254780312

254780312

response regulator receiver protein

GeneID in NCBI database:8209295Locus tag:CLIBASIA_00985
Protein GI in NCBI database:254780312Protein Accession:YP_003064725.1
Gene range:+(202550, 202918)Protein Length:122aa
Gene description:response regulator receiver protein
COG prediction:[T] FOG: CheY-like receiver
KEGG prediction:response regulator receiver protein; K13589 two-component system, cell cycle response regulator CpdR
SEED prediction:Response regulator
Pathway involved in KEGG:Two-component system [PATH:las02020]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLTIKN
cccEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHcc
cccEEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHcccccEEEEcccHHHHHHHHHHHccccc
mnqkillaeddDDMRRFLIKALGKAGYEVvscnngasaydkvreepfsllltdivmpemDGIELARRAteldpdlkvMFITGFAAvalnpdsnapknakvlskpfhlRDLVNEVNRLLTIKN
mnqkillaeddddmRRFLIKAlgkagyevvSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIELARRATELDPDLKVMFITGFAAValnpdsnapKNAKVlskpfhlrdlvNEVNRLLTIKN
MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLTIKN
MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLT***
MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLTIKN
*NQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLT***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMDGIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLTIKN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target122 response regulator receiver protein [Candidatus Liberib
254780450803 two-component sensor histidine kinase/response reg 1e-15
254780476123 two component response regulator [Candidatus Liber 9e-06
>gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Back     alignment
 Score = 73.6 bits (179), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 49/119 (41%), Positives = 68/119 (57%), Gaps = 8/119 (6%)

Query: 5   ILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREE---PFSLLLTDIVMPEMDG 61
           +LL ED+D +RR   + L   GY V    +G  A  KV E+      ++++D+VMPEMDG
Sbjct: 684 VLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDAL-KVMEKLQGRVDIVISDVVMPEMDG 742

Query: 62  IELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAK--VLSKPFHLRDLVNEVNRLL 118
             L R   +  P LK +FI+G+A  A +   N PK+AK   LSKPF L+ L   V+ LL
Sbjct: 743 PTLLRELRKTYPSLKFIFISGYAEDAFS--KNLPKDAKFSFLSKPFSLKQLATSVHELL 799

>gi|254780476|ref|YP_003064889.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Back     alignment
 Score = 40.4 bits (93), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/121 (20%), Positives = 57/121 (47%), Gaps = 4/121 (3%)

Query: 1   MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMD 60
           M +K+++ ED++   +     +  +GY  +   NG  A +  R+    +++ DI + E+ 
Sbjct: 1   MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEIS 60

Query: 61  GIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKV---LSKPFHLRDLVNEVNRL 117
           G+E+ ++  E D +L+ + +    A A+  D    +       +SKP  L   +  + + 
Sbjct: 61  GLEITKQIKE-DSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKY 119

Query: 118 L 118
           +
Sbjct: 120 I 120

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target122 response regulator receiver protein [Candidatus Liberib
315122264120 response regulator receiver protein [Candidatus Liberib 1 5e-60
86359166120 two-component response regulator protein [Rhizobium etl 1 8e-54
222149748121 chemotaxis response regulator [Agrobacterium vitis S4] 1 1e-53
222087102121 two-component response regulator protein [Agrobacterium 1 1e-53
332716601121 chemotaxis response regulator [Agrobacterium sp. H13-3] 1 1e-53
15966580120 putative 2-component receiver domain protein [Sinorhizo 1 1e-53
159185932120 chemotaxis response regulator [Agrobacterium tumefacien 1 2e-53
227823401120 putative two-component response regulator transcription 1 2e-53
163758886121 putative two component response regulator transcription 1 1e-51
260460614120 response regulator receiver protein [Mesorhizobium oppo 1 6e-51
>gi|315122264|ref|YP_004062753.1| response regulator receiver protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 120 Back     alignment and organism information
 Score =  233 bits (595), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%)

Query: 1   MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMD 60
           MNQKILLAEDD+DMRRFLIKALG AGYEV+SCNNGASAYDK+REEPFSLLLTDIVMPEMD
Sbjct: 1   MNQKILLAEDDNDMRRFLIKALGNAGYEVISCNNGASAYDKIREEPFSLLLTDIVMPEMD 60

Query: 61  GIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLTI 120
           GIELAR+ATELDPDLKVMFITGFAAV+LNPDSNAPKNAKVLSKPFHLRDLVNEVNRLL +
Sbjct: 61  GIELARKATELDPDLKVMFITGFAAVSLNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLAV 120


