254780314

254780314

outer membrane protein

GeneID in NCBI database:8209299Locus tag:CLIBASIA_00995
Protein GI in NCBI database:254780314Protein Accession:YP_003064727.1
Gene range:-(205404, 206459)Protein Length:351aa
Gene description:outer membrane protein
COG prediction:none
KEGG prediction:outer membrane protein
SEED prediction:porin outer membrane protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MGLKKFFLGTVAVATIISYSESFAYVRGKTSMVSNNRARNRSAGKVGNVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDVLSMQFAESDVRALAFTVPSSKLSVEELSLSMKGARLGYYKSWSDEVNPVYSPTTLYNDARGLDKMMSLSYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDKGVDLSVGLKKSF
ccHHHHHHHHHHHHHHHHccccEEEEEcccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccEEEEccccccccEEEEEEEHHHHHHHHHccccEEEEEEEEccccccHHHEEEEEcccEEEEEccccccccccccccHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccccccEEEEEcccccccccccccccEEEEcccccccccccEEEEEcEEEEEEEEEEEccccEEEEcccccccccccccccEEEEEccccccEEEEEEcHHHHHcccccccccEEEEEEcccc
cccHHHEHHHHEEEEEEEccccEEEEEcccccccccccccccccccccccccEEEEEEEEEEEEEcccccccccccccccccccccccEEEEEEcccccEEEEEEEEccccEEEEEEccccHHHHHcccccccccHcEEEEEEcccEEEEEEEEcccccccccccccccccccccEEEEEEEEEccccEEEEEEEEcccccccccccEEEEEEcEEEcEEEEEEEccccccccccEEEEEEEEccccccEEEEEEEEEccccccHcHcHHHHHHHHEEEHHcHcEEccccEEccccccccccccEEEEEEEEEEccccEEEEEEEEccccEcccEEEEcccEEEEcccccc
MGLKKFFLGTVAVATIISYSESFAyvrgktsmvsnnrarnrsagkvgnvlpHITKVGGSLEKSLQARYHKlngnnefnslaydipvkgnlevnanagdvtgVAKLKLAVDDVLSMQFAESDVRALAftvpssklSVEELSLSMKGARLGYykswsdevnpvyspttlyndarglDKMMSLSYRHSFgllkaglstdllqkdglKQVLGIGYMASYAIGKirstvtggydagtnnvairanisspvsragtldcgavwasgdnsyydkskysvfagykfdvaksitisgggqyfgdinktgkdgwsagISAKYMISSGLEAQASVAFNDNFVKKGVAIDKgvdlsvglkksf
mglkkfflGTVAVATIISYSESFAYVRGKtsmvsnnrarnrsagkvgnvlpHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDVLSMQFAESDVRALAftvpssklsveELSLSMKGARLGYYkswsdevnpvysPTTLYNDARGLDKMMSLSYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAidkgvdlsvglkksf
MGLKKFFLGTVAVATIISYSESFAYVRGKTSMVSNNRARNRSAGKVGNVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDVLSMQFAESDVRALAFTVPssklsveelslsMKGARLGYYKSWSDEVNPVYSPTTLYNDARGLDKMMSLSYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDKGVDLSVGLKKSF
*GLKKFFLGTVAVATIISYSESFAYVRGKTSMVSNNRARNRSAGKVGNVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDVLSMQFAESDVRALAFTVPSSKLSVEELSLSMKGARLGYYKSWSDEVNPVYSPTTLYNDARGLDKMMSLSYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDKGVDLSVGLKKSF
MGLKKFFLGTVAVATIISYSESFAYVRGKTSMVSNNRARNRSAGKVGNVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDVLSMQFAESDVRALAFTVPSSKLSVEELSLSMKGARLGYYKSWSDEVNPVYSPTTLYNDARGLDKMMSLSYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDKGVDLSVGLKKSF
*GLKKFFLGTVAVATIISYSESFAYVRGKT***************VGNVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDVLSMQFAESDVRALAFTVPSSKLSVEELSLSMKGARLGYYKSWSDEVNPVYSPTTLYNDARGLDKMMSLSYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDKGVDLSVGLKK*F
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MGLKKFFLGTVAVATIISYSESFAYVRGKTSMVSNNRARNRSAGKVGNVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDVLSMQFAESDVRALAFTVPSSKLSVEELSLSMKGARLGYYKSWSDEVNPVYSPTTLYNDARGLDKMMSLSYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDKGVDLSVGLKKSF
MGLKKFFLGTVAVATIISYSESFAYVRGKTSMVSNNRARNRSAGKVGNVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDVLSMQFAESDVRALAFTVPSSKLSVEELSLSMKGARLGYYKSWSDEVNPVYSPTTLYNDARGLDKMMSLSYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDKGVDLSVGLKKSF
MGLKKFFLGTVAVATIISYSESFAYVRGKTSMVSNNRARNRSAGKVGNVLPHITKVGGSLEKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVNANAGDVTGVAKLKLAVDDVLSMQFAESDVRALAFTVPSSKLSVEELSLSMKGARLGYYKSWSDEVNPVYSPTTLYNDARGLDKMMSLSYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDKGVDLSVGLKKSF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target351 outer membrane protein [Candidatus Liberibacter asiatic
315122261344 outer membrane protein [Candidatus Liberibacter solanac 1 7e-54
227821389343 putative outer membrane protein y4fJ precursor [Sinorhi 1 2e-18
15964809349 outer membrane protein [Sinorhizobium meliloti 1021] Le 1 1e-15
307320695349 porin [Sinorhizobium meliloti AK83] Length = 349 1 1e-15
86360534338 porin outer membrane protein [Rhizobium etli CFN 42] Le 1 4e-15
116255576338 putative outer membrane porin protein [Rhizobium legumi 1 1e-14
190895520338 porin outer membrane protein [Rhizobium etli CIAT 652] 1 1e-14
327191118338 porin outer membrane protein [Rhizobium etli CNPAF512] 1 1e-14
150395894352 porin [Sinorhizobium medicae WSM419] Length = 352 1 1e-14
116252521340 outer membrane protein [Rhizobium leguminosarum bv. vic 1 2e-14
>gi|315122261|ref|YP_004062750.1| outer membrane protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 344 Back     alignment and organism information
 Score =  215 bits (548), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 132/361 (36%), Positives = 205/361 (56%), Gaps = 27/361 (7%)

