii Length = 220 Back     alignment and structure
>gi|109158138|pdb|2H01|A Chain A, Py00414- Plasmodium Yoelii Thioredoxin Peroxidase I Length = 192 Back     alignment and structure
>gi|60594471|pdb|1XVQ|A Chain A, Crystal Structure Of Thiol Peroxidase From Mycobacterium Tuberculosis Length = 175 Back     alignment and structure
>gi|33358145|pdb|1PSQ|A Chain A, Structure Of A Probable Thiol Peroxidase From Streptococcus Pneumoniae Length = 163 Back     alignment and structure
gi|56967056|pdb|1XCC|A Chain A, 1-Cys Peroxidoxin From Plasmodium Yoelli Length = 220 Back     alignment and structure
>gi|291463493|pdb|3IXR|A Chain A, Crystal Structure Of Xylella Fastidiosa Prxq C47s Mutant Length = 179 Back     alignment and structure
>gi|164519504|pdb|2RII|A Chain A, Crystal Structure Of Human Peroxiredoxin I In Complex With Sulfiredoxin Length = 199 Back     alignment and structure
>gi|75765552|pdb|1YF1|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>gi|13786919|pdb|1E2Y|A Chain A, Tryparedoxin Peroxidase From Crithidia Fasciculata Length = 188 Back     alignment and structure
>gi|260656338|pdb|3HY2|A Chain A, Crystal Structure Of Sulfiredoxin In Complex With Peroxiredoxin I And Atp:mg2+ Length = 206 Back     alignment and structure
>gi|6435547|pdb|1QQ2|A Chain A, Crystal Structure Of A Mammalian 2-Cys Peroxiredoxin, Hbp23. Length = 199 Back     alignment and structure
>gi|75765547|pdb|1YF0|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>gi|62738232|pdb|1WE0|A Chain A, Crystal Structure Of Peroxiredoxin (Ahpc) From Amphibacillus Xylanus Length = 187 Back     alignment and structure
>gi|224510654|pdb|3EMP|A Chain A, Crystal Structure Of The S-Acetanilide Modified Form Of C165s Ahpc Length = 186 Back     alignment and structure
>gi|75765537|pdb|1YEP|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Olgomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>gi|75765542|pdb|1YEX|A Chain A, Structural And Biochemical Analysis Of The Link Between Enzymatic Activity And Oligomerization In Ahpc, A Bacterial Peroxiredoxin. Length = 186 Back     alignment and structure
>gi|160877873|pdb|2Z9S|A Chain A, Crystal Structure Analysis Of Rat Hbp23PEROXIREDOXIN I, Cys52ser Mutant Length = 199 Back     alignment and structure
>gi|30749577|pdb|1N8J|A Chain A, Crystal Structure Of Ahpc With Active Site Cysteine Mutated To Serine (C46s) Length = 186 Back     alignment and structure
>gi|42543455|pdb|1QXH|A Chain A, Crystal Structure Of Escherichia Coli Thiol Peroxidase In The Oxidized State Length = 167 Back     alignment and structure
>gi|61680453|pdb|1XVW|A Chain A, Crystal Structure Of Ahpe From Mycobacterium Tuberculosis, A 1-Cys Peroxiredoxin Length = 160 Back     alignment and structure
gi|61680459|pdb|1XXU|A Chain A, Crystal Structure Of Ahpe From Mycrobacterium Tuberculosis, A 1-Cys Peroxiredoxin Length = 153 Back     alignment and structure
>gi|262118518|pdb|3A5W|A Chain A, Peroxiredoxin (Wild Type) From Aeropyrum Pernix K1 (Reduced Form) Length = 249 Back     alignment and structure
>gi|262118485|pdb|3A2V|A Chain A, Peroxiredoxin (C207s) From Aeropyrum Pernix K1 Complexed With Hydrogen Peroxide Length = 249 Back     alignment and structure
>gi|160877634|pdb|2E2G|A Chain A, Crystal Structure Of Archaeal Peroxiredoxin, Thioredoxin Peroxidase From Aeropyrum Pernix K1 (Pre-Oxidation Form) Length = 250 Back     alignment and structure
>gi|85543926|pdb|1X0R|A Chain A, Thioredoxin Peroxidase From Aeropyrum Pernix K1 Length = 249 Back     alignment and structure
>gi|178847275|pdb|2V2G|A Chain A, Crystal Structure Of The C45s Mutant Of The Peroxiredoxin 6 Of Arenicola Marina. Monoclinic Form Length = 233 Back     alignment and structure
>gi|262118495|pdb|3A2W|A Chain A, Peroxiredoxin (C50s) From Aeropytum Pernix K1 (Peroxide- Bound Form) Length = 249 Back     alignment and structure
>gi|189096094|pdb|2ZCT|A Chain A, Oxidation Of Archaeal Peroxiredoxin Involves A Hypervalent Sulfur Intermediate Length = 249 Back     alignment and structure
>gi|160877644|pdb|2E2M|A Chain A, Crystal Structure Of Archaeal Peroxiredoxin, Thioredoxin Peroxidase From Aeropyrum Pernix K1 (Sulfinic Acid Form) Length = 250 Back     alignment and structure
>gi|71042806|pdb|2CV4|A Chain A, Crystal Structure Of An Archaeal Peroxiredoxin From The Aerobic Hyperthermophilic Crenarchaeon Aeropyrum Pernix K1 Length = 250 Back     alignment and structure
>gi|3318841|pdb|1PRX|A Chain A, Horf6 A Novel Human Peroxidase Enzyme Length = 224 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target177 hypothetical protein CLIBASIA_00980 [Candidatus Liberib
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, el 1e-43
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, 5e-42
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enz 4e-28
1hd2_A161 Peroxiredoxin 5 residues 54-214; antioxidant enzyme, th 2e-27
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protein, ox 3e-27
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, subst 1e-25
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredoxin f 2e-18
3ixr_A179 Bacterioferritin comigratory protein; alpha beta protei 3e-09
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXRC, PS 1e-07
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, atypica 4e-06
3hvv_A167 Thiol peroxidase, scavengase P20; oxidoreductase, TPX, 2e-05
3keb_A224 Probable thiol peroxidase; structural genomics, APC4067 4e-04
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; peroxi 1e-07
1e2y_A188 TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxi 7e-07
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox regulati 2e-06
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1 8e-06
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, oxido 2e-05
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sulphini 4e-04
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hydroge 5e-04
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, structura 7e-04
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidant def 0.001
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thiored 0.001
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-shaped 0.003
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, structural 0.004
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Length = 241 Back     alignment and structure
 Score =  170 bits (433), Expect = 1e-43
 Identities = 72/173 (41%), Positives = 106/173 (61%), Gaps = 13/173 (7%)