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359166|ref|YP_471058.1| two-component response regulator protein [Rhizobium etli CFN 42] Length = 120 Back     alignment and organism information
>gi|222149748|ref|YP_002550705.1| chemotaxis response regulator [Agrobacterium vitis S4] Length = 121 Back     alignment and organism information
>gi|222087102|ref|YP_002545637.1| two-component response regulator protein [Agrobacterium radiobacter K84] Length = 121 Back     alignment and organism information
>gi|332716601|ref|YP_004444067.1| chemotaxis response regulator [Agrobacterium sp. H13-3] Length = 121 Back     alignment and organism information
>gi|15966580|ref|NP_386933.1| putative 2-component receiver domain protein [Sinorhizobium meliloti 1021] Length = 120 Back     alignment and organism information
>gi|159185932|ref|NP_356752.2| chemotaxis response regulator [Agrobacterium tumefaciens str. C58] Length = 120 Back     alignment and organism information
>gi|227823401|ref|YP_002827374.1| putative two-component response regulator transcriptional regulatory protein [Sinorhizobium fredii NGR234] Length = 120 Back     alignment and organism information
>gi|163758886|ref|ZP_02165973.1| putative two component response regulator transcriptional regulatory protein [Hoeflea phototrophica DFL-43] Length = 121 Back     alignment and organism information
>gi|260460614|ref|ZP_05808865.1| response regulator receiver protein [Mesorhizobium opportunistum WSM2075] Length = 120 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target122 response regulator receiver protein [Candidatus Liberib
pfam00072111 pfam00072, Response_reg, Response regulator receiver do 1e-18
cd00156113 cd00156, REC, Signal receiver domain; originally though 3e-18
COG3437 360 COG3437, COG3437, Response regulator containing a CheY- 8e-15
PRK11361 457 PRK11361, PRK11361, acetoacetate metabolism regulatory 1e-14
TIGR01818 463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 4e-14
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal transduc 2e-13
PRK13557540 PRK13557, PRK13557, histidine kinase; Provisional 2e-13
COG0745 229 COG0745, OmpR, Response regulators consisting of a CheY 9e-13
COG3706 435 COG3706, PleD, Response regulator containing a CheY-lik 1e-11
COG4566202 COG4566, TtrR, Response regulator [Signal transduction 7e-11
PRK15479 221 PRK15479, PRK15479, transcriptional regulatory protein 2e-10
COG2197211 COG2197, CitB, Response regulator containing a CheY-lik 3e-10
COG3947 361 COG3947, COG3947, Response regulator containing CheY-li 3e-10
PRK10365 441 PRK10365, PRK10365, transcriptional regulatory protein 9e-10
PRK09390202 PRK09390, fixJ, response regulator FixJ; Provisional 2e-09
PRK10923 469 PRK10923, glnG, nitrogen regulation protein NR(I); Prov 9e-09
COG4567182 COG4567, COG4567, Response regulator consisting of a Ch 2e-08
COG3279 244 COG3279, LytT, Response regulator of the LytR/AlgR fami 3e-08
KOG0519786 KOG0519, KOG0519, KOG0519, Sensory transduction histidi 3e-08
CHL00148 240 CHL00148, orf27, Ycf27; Reviewed 2e-07
PRK15115 444 PRK15115, PRK15115, response regulator GlrR; Provisiona 3e-07
COG4565 224 COG4565, CitB, Response regulator of citrate/malate met 6e-07
PRK15347 921 PRK15347, PRK15347, two component system sensor kinase 6e-07
PRK11466 914 PRK11466, PRK11466, hybrid sensory histidine kinase Tor 9e-07
TIGR01387218 TIGR01387, cztR_silR_copR, heavy metal response regulat 1e-06
PRK09836 227 PRK09836, PRK09836, DNA-binding transcriptional activat 1e-06
PRK10955 232 PRK10955, PRK10955, DNA-binding transcriptional regulat 9e-06
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS 1e-05
PRK10766221 PRK10766, PRK10766, DNA-binding transcriptional regulat 3e-05
PRK10643 222 PRK10643, PRK10643, DNA-binding transcriptional regulat 4e-05
PRK11091 779 PRK11091, PRK11091, aerobic respiration control sensor 5e-04
PRK10336219 PRK10336, PRK10336, DNA-binding transcriptional regulat 0.002
TIGR02875 262 TIGR02875, spore_0_A, sporulation transcription factor 0.002
COG2204 464 COG2204, AtoC, Response regulator containing CheY-like 7e-22
COG4753 475 COG4753, COG4753, Response regulator containing CheY-li 3e-14
smart0044855 smart00448, REC, cheY-homologous receiver domain 1e-09
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinase Bar 1e-09
TIGR02154 226 TIGR02154, PhoB, phosphate regulon transcriptional regu 6e-09
PRK11083 228 PRK11083, PRK11083, DNA-binding response regulator CreB 8e-09
PRK09959 1197 PRK09959, PRK09959, hybrid sensory histidine kinase in 2e-08
PRK10841924 PRK10841, PRK10841, hybrid sensory kinase in two-compon 5e-08