Query: 1   MGLKKFFLGTVAVATIISYSESFAYVRGKTSMVSNNRARNRSAGKVGNVLPHITKVGGSL 60
           M  K  +LG+ A+  ++SY+ESFA V  K+++ ++  A     G    +  H  K+    
Sbjct: 1   MKFKNIYLGSAAIIAVLSYTESFAVVH-KSTVKNHKNAHYCEKGYQKYLSDHCLKISKYY 59

Query: 61  EKSLQARYHKLNGNNEFNSLAYDIPVKGNLEVN----ANAGDVTGVAKLKLAVDDVLSMQ 116
           E S+ + Y K        S  Y  P+K  + V+       G + G  KLK+   D+ +++
Sbjct: 60  EPSVSSLYVK------GASPQYSYPLKTGVAVDYKTQTRLGKLQGSLKLKVYTPDLSTLR 113

Query: 117 FAESDVRALAF--TVPSSKLSVEELSLSMKGARLGYYKSWSDEVNPVYSPTTLYNDARGL 174
             ++D        T  +  ++++EL L+++G + GYYK WS+EV+ VY    L ND   +
Sbjct: 114 RVKNDSNMFTPSGTFENVNITLDELYLNLRGVQAGYYKPWSNEVSSVYDMAALNNDEANI 173

Query: 175 DKMMSLSYRHSFGLLKAGLSTDLLQKDGLKQVLGIGYMASYAIGKIRSTVTGGYDAGTNN 234
               SLSY+ SFGL+KAGLS DLLQ+   K+ LGIGYM SY  GK++STVTGGYD    +
Sbjct: 174 ---TSLSYQRSFGLVKAGLSADLLQQAAKKRGLGIGYMVSYVFGKLKSTVTGGYDTYNKH 230

Query: 235 VAIRANISSPVSRAGTLDCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFG 294
           +A+RAN+S+ +S   + D GA+WA+G NSYYD+S+ S+FAGYK +V  +I+IS G QYF 
Sbjct: 231 LAVRANVSARLSNCSSFDFGALWANGKNSYYDQSQSSIFAGYKVNVRDNISISPGAQYFW 290