Query: 5   QIPQVVFHMRVATVLPDGSKAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFE 64
           ++PQV F  R            +W DV T +LF  K V +F+LPGAFTPTCS   LP + 
Sbjct: 8   KVPQVTFRTRQGD---------KWVDVTTSELFDNKTVIVFSLPGAFTPTCSSSHLPRYN 58

Query: 65  KIYDDLRCEGIEEVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNV 124
           ++    +  G++++  +SVND FVMNAW +  + +N+  +PDG+GEFT  MGMLV K+++
Sbjct: 59  ELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSENISFIPDGNGEFTEGMGMLVGKEDL 118

Query: 125 GFGLRSWRYGALIKDMVVESWFVEEGFSDNCATDPYEISSPENVLKVIRESKK 177
           GFG RSWRY  L+K+ VVE  F+E     N   DP+++S  + +LK +    +
Sbjct: 119 GFGKRSWRYSMLVKNGVVEKMFIEP----NEPGDPFKVSDADTMLKYLAPQHQ 167


>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Length = 182 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Length = 167 Back     alignment and structure
>1hd2_A Peroxiredoxin 5 residues 54-214; antioxidant enzyme, thioredoxin peroxidase, thioredoxin fold; 1.5A {Homo sapiens} SCOP: c.47.1.10 PDB: 1h4o_A 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A Length = 161 Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Length = 171 Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Length = 173 Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Length = 162 Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Length = 179 Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Length = 165 Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreductase; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Length = 163 Back     alignment and structure
>3hvv_A Thiol peroxidase, scavengase P20; oxidoreductase, TPX, peroxiredoxin, antioxidant; 1.75A {Escherichia coli k-12} PDB: 3hvs_A* 1qxh_A* 3i43_A* 3hvx_A Length = 167 Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.80A {Chromobacterium violaceum} Length = 224 Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Length = 186 Back     alignment and structure
>1e2y_A TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxidoreductase; 3.2A {Crithidia fasciculata} SCOP: c.47.1.10 Length = 188 Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Length = 224 Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Length = 233 Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Length = 202 Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix K1} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Length = 249 Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 211 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in europe, spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Length = 195 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Length = 221 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Length = 198 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Length = 192 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target177 hypothetical protein CLIBASIA_00980 [Candidatus Liberib
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, 100.0
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, el 100.0
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protein, ox 100.0
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredoxin f 100.0
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enz 100.0
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, subst 100.0
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural genom 100.0
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1 100.0
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox regulati 100.0
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thiored 99.97
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane, dod 99.96
3keb_A224 Probable thiol peroxidase; structural genomics, APC4067 99.96
2i81_A213 2-Cys peroxiredoxin; structural genomics consortium, SG 99.96
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, oxido 99.96
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, structural 99.96
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidant def 99.96
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, o 99.96
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sulphini 99.96
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, structura 99.95
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; peroxi 99.95
1e2y_A188 TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxi 99.95
3ixr_A179 Bacterioferritin comigratory protein; alpha beta protei 99.95
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hydroge 99.95
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-shaped 99.95
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXRC, PS 99.93
2yzh_A171 Probable thiol peroxidase; redox protein, antioxidant, 99.93
3hvv_A167 Thiol peroxidase, scavengase P20; oxidoreductase, TPX, 99.93
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, atypica 99.92
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural genomics 99.92