PRK09581 457 PRK09581, pleD, response regulator PleD; Reviewed 5e-07
PRK11173 237 PRK11173, PRK11173, two-component response regulator; P 3e-06
PRK09468 239 PRK09468, ompR, osmolarity response regulator; Provisio 5e-06
PRK10710 240 PRK10710, PRK10710, DNA-binding transcriptional regulat 7e-06
PRK11517 223 PRK11517, PRK11517, transcriptional regulatory protein 1e-05
PRK12555 337 PRK12555, PRK12555, chemotaxis-specific methylesterase; 2e-05
COG2201 350 COG2201, CheB, Chemotaxis response regulator containing 2e-04
PRK10610129 PRK10610, PRK10610, chemotaxis regulatory protein CheY; 3e-04
PRK10701 240 PRK10701, PRK10701, DNA-binding transcriptional regulat 4e-04
PRK09935210 PRK09935, PRK09935, transcriptional regulator FimZ; Pro 0.003
>gnl|CDD|143854 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|29071 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|33243 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|162545 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information
>gnl|CDD|31127 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|184141 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|31088 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|34204 COG4566, TtrR, Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|33728 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|181815 PRK09390, fixJ, response regulator FixJ; Provisional Back     alignment and domain information
>gnl|CDD|182842 PRK10923, glnG, nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>gnl|CDD|34205 COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|33090 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|164540 CHL00148, orf27, Ycf27; Reviewed Back     alignment and domain information
>gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional Back     alignment and domain information
>gnl|CDD|34203 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|183148 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator Back     alignment and domain information
>gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>gnl|CDD|163083 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|182711 PRK10766, PRK10766, DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>gnl|CDD|182956 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|182387 PRK10336, PRK10336, DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>gnl|CDD|131922 TIGR02875, spore_0_A, sporulation transcription factor Spo0A Back     alignment and domain information
>gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|34367 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|128724 smart00448, REC, cheY-homologous receiver domain Back     alignment and domain information
>gnl|CDD|182968 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>gnl|CDD|182950 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|181966 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|183013 PRK11173, PRK11173, two-component response regulator; Provisional Back     alignment and domain information
>gnl|CDD|181883 PRK09468, ompR, osmolarity response regulator; Provisional Back     alignment and domain information
>gnl|CDD|182665 PRK10710, PRK10710, DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>gnl|CDD|183591 PRK12555, PRK12555, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|32383 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>gnl|CDD|182660 PRK10701, PRK10701, DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>gnl|CDD|182154 PRK09935, PRK09935, transcriptional regulator FimZ; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 122 response regulator receiver protein [Candidatus Liberib
TIGR02154 226 PhoB phosphate regulon transcriptional regulatory prote 100.0
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisional 99.97
PRK09581 457 pleD response regulator PleD; Reviewed 99.97
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; Provis 99.97
PRK10161 229 transcriptional regulator PhoB; Provisional 99.97
PRK10693 337 response regulator of RpoS; Provisional 99.97
PRK10365 441 transcriptional regulatory protein ZraR; Provisional 99.97
PRK11083 229 DNA-binding response regulator CreB; Provisional 99.97
PRK10841947 hybrid sensory kinase in two-component regulatory syste 99.97
PRK09468 239 ompR osmolarity response regulator; Provisional 99.97
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 99.97
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.96
PRK09836 226 DNA-binding transcriptional activator CusR; Provisional 99.96
PRK10336219 DNA-binding transcriptional regulator QseB; Provisional 99.96
PRK13557538 histidine kinase; Provisional 99.96
pfam00072111 Response_reg Response regulator receiver domain. This d 99.96
CHL00148 240 orf27 Ycf27; Reviewed 99.96
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 99.96
PRK10766 224 DNA-binding transcriptional regulator TorR; Provisional 99.96
COG2204 464 AtoC Response regulator containing CheY-like receiver, 99.96
cd00156113 REC Signal receiver domain; originally thought to be un 99.96
PRK11517 223 transcriptional regulatory protein YedW; Provisional 99.96
PRK11466 912 hybrid sensory histidine kinase TorS; Provisional 99.96
TIGR01387 219 cztR_silR_copR heavy metal response regulator; InterPro 99.96
PRK10046225 dpiA two-component response regulator DpiA; Provisional 99.96
PRK11091 779 aerobic respiration control sensor protein ArcB; Provis 99.96
PRK11173 237 two-component response regulator; Provisional 99.96
TIGR01818 471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 99.96
PRK10701 240 DNA-binding transcriptional regulator RstA; Provisional 99.95
PRK10529 225 DNA-binding transcriptional activator KdpE; Provisional 99.95
PRK10955 232 DNA-binding transcriptional regulator CpxR; Provisional 99.95
PRK10643 222 DNA-binding transcriptional regulator BasR; Provisional 99.95
PRK09390202 fixJ response regulator FixJ; Provisional 99.95
PRK10816 223 DNA-binding transcriptional regulator PhoP; Provisional 99.95
PRK10710 240 DNA-binding transcriptional regulator BaeR; Provisional 99.95
COG0745 229 OmpR Response regulators consisting of a CheY-like rece 99.95
COG4753 475 Response regulator containing CheY-like receiver domain 99.94
PRK13856 241 two-component response regulator VirG; Provisional 99.94
PRK10430 239 DNA-binding transcriptional activator DcuR; Provisional 99.94
PRK13435141 response regulator; Provisional 99.93
TIGR02875 270 spore_0_A sporulation transcription factor Spo0A; Inter 99.93
KOG0519786 consensus 99.93
PRK00742 345 chemotaxis-specific methylesterase; Provisional 99.92
COG4566202 TtrR Response regulator [Signal transduction mechanisms 99.92
PRK12555 340 chemotaxis-specific methylesterase; Provisional 99.9
COG3437 360 Response regulator containing a CheY-like receiver doma 99.9
TIGR02956 1052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 99.89
PRK09958204 DNA-binding transcriptional activator EvgA; Provisional 99.89
PRK10651216 transcriptional regulator NarL; Provisional 99.89
PRK13837831 two-component VirA-like sensor kinase; Provisional 99.89
PRK09483216 response regulator; Provisional 99.88
COG3706 435 PleD Response regulator containing a CheY-like receiver 99.88
PRK09935210 transcriptional regulator FimZ; Provisional 99.88
PRK10403215 transcriptional regulator NarP; Provisional 99.88
PRK10840216 transcriptional regulator RcsB; Provisional 99.86
COG2197211 CitB Response regulator containing a CheY-like receiver 99.86
COG4565 224 CitB Response regulator of citrate/malate metabolism [T 99.84
PRK10360196 DNA-binding transcriptional activator UhpA; Provisional 99.83
TIGR02915 451 PEP_resp_reg putative PEP-CTERM system response regulat 99.83
COG3947 361 Response regulator containing CheY-like receiver and SA 99.83
COG0784130 CheY FOG: CheY-like receiver [Signal transduction mecha 99.82
PRK09191261 two-component response regulator; Provisional 99.82
PRK11697 239 putative two-component response-regulatory protein YehT 99.8
COG4567182 Response regulator consisting of a CheY-like receiver d 99.75
COG2201 350 CheB Chemotaxis response regulator containing a CheY-li 99.71
PRK13558 674 bacterio-opsin activator; Provisional 99.69
PRK10100216 DNA-binding transcriptional regulator CsgD; Provisional 99.65
COG3707194 AmiR Response regulator with putative antiterminator ou 99.57
PRK11475205 DNA-binding transcriptional activator BglJ; Provisional 99.49
COG3279 244 LytT Response regulator of the LytR/AlgR family [Transc 99.4
PRK09581 457 pleD response regulator PleD; Reviewed 99.15
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 99.08
pfam06490109 FleQ Flagellar regulatory protein FleQ. This domain is 98.82
pfam03709111 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain 97.49
cd02067119 B12-binding B12 binding domain (B12-BD). This domain bi 96.43
COG4999140 Uncharacterized domain of BarA-like signal transduction 96.19
PRK07206 415 hypothetical protein; Provisional 95.95
TIGR01815726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 95.75
pfam02310121 B12-binding B12 binding domain. This domain binds to B1 94.17
PRK02261137 methylaspartate mutase subunit S; Provisional 93.58
cd02070201 corrinoid_protein_B12-BD B12 binding domain of corrinoi 93.55
cd02068127 radical_SAM_B12_BD B12 binding domain_like associated w 93.25