Query: 295 DINK----TGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVAIDKGVDLSVGLKKS 350
           + +K    T ++ W+AG+   Y  S     + S  ++          +KGV++++  K  
Sbjct: 291 NKDKFTTNTKQNSWTAGVGVAYEFSKDTTVKLSTLYDSR-------PNKGVNVALAWKHG 343

Query: 351 F 351
           F
Sbjct: 344 F 344


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821389|ref|YP_002825359.1| putative outer membrane protein y4fJ precursor [Sinorhizobium fredii NGR234] Length = 343 Back     alignment and organism information
>gi|15964809|ref|NP_385162.1| outer membrane protein [Sinorhizobium meliloti 1021] Length = 349 Back     alignment and organism information
>gi|307320695|ref|ZP_07600107.1| porin [Sinorhizobium meliloti AK83] Length = 349 Back     alignment and organism information
>gi|86360534|ref|YP_472422.1| porin outer membrane protein [Rhizobium etli CFN 42] Length = 338 Back     alignment and organism information
>gi|116255576|ref|YP_771409.1| putative outer membrane porin protein [Rhizobium leguminosarum bv. viciae 3841] Length = 338 Back     alignment and organism information
>gi|190895520|ref|YP_001985812.1| porin outer membrane protein [Rhizobium etli CIAT 652] Length = 338 Back     alignment and organism information
>gi|327191118|gb|EGE58165.1| porin outer membrane protein [Rhizobium etli CNPAF512] Length = 338 Back     alignment and organism information
>gi|150395894|ref|YP_001326361.1| porin [Sinorhizobium medicae WSM419] Length = 352 Back     alignment and organism information
>gi|116252521|ref|YP_768359.1| outer membrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 340 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target351 outer membrane protein [Candidatus Liberibacter asiatic
pfam02530378 pfam02530, Porin_2, Porin subfamily 8e-07
>gnl|CDD|145590 pfam02530, Porin_2, Porin subfamily Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 351 outer membrane protein [Candidatus Liberibacter asiatic
pfam02530378 Porin_2 Porin subfamily. This family consists of porins 100.0
COG3203354 OmpC Outer membrane protein (porin) [Cell envelope biog 94.41
pfam04966365 OprB Carbohydrate-selective porin, OprB family. 97.34
PRK13528 727 outer membrane receptor FepA; Provisional 94.72
PRK13524 742 outer membrane receptor FepA; Provisional 93.11
pfam06178218 KdgM Oligogalacturonate-specific porin protein (KdgM). 97.17
pfam09694226 Gcw_chp Bacterial protein of unknown function (Gcw_chp) 93.85
pfam01389175 OmpA_membrane OmpA-like transmembrane domain. The struc 92.3
pfam03349415 Toluene_X Outer membrane protein transport protein (OMP 93.76
PRK09980230 ompL outer membrane porin L; Provisional 93.57
PRK10808 347 outer membrane protein A; Reviewed 91.23
cd00342329 gram_neg_porins Porins form aqueous channels for the di 90.17
>pfam02530 Porin_2 Porin subfamily Back     alignment and domain information
>COG3203 OmpC Outer membrane protein (porin) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam04966 OprB Carbohydrate-selective porin, OprB family Back     alignment and domain information
>PRK13528 outer membrane receptor FepA; Provisional Back     alignment and domain information
>PRK13524 outer membrane receptor FepA; Provisional Back     alignment and domain information
>pfam06178 KdgM Oligogalacturonate-specific porin protein (KdgM) Back     alignment and domain information
>pfam09694 Gcw_chp Bacterial protein of unknown function (Gcw_chp) Back     alignment and domain information
>pfam01389 OmpA_membrane OmpA-like transmembrane domain Back     alignment and domain information
>pfam03349 Toluene_X Outer membrane protein transport protein (OMPP1/FadL/TodX) Back     alignment and domain information
>PRK09980 ompL outer membrane porin L; Provisional Back     alignment and domain information
>PRK10808 outer membrane protein A; Reviewed Back     alignment and domain information
>cd00342 gram_neg_porins Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target351 outer membrane protein [Candidatus Liberibacter asiatic
3prn_A289 Porin; integral membrane protein, pore eyelet mutant; H 97.3
2por_A301 Porin; HET: C8E; 1.80A {Rhodobacter capsulatus} SCOP: f 97.21
2wjr_A214 Probable N-acetylneuraminic acid outer membrane channel 96.53
2f1v_A197 Outer membrane protein W; outer membrane protein beta b 91.17
2k0l_A216 Outer membrane protein A; OMPA, trosy, sidechain, DHPC 90.22
2fgq_X332 OMP32, outer membrane porin protein 32; malate, outer m 96.17
1pho_A330 Phosphoporin; outer membrane protein; 3.00A {Escherichi 93.14
>3prn_A Porin; integral membrane protein, pore eyelet mutant; HET: C8E; 1.90A {Rhodobacter blasticus} SCOP: f.4.3.1 PDB: 1bh3_A* 1prn_A* 7prn_A* 6prn_A* 5prn_A* 2prn_A* 8prn_A* 1h6s_1 Back     alignment and structure
Probab=97.30  E-value=0.0092  Score=35.76  Aligned_cols=153  Identities=13%  Similarity=0.082  Sum_probs=95.0