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, aty 99.91
2cx4_A164 Bacterioferritin comigratory protein; oxidoreductase, a 99.91
2jsy_A167 Probable thiol peroxidase; solution structure, antioxid 99.9
1psq_A163 Probable thiol peroxidase; structural genomics, NYSGXRC 99.9
2ywn_A157 Peroxiredoxin-like protein; redox protein, structural g 99.9
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin fold, 99.89
3drn_A161 Peroxiredoxin, bacterioferritin comigratory protein hom 99.85
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-like p 99.44
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , stru 99.38
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredoxin-l 99.27
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like fold 99.25
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved protein, 99.18
3me7_A170 Putative uncharacterized protein; electron transfer pro 99.17
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; redox p 99.14
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like fold, 99.05
3or5_A165 Thiol:disulfide interchange protein, thioredoxin protei 99.05
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCSG, st 98.92
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-beta fo 98.82
2k6v_A172 Putative cytochrome C oxidase assembly protein; thiored 98.8
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaperone, 98.68
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI, pro 98.66
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductase MSR 98.41
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxidase, m 98.33
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; oxid 99.57
2ywi_A196 Hypothetical conserved protein; uncharacterized conserv 99.53
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin protein, P 99.21
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, structural 99.18
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like supe 99.16
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreductase; N 99.05
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like, thi 99.03
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomics, AP 99.0
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreductase, P 98.98
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-terminal th 98.97
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomics, PS 98.96
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, structu 98.94
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, 98.91
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, PSI, M 98.85
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathione pe 98.82
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredoxin f 98.74
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathione pe 98.71
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, cytoplasm, o 98.67
2rli_A171 SCO2 protein homolog, mitochondrial; copper protein, th 98.53
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thioredox 98.46
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, thior 97.91
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron r 97.5
2vup_A190 Glutathione peroxidase-like protein; oxidoreductase, tr 98.88
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, NPGP 98.6
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3-laye 98.59
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidoreduct 98.52
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, oxido 98.5
3cyn_A189 Probable glutathione peroxidase 8; thioredoxin fold, me 98.36
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.40A {C 95.55
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
Probab=100.00  E-value=0  Score=337.42  Aligned_cols=174  Identities=35%  Similarity=0.717  Sum_probs=156.3

Q ss_pred             CCCCCCCEEEEEEECCCCCCCC----CCCCCCCEEHHHHHCCCEEEEEEECCCCCCCCCHHHCHHHHHHHHHH-HHHCCC
Q ss_conf             7671881599995367068840----36888402358983897499998228878741001010465311245-531011
Q gi|254780311|r    2 IRFQIPQVVFHMRVATVLPDGS----KAFQWKDVNTQDLFAGKRVFLFALPGAFTPTCSDHQLPGFEKIYDDL-RCEGIE   76 (177)
Q Consensus         2 ~~~~ip~~~~~ikvGd~~Pd~t----l~~~~~~~~~~d~f~gKkVvL~~~P~AfTp~Ct~~~~~~~~~~~~~~-~~~~~~   76 (177)
                      .|.+||++++.+++.+. |...    .+++.++++++|+|+||||||||+||||||+||.+|+|+|.++++.| +.+|+|
T Consensus         3 ~gd~iP~v~~~~~~~~~-~~~~~~~~~~~~~~~~~~~d~f~~KkVvl~~vPGAFTptCs~~hlP~y~~~~~~f~k~~gvd   81 (182)
T 1xiy_A            3 ENDLIPNVKVMIDVRNM-NNISDTDGSPNDFTSIDTHELFNNKKILLISLPGAFTPTCSTKMIPGYEEEYDYFIKENNFD   81 (182)
T ss_dssp             TTCBCCCCEEEEEHHHH-TC--------CCEEEEEHHHHSTTCEEEEEECSCTTCHHHHHTHHHHHHHTHHHHHTTSCCS
T ss_pred             CCCCCCCEEEEEEECCC-CCCCCCCCCCCCCEEEEHHHHHCCCEEEEEECCCCCCCCCCHHHCCCHHHHHHHHHHHCCCC
T ss_conf             87717984889862256-44444668988725745999859984999973777698678303756888889999856985