COG0313 275 Predicted methyltransferases [General function predicti 92.96
pfam00563233 EAL EAL domain. This domain is found in diverse bacteri 92.27
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) 91.92
PRK10060663 RNase II stability modulator; Provisional 90.92
COG2200256 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Si 90.15
smart0044855 REC cheY-homologous receiver domain. CheY regulates the 99.13
PRK05993 277 short chain dehydrogenase; Provisional 93.72
COG3967 245 DltE Short-chain dehydrogenase involved in D-alanine es 93.68
PRK08017 256 short chain dehydrogenase; Provisional 92.4
PRK06483 236 short chain dehydrogenase; Provisional 90.72
COG3706 435 PleD Response regulator containing a CheY-like receiver 98.97
PRK13566724 anthranilate synthase; Provisional 96.42
PRK06895191 para-aminobenzoate synthase component II; Provisional 93.98
PRK05637208 anthranilate synthase component II; Provisional 93.75
PRK09522 531 bifunctional anthranilate synthase/anthranilate phospho 92.82
COG0512191 PabA Anthranilate/para-aminobenzoate synthases componen 92.8
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine amid 90.4
PRK05670192 anthranilate synthase component II; Provisional 90.31
CHL00101190 trpG anthranilate synthase component 2 90.05
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB; InterPro: IPR011879 PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>pfam00072 Response_reg Response regulator receiver domain Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator; InterPro: IPR006291 Members of this family contain a response regulator receiver domain and an associated transcriptional regulatory region Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I); InterPro: IPR010114 This entry represents Nitrogen regulatory protein C (NtrC), which is a bacterial enhancer-binding protein that activates the transcription of genes encoding enzymes required for nitrogen metabolism Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A; InterPro: IPR012052 Members of this group are response regulators/transcription factors that contain CheY-like receiver (phosphoacceptor) domain and a unique DNA-binding domain Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator; InterPro: IPR014264 Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see Q06065 from SWISSPROT) Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>pfam06490 FleQ Flagellar regulatory protein FleQ Back     alignment and domain information
>pfam03709 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 This entry represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium) Back     alignment and domain information
>pfam02310 B12-binding B12 binding domain Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain Back     alignment and domain information
>COG0313 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>pfam00563 EAL EAL domain Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>COG2200 Rtn c-di-GMP phosphodiesterase class I (EAL domain) [Signal transduction mechanisms] Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08017 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>PRK06895 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK09522 bifunctional anthranilate synthase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target122 response regulator receiver protein [Candidatus Liberib
1mvo_A136 Crystal Structure Of The Phop Receiver Domain From 5e-38
3f6p_A120 Crystal Structure Of Unphosphorelated Receiver Doma 1e-36
2zwm_A130 Crystal Structure Of Yycf Receiver Domain From Baci 1e-36
1zes_A125 Bef3- Activated Phob Receiver Domain Length = 125 9e-36
2iyn_A124 The Co-Factor-Induced Pre-Active Conformation In Ph 1e-35
1b00_A127 Phob Receiver Domain From Escherichia Coli Length = 2e-35
1nxo_A120 Micarec Ph7.0 Length = 120 4e-35
1nxt_A120 Micarec Ph 4.0 Length = 120 5e-35
2jba_A127 Phob Response Regulator Receiver Domain Constitutiv 7e-35
2jba_B127 Phob Response Regulator Receiver Domain Constitutiv 1e-34
3nnn_A122 Bef3 Activated Drrd Receiver Domain Length = 122 1e-34
2jb9_A127 Phob Response Regulator Receiver Domain Constitutiv 1e-33
1kgs_A 225 Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG 1e-33
2oqr_A 230 The Structure Of The Response Regulator Regx3 From 1e-32
3dge_C122 Structure Of A Histidine Kinase-Response Regulator 6e-32
3gl9_A122 The Structure Of A Histidine Kinase-Response Regula 7e-32
>gi|24987831|pdb|1MVO|A Chain A, Crystal Structure Of The Phop Receiver Domain From Bacillus Subtilis Length = 136 Back     alignment and structure
 Score =  160 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 61/120 (50%)

Query: 1   MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMD 60
           MN+KIL+ +D++ +   L   L ++GY+V++ ++G  A  K   E   L++ D+++P++D
Sbjct: 2   MNKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETEKPDLIVLDVMLPKLD 61

Query: 61  GIELARRATELDPDLKVMFITGFAAVALNPDSNAPKNAKVLSKPFHLRDLVNEVNRLLTI 120
           GIE+ ++  +      ++ +T                   ++KPF  R++   V  +L  
Sbjct: 62  GIEVCKQLRQQKLMFPILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAILRR 121


>gi|290560102|pdb|3F6P|A Chain A, Crystal Structure Of Unphosphorelated Receiver Domain Of Yycf Length = 120 Back     alignment and structure
>gi|254220896|pdb|2ZWM|A Chain A, Crystal Structure Of Yycf Receiver Domain From Bacillus Subtilis Length = 130 Back     alignment and structure
>gi|78101053|pdb|1ZES|A Chain A, Bef3- Activated Phob Receiver Domain Length = 125 Back     alignment and structure
>gi|114794859|pdb|2IYN|A Chain A, The Co-Factor-Induced Pre-Active Conformation In Phob Length = 124 Back     alignment and structure
gi|6573458|pdb|1B00|A Chain A, Phob Receiver Domain From Escherichia Coli Length = 127 Back     alignment and structure
>gi|46014953|pdb|1NXO|A Chain A, Micarec Ph7.0 Length = 120 Back     alignment and structure
>gi|46014956|pdb|1NXT|A Chain A, Micarec Ph 4.0 Length = 120 Back     alignment and structure
>gi|126031095|pdb|2JBA|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D53a And Y102c Length = 127 Back     alignment and structure
>gi|126031096|pdb|2JBA|B Chain B, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D53a And Y102c Length = 127 Back     alignment and structure
>gi|302566228|pdb|3NNN|A Chain A, Bef3 Activated Drrd Receiver Domain Length = 122 Back     alignment and structure
>gi|126031093|pdb|2JB9|A Chain A, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D10a And D53e. Length = 127 Back     alignment and structure
>gi|17942992|pdb|1KGS|A Chain A, Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG FROM Thermotoga Maritima Length = 225 Back     alignment and structure
>gi|158429258|pdb|2OQR|A Chain A, The Structure Of The Response Regulator Regx3 From Mycobacterium Tuberculosis Length = 230 Back     alignment and structure
gi|251836870|pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-Response Regulator Complex Reveals Insights Into Two-Component Signaling And A Novel Cis-Autophosphorylation Mechanism Length = 122 Back     alignment and structure
>gi|262118598|pdb|3GL9|A Chain A, The Structure Of A Histidine Kinase-Response Regulator Complex Sheds Light Into Two-Component Signaling And Reveals A Novel Cis Autophosphorylation Mechanism Length = 122 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target122 response regulator receiver protein [Candidatus Liberib
3f6p_A120 Transcriptional regulatory protein YYCF; unphosphorelat 3e-22
3nhm_A133 Response regulator; protein structure initiative II(PSI 4e-21
1srr_A124 SPO0F, sporulation response regulatory protein; asparta 5e-21
3hdg_A137 Uncharacterized protein; two-component sensor activity, 1e-20
1mvo_A136 PHOP response regulator; phosphate regulon, transcripti 2e-20
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGXRC, s 2e-20
3i42_A127 Response regulator receiver domain protein (CHEY- like) 4e-20
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional regula 5e-20
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPase, s 6e-20
2zwm_A130 Transcriptional regulatory protein YYCF; two-component 6e-20
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 activa 6e-20
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer, sig 9e-20
3eqz_A135 Response regulator; structural genomics, unknown functi 2e-19
3cu5_A141 Two component transcriptional regulator, ARAC family; s 2e-19
1mb3_A124 Cell division response regulator DIVK; signal transduct 3e-19
1w25_A 459 Stalked-cell differentiation controlling protein; two-c 4e-19
3c97_A140 Signal transduction histidine kinase; structural genomi 5e-19
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA h 7e-19
3lte_A132 Response regulator; structural genomics, PSI, protein s 8e-19
3f6c_A134 Positive transcription regulator EVGA; structural genom 6e-18
2ayx_A254 Sensor kinase protein RCSC; two independent structural 6e-18
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain, pho 8e-18
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural genom 1e-17
3b2n_A133 Uncharacterized protein Q99UF4; structural genomics, PS 2e-17
2qsj_A154 DNA-binding response regulator, LUXR family; structural 4e-17
2rdm_A132 Response regulator receiver protein; structural genomic 4e-17
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cy 4e-17
3bre_A 358 Probable two-component response regulator; protein-nucl 5e-17
1dz3_A130 Stage 0 sporulation protein A; response regulator, doma 5e-17
3lua_A140 Response regulator receiver protein; two-component sign 5e-17
2b4a_A138 BH3024; 10175646, structural genomics, joint center for 8e-17
3eul_A152 Possible nitrate/nitrite response transcriptional regul 9e-17
3cfy_A137 Putative LUXO repressor protein; structural genomics, u 1e-16
2qv0_A143 Protein MRKE; structural genomics, transcription, PSI-2 1e-16
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A {Esch 2e-16
1p6q_A129 CHEY2; chemotaxis, signal transduction, response regula 2e-16
2qxy_A142 Response regulator; regulation of transcription, NYSGXR 9e-16
3cz5_A153 Two-component response regulator, LUXR family; structur 9e-16
3grc_A140 Sensor protein, kinase; protein structure initiative II 9e-16
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptation, 1e-15
3kht_A144 Response regulator; PSI-II, structural genomics, protei 1e-15
3a10_A116 Response regulator; phosphoacceptor, signaling protein; 2e-15
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatase, co 2e-15
2qr3_A140 Two-component system response regulator; structural gen 2e-15
3hdv_A136 Response regulator; PSI-II, structural genomics, protei 2e-15
1k66_A149 Phytochrome response regulator RCPB; CHEY homologue, ho 4e-15
2rjn_A154 Response regulator receiver:metal-dependent phosphohydr 5e-15
3kto_A136 Response regulator receiver protein; PSI-II,structural 7e-15
3gl9_A122 Response regulator; beta-sheet, surrounded by alpha hel 1e-14
3cg4_A142 Response regulator receiver domain protein (CHEY- like) 1e-14
2jba_A127 Phosphate regulon transcriptional regulatory protein PH 1e-14
1kgs_A 225 DRRD, DNA binding response regulator D; DNA-binding pro 2e-14
1k68_A140 Phytochrome response regulator RCPA; phosphorylated asp 3e-14
1i3c_A149 Response regulator RCP1; phytochrome, signaling protein 3e-14
1dcf_A136 ETR1 protein; beta-alpha five sandwich; 2.50A {Arabidop 5e-14
3crn_A132 Response regulator receiver domain protein, CHEY- like; 5e-14
2j48_A119 Two-component sensor kinase; pseudo-receiver, circadian 6e-14
2gkg_A127 Response regulator homolog; social motility, receiver d 7e-14
3cg0_A140 Response regulator receiver modulated diguanylate cycla 8e-14
3c3m_A138 Response regulator receiver protein; structural genomic 8e-14
3n0r_A286 Response regulator; sigma factor, receiver, two-compone 9e-14
2jk1_A139 HUPR, hydrogenase transcriptional regulatory protein HU 1e-13
1s8n_A205 Putative antiterminator; structural genomics, transcrip 1e-13
3eod_A130 Protein HNR; response regulator, phosphoprotein, two-co 1e-13
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wound f 2e-13
3cwo_X 237 Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, 5e-13
3cnb_A143 DNA-binding response regulator, MERR family; signal rec 5e-13
3luf_A259 Two-component system response regulator/ggdef domain pr 6e-11
3heb_A152 Response regulator receiver domain protein (CHEY); NYSG 2e-12
2a9o_A120 Response regulator; essential protein, YYCF/YYCG homolo 4e-12
2zay_A147 Response regulator receiver protein; structural genomic 5e-12
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like fold 6e-12
1p2f_A 220 Response regulator; DRRB, OMPR/PHOB, transcription; HET 6e-12
1yio_A208 Response regulatory protein; transcription regulation, 7e-12
3h5i_A140 Response regulator/sensory box protein/ggdef domain pro 8e-12
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5-BETA5 2e-11
1zh2_A121 KDP operon transcriptional regulatory protein KDPE; two 5e-11
1xhf_A123 DYE resistance, aerobic respiration control protein ARC 6e-11
2gwr_A 238 DNA-binding response regulator MTRA; two-component regu 1e-10
3jte_A143 Response regulator receiver protein; structural genomic 2e-10
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, struc 3e-10
2qzj_A136 Two-component response regulator; 11017X, PSI-II, struc 3e-10
1zgz_A122 Torcad operon transcriptional regulatory protein TORR; 4e-10
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, prot 4e-10
3gt7_A154 Sensor protein; structural genomics, signal receiver do 6e-10
2oqr_A 230 Sensory transduction protein REGX3; response regulator, 9e-10
3klo_A225 Transcriptional regulator VPST; REC domain, HTH domain, 2e-09
2pln_A137 HP1043, response regulator; signaling protein; 1.80A {H 4e-08
3eq2_A 394 Probable two-component response regulator; adaptor sigm 4e-20
3kyj_B145 CHEY6 protein, putative histidine protein kinase; prote 6e-13
3luf_A 259 Two-component system response regulator/ggdef domain pr 2e-12
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2.25A 2e-11
3c3w_A 225 Two component transcriptional regulatory protein DEVR; 5e-10
1ys7_A 233 Transcriptional regulatory protein PRRA; response regul 4e-09
1a04_A215 Nitrate/nitrite response regulator protein NARL; signal 2e-05
2hqr_A 223 Putative transcriptional regulator; phosporylation-inde 2e-08
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 Back     alignment and structure
 Score = 98.9 bits (247), Expect = 3e-22
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 11/123 (8%)

Query: 1   MNQKILLAEDDDDMRRFLIKALGKAGYEVVSCNNGASAYDKVREEPFSLLLTDIVMPEMD 60
           M++KIL+ +D+  +   L   L K GYEV   ++G  A + V E    L+L DI++P  D
Sbjct: 1   MDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKD 60

Query: 61  GIELARRATELDPDLKVMFITGFAAV-----ALNPDSNAPKNAKVLSKPFHLRDLVNEVN 115
           G+E+ R   +   D+ ++ +T   +       L   ++       ++KPF  R+L+  V 
Sbjct: 61  GVEVCREVRK-KYDMPIIMLTAKDSEIDKVIGLEIGADD-----YVTKPFSTRELLARVK 114

Query: 116 RLL 118
             L
Sbjct: 115 ANL 117


>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, dimer; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 1zy2_A* Length = 387 Back     alignment and structure
>2zwm_A Transcriptional regulatory protein YYCF; two-component system, response regulator, dimerization domain, phosphorylation site, cytoplasm; 2.04A {Bacillus subtilis} Length = 130 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.15A {Colwellia psychrerythraea 34H} Length = 135 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC family; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, response regulator, diguanylate cyclase, ggdef domain; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* Length = 459 Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, nysgrc, NEW YORK structural genomix research consortium; 2.00A {Bermanella marisrubri} Length = 132 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, , PSI-2, protein structure initiative; 1.45A {Escherichia coli k-12} Length = 134 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative; 2.04A {Staphylococcus aureus} Length = 133 Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE; 1.76A {Sinorhizobium medicae WSM419} Length = 132 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa PAO1} PDB: 3i5a_A* Length = 358 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 Back     alignment and structure
>2b4a_A BH3024; 10175646, structural genomics, joint center for structural genomics, JCSG, protein structure initiative PSI, unknown function; 2.42A {Bacillus halodurans c-125} SCOP: c.23.1.1 Length = 138 Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Length = 152 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 1cye_A 2che_A 2chf_A 2pl9_A* 2pmc_A ... Length = 128 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 Back     alignment and structure
>3kht_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Hahella chejuensis kctc 2396} Length = 144 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structure initiative; 1.80A {Bacteroides fragilis YCH46} Length = 140 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.09A {Pseudomonas putida KT2440} Length = 136 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92, PSI-2; 2.10A {Neptuniibacter caesariensis} Length = 154 Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136 Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY- like); structural genomics, unknown function, uncharacterized protein; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory protein PHOB; transcription factor, sensory transduction, phosphate regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix-turn-helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 Length = 225 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY- like; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolution, signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor; signal receiver domain; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} Length = 286 Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HUPR1; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 Back     alignment and structure
>1s8n_A Putative antiterminator; structural genomics, transcriptional antiterminator, two component system, PSI; 1.48A {Mycobacterium tuberculosis H37RV} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixation regulation; HET: 15P; 1.60A {Rhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Length = 126 Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} Length = 237 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structure initiative, PSI-2; 2.00A {Colwellia psychrerythraea 34H} Length = 143 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, protein structure initiative; 2.40A {Rhodospirillum rubrum atcc 11170} Length = 152 Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, PSI-2, protein structure initiative; 2.00A {Desulfuromonas acetoxidans dsm 684} Length = 147 Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 Length = 220 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} Length = 238 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics, protein structure initiative; 2.89A {Clostridium difficile 630} Length = 136 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein TORR; two-component system, gene regulation, transcription factor, TMAO respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein structure initiative, structural genomics; 2.59A {Cytophaga hutchinsonii atcc 33406} Length = 146 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D domain swapping; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Length = 225 Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Length = 137 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} Length = 394 Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein DEVR; response regulator, two-component regulatory system, DNA- binding protein; 2.20A {Mycobacterium tuberculosis} Length = 225 Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, symmetric dimer, signaling protein; NMR {Helicobacter pylori J99} Length = 223 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target122 response regulator receiver protein [Candidatus Liberib
1srr_A124 SPO0F, sporulation response regulatory protein; asparta 100.0
1mvo_A136 PHOP response regulator; phosphate regulon, transcripti 99.98
3crn_A132 Response regulator receiver domain protein, CHEY- like; 99.98