Q ss_pred             CEEEEEEECCCEEEEEEHHHCCCCCCC--CEEEEEEEEEEEECCEEEEEEEEEECCCC----CCEEEEEEEECCCCCCEE
Q ss_conf             226899825754510330321466665--40347889634541268999852211466----512798886136788202
Q gi|254780314|r  178 MSLSYRHSFGLLKAGLSTDLLQKDGLK--QVLGIGYMASYAIGKIRSTVTGGYDAGTN----NVAIRANISSPVSRAGTL  251 (351)
Q Consensus       178 ~SirYqYe~G~F~AGiSvDeLE~dg~~--n~VGV~g~vsg~aGavS~qltGGyDtd~e----eGAIRAl~ta~iG~PGTl  251 (351)
                      ..+.|.++.+.|+.+++-..-+.++..  +...+...+.+..+++.  +...|+....    .-..+..+...   .+.+
T Consensus       131 ~~~~~s~~~~Gf~~~~~y~~~~~~~~~~~~~~~~~~~~~y~~~~~~--~~~~y~~~~~~~~~~~~~~~~~~y~---~~~~  205 (289)
T 3prn_A          131 NGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMIS--LAAAYTTDAGGIVDNDIAFVGAAYK---FNDA  205 (289)
T ss_dssp             EEEEEEEECSSEEEEEEEEETTTTSCGGGSCCEEEEEEEEECSSEE--EEEEEEESGGGCTTCCEEEEEEEEC---CSSS
T ss_pred             CEEEECCCCCCEEEEEEEECCCCCCCCCCCCCEEEEEEEECCCCEE--EEEEEEECCCCCCCCCEEEEEEEEE---CCCE
T ss_conf             1699652237710010021036666667756279999991168678--9999985057765542389989997---0643


Q ss_pred             EEEEEEECCCCCCCCCCCEEEEEEEEEEECEEEEECCCEEEECCCCCCCCCEEEEEEEEEEEEECCCEEEEEEEECCCCC
Q ss_conf             46788733864000112113664355631104786045254045676785227787788888515912778987327421
Q gi|254780314|r  252 DCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFV  331 (351)
Q Consensus       252 glAgVwASgpNaYY~~SEWaVAAeYaikaTDKl~ITPG~QY~gd~~~sg~DaWk~GlTvDYqItegL~tK~SVqY~D~~~  331 (351)
                      .+++.+......=.+...|.+.+.|.+.+   +  +..++|-..-..  .+.-..+|.++|++..++...+++++.|.  
T Consensus       206 ~~~~~~~~~~~~~~~~~~~~~~~~y~~g~---~--~~~~~y~~~~~~--~~~~~~~~g~~Y~l~~~~~l~a~~~~~~~--  276 (289)
T 3prn_A          206 GTVGLNWYDNGLSTAGDQVTLYGNYAFGA---T--TVRAYVSDIDRA--GADTAYGIGADYQFAEGVKVSGSVQSGFA--  276 (289)
T ss_dssp             EEEEEEEEECTTSTTCSEEEEEEEEEETT---E--EEEEEEEEECST--TCCCEEEEEEEEEEETTEEEEEEEEECTT--
T ss_pred             EEEEEEEEECCCCCCCEEEEEEEEEEECC---E--EEEEEEEECCCC--CCCCEEEEEEEEECCCCEEEEEEEEEECC--
T ss_conf             68999997214677502699877898377---7--899999860677--66448999999976999799999999538--


Q ss_pred             CCCCCCCCCCCCCCCHHCCC
Q ss_conf             13542346631001101139
Q gi|254780314|r  332 KKGVAIDKGVDLSVGLKKSF  351 (351)
Q Consensus       332 ~~~~~~d~g~d~t~gl~~sf  351 (351)
                            |+ .....|+.-+|
T Consensus       277 ------d~-t~~~~Gv~~~F  289 (289)
T 3prn_A          277 ------NE-TVADVGVRFDF  289 (289)
T ss_dssp             ------CC-EEEEEEEEEEC
T ss_pred             ------CC-CCEEEEEEEEC
T ss_conf             ------98-53603778889



>2por_A Porin; HET: C8E; 1.80A {Rhodobacter capsulatus} SCOP: f.4.3.1 PDB: 3por_A* Back     alignment and structure
>2wjr_A Probable N-acetylneuraminic acid outer membrane channel protein NANC; cell membrane, ION transport, transmembrane, porin, transport; HET: EPE; 1.80A {Escherichia coli} PDB: 2wjq_A* Back     alignment and structure
>2f1v_A Outer membrane protein W; outer membrane protein beta barrel; 2.70A {Escherichia coli K12} PDB: 2f1t_A Back     alignment and structure
>2k0l_A Outer membrane protein A; OMPA, trosy, sidechain, DHPC micelles; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2fgq_X OMP32, outer membrane porin protein 32; malate, outer membrane protein; HET: BOG; 1.45A {Delftia acidovorans} SCOP: f.4.3.1 PDB: 2fgr_A 1e54_A Back     alignment and structure
>1pho_A Phosphoporin; outer membrane protein; 3.00A {Escherichia coli} SCOP: f.4.3.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target351 outer membrane protein [Candidatus Liberibacter asiatic
d3prna_289 Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId 97.94
d2fgqx1330 Porin {Comamonas acidovorans [TaxId: 80866]} 95.87
d2pora_301 Porin {Rhodobacter capsulatus [TaxId: 1061]} 92.04
d2zfga1340 Porin {Escherichia coli, different sequences [TaxId: 56 90.71
>d3prna_ f.4.3.1 (A:) Porin {Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Transmembrane beta-barrels
superfamily: Porins
family: Porin
domain: Porin
species: Rhodopseudomonas blastica, strain DSM2131 [TaxId: 1075]
Probab=97.94  E-value=0.00066  Score=41.38  Aligned_cols=153  Identities=13%  Similarity=0.074  Sum_probs=96.7

Q ss_pred             CEEEEEEECCCEEEEEEHHHCCCCCC--CCEEEEEEEEEEEECCEEEEEEEEEECCCC----CCEEEEEEEECCCCCCEE
Q ss_conf             22689982575451033032146666--540347889634541268999852211466----512798886136788202
Q gi|254780314|r  178 MSLSYRHSFGLLKAGLSTDLLQKDGL--KQVLGIGYMASYAIGKIRSTVTGGYDAGTN----NVAIRANISSPVSRAGTL  251 (351)
Q Consensus       178 ~SirYqYe~G~F~AGiSvDeLE~dg~--~n~VGV~g~vsg~aGavS~qltGGyDtd~e----eGAIRAl~ta~iG~PGTl  251 (351)
                      ..+.|.++.+.|+++++.-.=+.+..  .+..+....+.++.+++..  -..|+....    .-+.........   +.+
T Consensus       131 ~i~y~sp~~~Gf~~~~~y~~~~~~~~~~~~~~~~~~~~~y~~~~~~~--~~~y~~~~~~~~~~~~~~~~~~~~~---~~~  205 (289)
T d3prna_         131 NGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISL--AAAYTTDAGGIVDNDIAFVGAAYKF---NDA  205 (289)
T ss_dssp             EEEEEEEECSSEEEEEEEEETTTTSCGGGSCCEEEEEEEEECSSEEE--EEEEEESGGGCTTCCEEEEEEEECC---SSS
T ss_pred             CEEEECCCCCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCCEE--EEEEEECCCCCCCCCCCEEEEEEEE---CCE
T ss_conf             27996611277989988842677665666663268998804786134--6656410477654432101014540---551


Q ss_pred             EEEEEEECCCCCCCCCCCEEEEEEEEEEECEEEEECCCEEEECCCCCCCCCEEEEEEEEEEEEECCCEEEEEEEECCCCC
Q ss_conf             46788733864000112113664355631104786045254045676785227787788888515912778987327421
Q gi|254780314|r  252 DCGAVWASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFV  331 (351)
Q Consensus       252 glAgVwASgpNaYY~~SEWaVAAeYaikaTDKl~ITPG~QY~gd~~~sg~DaWk~GlTvDYqItegL~tK~SVqY~D~~~  331 (351)
                      .+.+.+....+.--+...|.+.+.|.+.+     .+..++|...-...  +.-..+|.++|+++.++..-+.+++.+.  
T Consensus       206 ~~~~~~~~~~~~~~~~~~~~~~~~y~~g~-----~~~~~~y~~~~~~~--~~~~~~lg~~Y~ls~~~~l~a~~~~~~~--  276 (289)
T d3prna_         206 GTVGLNWYDNGLSTAGDQVTLYGNYAFGA-----TTVRAYVSDIDRAG--ADTAYGIGADYQFAEGVKVSGSVQSGFA--  276 (289)
T ss_dssp             EEEEEEEEECTTSTTCSEEEEEEEEEETT-----EEEEEEEEEECSTT--CCCEEEEEEEEEEETTEEEEEEEEECTT--
T ss_pred             EEEEEEEEEECCCCCCEEEEEEEEEEECC-----EEEEEEEEECCCCC--CCCEEEEEEEEECCCCEEEEEEEEEEEC--
T ss_conf             68888888603676413799999998388-----89999996157787--6418999999984998499999999808--


Q ss_pred             CCCCCCCCCCCCCCCHHCCC
Q ss_conf             13542346631001101139
Q gi|254780314|r  332 KKGVAIDKGVDLSVGLKKSF  351 (351)
Q Consensus       332 ~~~~~~d~g~d~t~gl~~sf  351 (351)
                            ++ ...++|++-+|
T Consensus       277 ------~~-~~a~~Gv~~~F  289 (289)
T d3prna_         277 ------NE-TVADVGVRFDF  289 (289)
T ss_dssp             ------CC-EEEEEEEEEEC
T ss_pred             ------CC-CEEEEEEEEEC
T ss_conf             ------98-25725657769



>d2fgqx1 f.4.3.1 (X:3-332) Porin {Comamonas acidovorans [TaxId: 80866]} Back     information, alignment and structure
>d2pora_ f.4.3.1 (A:) Porin {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2zfga1 f.4.3.1 (A:1-340) Porin {Escherichia coli, different sequences [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target351 outer membrane protein [Candidatus Liberibacter asiatic
3prn_A_289 Porin; integral membrane protein, pore eyelet muta 97.62
2por_A_301 Porin; HET: C8E; 1.80A {Rhodobacter capsulatus} (A 95.28
2wjr_A_214 Probable N-acetylneuraminic acid outer membrane ch 96.6
1pho_A_330 Phosphoporin; outer membrane protein; 3.00A {Esche 94.03
2f1c_X_286 OMPG, outer membrane protein G; beta barrel; HET: 92.47
2hdi_A_136-639504 Colicin I receptor; outer membrane, iron transport 90.25
>3prn_A (A:) Porin; integral membrane protein, pore eyelet mutant; HET: C8E; 1.90A {Rhodopseudomonas blastica} Back     alignment and structure
Probab=97.62  E-value=0.0052  Score=38.23  Aligned_cols=156  Identities=14%  Similarity=0.082  Sum_probs=111.8

Q ss_pred             EEEEEEECCCEEEEEEHHHCCCCC--CCCEEEEEEEEEEEECCEEEEEEEEEECCCCCCEEEEEEEECCCCCCEEEEEEE
Q ss_conf             268998257545103303214666--654034788963454126899985221146651279888613678820246788
Q gi|254780314|r  179 SLSYRHSFGLLKAGLSTDLLQKDG--LKQVLGIGYMASYAIGKIRSTVTGGYDAGTNNVAIRANISSPVSRAGTLDCGAV  256 (351)
Q Consensus       179 SirYqYe~G~F~AGiSvDeLE~dg--~~n~VGV~g~vsg~aGavS~qltGGyDtd~eeGAIRAl~ta~iG~PGTlglAgV  256 (351)
                      -+.|.++.+.|+.+.+...-+.+.  ..+.-+....+.++.+.+.....-.......+.+-.-.+.+... .+-+-+++.
T Consensus       132 ~~~~s~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~y~~~~~~~~~~~~~~~~a~y~-~~~~~l~a~  210 (289)
T 3prn_A          132 GIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYK-FNDAGTVGL  210 (289)
T ss_dssp             EEEEEEECSSEEEEEEEEETTTTSCGGGSCCEEEEEEEEECSSEEEEEEEEESGGGCTTCCEEEEEEEEC-CSSSEEEEE
T ss_pred             EEEECCCCCCEEEEEEEECCCCCCCCCCCCCEEEEEEEECCCCEEEEEEEEECCCCCCCCCCCEEEEEEE-ECCEEEEEE
T ss_conf             7997710068999998832677654555673589999902786468988864035655543210001454-054268889


Q ss_pred             EECCCCCCCCCCCEEEEEEEEEEECEEEEECCCEEEECCCCCCCCCEEEEEEEEEEEEECCCEEEEEEEECCCCCCCCCC
Q ss_conf             73386400011211366435563110478604525404567678522778778888851591277898732742113542
Q gi|254780314|r  257 WASGDNSYYDKSKYSVFAGYKFDVAKSITISGGGQYFGDINKTGKDGWSAGISAKYMISSGLEAQASVAFNDNFVKKGVA  336 (351)
Q Consensus       257 wASgpNaYY~~SEWaVAAeYaikaTDKl~ITPG~QY~gd~~~sg~DaWk~GlTvDYqItegL~tK~SVqY~D~~~~~~~~  336 (351)
                      |.-..+.-.+...|.+.+.|.+..   +++.-+.++..+  ....++|.  +.++|++..++..-+.++|.|.       
T Consensus       211 y~~~~~~~~~~~~~~~~~~Y~~~~---~~~~~~y~~~~~--~~~~~~~~--~g~~Y~l~k~~~~yae~~~~~~-------  276 (289)
T 3prn_A          211 NWYDNGLSTAGDQVTLYGNYAFGA---TTVRAYVSDIDR--AGADTAYG--IGADYQFAEGVKVSGSVQSGFA-------  276 (289)
T ss_dssp             EEEECTTSTTCSEEEEEEEEEETT---EEEEEEEEEECS--TTCCCEEE--EEEEEEEETTEEEEEEEEECTT-------
T ss_pred             EEEECCCCCCCEEEEEEEEEEECC---EEEEEEEEECCC--CCCCCEEE--EEEEEECCCCEEEEEEEEEEEC-------
T ss_conf             998503776304899999999488---889999961577--77641899--9999984898599999999708-------


Q ss_pred             CCCCCCCCCCHHCCC
Q ss_conf             346631001101139
Q gi|254780314|r  337 IDKGVDLSVGLKKSF  351 (351)
Q Consensus       337 ~d~g~d~t~gl~~sf  351 (351)
                        +++..++||.-.|
T Consensus       277 --~~~~~~vG~r~~F  289 (289)
T 3prn_A          277 --NETVADVGVRFDF  289 (289)
T ss_dssp             --CCEEEEEEEEEEC
T ss_pred             --CCCEEEEEEEEEC
T ss_conf             --9825705757769



>2por_A (A:) Porin; HET: C8E; 1.80A {Rhodobacter capsulatus} Back     alignment and structure
>2wjr_A (A:) Probable N-acetylneuraminic acid outer membrane channel protein NANC; cell membrane, ION transport, transmembrane, porin, transport; HET: EPE; 1.80A {Escherichia coli} PDB: 2wjq_A* Back     alignment and structure
>1pho_A (A:) Phosphoporin; outer membrane protein; 3.00A {Escherichia coli} Back     alignment and structure
>2f1c_X (X:) OMPG, outer membrane protein G; beta barrel; HET: C8E; 2.30A {Escherichia coli K12} PDB: 2jqy_A 2iwv_A* 2iww_A* Back     alignment and structure
>2hdi_A (A:136-639) Colicin I receptor; outer membrane, iron transport, TONB BOX, signal transduction, colicin I receptor, receptor ligand, membrane protein; HET: LDA; 2.50A {Escherichia coli} PDB: 2hdf_A* Back     alignment and structure