Q ss_pred             EEEEEECCCCHHHHHHHCCCCCCEEEEEECCCHHHHHHHHCCCCCCCCCCCEEEEEEEEEECCCEEEEEEECCCCCCCCC
Q ss_conf             02343035401136652235875278610367154333200224765434410015999987996999997488777877
Q gi|254780311|r   77 EVYCLSVNDAFVMNAWGKKLEIKNVKLLPDGSGEFTRKMGMLVYKDNVGFGLRSWRYGALIKDMVVESWFVEEGFSDNCA  156 (177)
Q Consensus        77 ~i~~~s~~d~~~~~aw~~~~~~~~~~~l~D~~~~~~~~~g~~~~~~~~g~g~rs~R~a~Ii~dG~I~~~~~E~~~~~~~~  156 (177)
                      +|||+|+||||+|+||+++.+..++++++|++++|++++|+..+....|+|.|||||+|||+||+|+++|+|++..++++
T Consensus        82 ~I~cisvNDpfVm~AW~~~~~~~~i~~lsD~~g~ftk~lGl~~d~~~~g~g~Rs~Rya~iiddg~I~~~~vE~~~~~~~~  161 (182)
T 1xiy_A           82 DIYCITNNDIYVLKSWFKSMDIKKIKYISDGNSSFTDSMNMLVDKSNFFMGMRPWRFVAIVENNILVKMFQEKDKQHNIQ  161 (182)
T ss_dssp             EEEEEESSCHHHHHHHHHHTTCCSSEEEECTTSHHHHHTTCEEECGGGTCCEEECCEEEEEETTEEEEEEECSSCCTTCS
T ss_pred             EEEEEECCCHHHHHHHHHHCCCCCCEEEECCCHHHHHHCCCEECCCCCCCEEEEEEEEEEEECCEEEEEEEECCCCCCCC
T ss_conf             26899659999999999746634366811787899986498143566888087777999998998999998379877888


Q ss_pred             CCCCCCCCHHHHHHHHHHHC
Q ss_conf             77732489999999998616
Q gi|254780311|r  157 TDPYEISSPENVLKVIRESK  176 (177)
Q Consensus       157 ~d~~~vs~ae~iL~~Lk~~~  176 (177)
                      .|||++|+||+||++||+.|
T Consensus       162 ~dp~~vSsae~iL~~Lk~~~  181 (182)
T 1xiy_A          162 TDPYDISTVNNVKEFLKNNQ  181 (182)
T ss_dssp             SCCCSTTSHHHHHHHHHCC-
T ss_pred             CCCCCCCCHHHHHHHHHHCC
T ss_conf             98756679999999885576



>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in europe, spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>1e2y_A TRYP, tryparedoxin peroxidase; 2-Cys peroxiredoxin, oxidoreductase; 3.2A {Crithidia fasciculata} SCOP: c.47.1.10 Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix K1} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, structural genomics, NPPSFA; 1.85A {Aquifex aeolicus VF5} Back     alignment and structure
>3hvv_A Thiol peroxidase, scavengase P20; oxidoreductase, TPX, peroxiredoxin, antioxidant; 1.75A {Escherichia coli k-12} PDB: 3hvs_A* 1qxh_A* 3i43_A* 3hvx_A Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreductase; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>2cx4_A Bacterioferritin comigratory protein; oxidoreductase, antioxidant enzyme, reactive oxygen species, thioredoxin fold, structural genomics; 2.30A {Aeropyrum pernix K1} SCOP: c.47.1.10 PDB: 2cx3_A Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>2ywn_A Peroxiredoxin-like protein; redox protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Sulfolobus tokodaii} PDB: 3hjp_A Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory protein homolog; oxidoreductase; HET: CIT; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal- kingston bacterial structural genomics initiative; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein structure initiative; HET: MSE; 1.30A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, structural genomics, PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken structural genomics/proteomics initiative; 1.80A {Thermus thermophilus HB8} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure