254780313

254780313

ribosomal RNA methyltransferase RrmJ/FtsJ

GeneID in NCBI database:8209297Locus tag:CLIBASIA_00990
Protein GI in NCBI database:254780313Protein Accession:YP_003064726.1
Gene range:-(204153, 204836)Protein Length:227aa
Gene description:ribosomal RNA methyltransferase RrmJ/FtsJ
COG prediction:[J] 23S rRNA methylase
KEGG prediction:ribosomal RNA methyltransferase RrmJ/FtsJ; K02427 ribosomal RNA large subunit methyltransferase E [EC:2.1.1.-]
SEED prediction:Cell division protein FtsJ / Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cell Division
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MVKPPGSSSRRGLTQKVKNRSCQGSSRDWLNRHINDPYVQRAQLEGWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDILDMEPILGVKFFKFDFLDLDSWEFIRQAIGGNPDLVLSDMAYPTIGHRKIDHLRTMSLCEAATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHVKPVASRAESVEMFLLAKGFRK
cccccccccccccEEEEcccccccHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHcccccccEEEEEEccccccccccEEEEEccccHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHccEEEEEccHHHcccccEEEEEEccccc
ccccccccccccEEEEcccccccccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHcccccccEEEEEEcccccccccccEEccccccHHHHHHHHHHHcccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHcccEEEEcccccccccHEEEEEEccccc
mvkppgsssrrgltqkvknrscqgssrdwlnrhindpyvqrAQLEGWRARSAYKLLQINEKHQilqsnrrivdlgsspgswSQVAARItgsnanntrvvaidildmepilgvkffkfdfldldSWEFIRQAiggnpdlvlsdmayptighrkidhlrTMSLCEAATFFALEMLNIGGDFLvktfqggttnDILCLLKKHFQkvihvkpvasrAESVEMFLLAKGFRK
mvkppgsssrrgltqkvknrscqgssrdwlnrhindpYVQRAQLEGWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAAritgsnanntrVVAIDILDMEPILGVKFFKFDFLDLDSWEFIRQAIGGNPDLVLSDMAYPTIGHRKIDHLRTMSLCEAATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHvkpvasraeSVEMFLLAKGFRK
MVKPPGSSSRRGLTQKVKNRSCQGSSRDWLNRHINDPYVQRAQLEGWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDILDMEPILGVkffkfdfldldSWEFIRQAIGGNPDLVLSDMAYPTIGHRKIDHLRTMSLCEAATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHVKPVASRAESVEMFLLAKGFRK
********************************HINDPYVQRAQLEGWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDILDMEPILGVKFFKFDFLDLDSWEFIRQAIGGNPDLVLSDMAYPTIGHRKIDHLRTMSLCEAATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHVKP***RAESVEMFLLAKGFR*
*************************SRDWLNRHINDPYVQRAQLEGWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDILDMEPILGVKFFKFDFLDLDSWEFIRQAIGGNPDLVLSDMAYPTIGHRKIDHLRTMSLCEAATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHVKPVASRAESVEMFLLAKGFRK
*********RRGLTQKVKNRSCQGSSRDWLNRHINDPYVQRAQLEGWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDILDMEPILGVKFFKFDFLDLDSWEFIRQAIGGNPDLVLSDMAYPTIGHRKIDHLRTMSLCEAATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHVKPVASRAESVEMFLLAKGF**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKPPGSSSRRGLTQKVKNRSCQGSSRDWLNRHINDPYVQRAQLEGWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDILDMEPILGVKFFKFDFLDLDSWEFIRQAIGGNPDLVLSDMAYPTIGHRKIDHLRTMSLCEAATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHVKPVASRAESVEMFLLAKGFRK
MVKPPGSSSRRGLTQKVKNRSCQGSSRDWLNRHINDPYVQRAQLEGWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDILDMEPILGVKFFKFDFLDLDSWEFIRQAIGGNPDLVLSDMAYPTIGHRKIDHLRTMSLCEAATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHVKPVASRAESVEMFLLAKGFRK
MVKPPGSSSRRGLTQKVKNRSCQGSSRDWLNRHINDPYVQRAQLEGWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDILDMEPILGVKFFKFDFLDLDSWEFIRQAIGGNPDLVLSDMAYPTIGHRKIDHLRTMSLCEAATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHVKPVASRAESVEMFLLAKGFRK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target227 ribosomal RNA methyltransferase RrmJ/FtsJ [Candidatus L
315122262242 ribosomal RNA methyltransferase RrmJ/FtsJ [Candidatus L 1 1e-112
15964509245 cell division protein [Sinorhizobium meliloti 1021] Len 1 3e-81
227820952245 putative ribosomal RNA large subunit methyltransferase 1 5e-81
150395598245 ribosomal RNA methyltransferase RrmJ/FtsJ [Sinorhizobiu 1 5e-81
222084954239 cell division protein [Agrobacterium radiobacter K84] L 1 3e-80
116250616239 ribosomal RNA methyltransferase/cell division FtsJ prot 1 6e-80
241203222239 ribosomal RNA methyltransferase RrmJ/FtsJ [Rhizobium le 1 7e-80
190890496239 ribosomal RNA methyltransferase/cell division protein [ 1 1e-79
327189976239 ribosomal RNA methyltransferase/cell division protein [ 1 1e-79
209548035239 ribosomal RNA methyltransferase RrmJ/FtsJ [Rhizobium le 1 1e-79
>gi|315122262|ref|YP_004062751.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 242 Back     alignment and organism information
 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/227 (85%), Positives = 210/227 (92%)

Query: 1   MVKPPGSSSRRGLTQKVKNRSCQGSSRDWLNRHINDPYVQRAQLEGWRARSAYKLLQINE 60
           MVK  G SSRRGL QKVKN SCQ SS  WL+RHINDPYVQ+AQLEGWRARSAYKL+QINE
Sbjct: 16  MVKLLGGSSRRGLIQKVKNNSCQESSHRWLSRHINDPYVQQAQLEGWRARSAYKLIQINE 75

Query: 61  KHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDILDMEPILGVKFFKFDFL 120
           KH+IL  +RRIVDLGS+PGSWSQVAAR+T + +N+ R+VAIDILDMEPILGVKFFKFDFL
Sbjct: 76  KHRILHPSRRIVDLGSAPGSWSQVAARMTAAKSNDIRIVAIDILDMEPILGVKFFKFDFL 135

Query: 121 DLDSWEFIRQAIGGNPDLVLSDMAYPTIGHRKIDHLRTMSLCEAATFFALEMLNIGGDFL 180
           DL+SWEFI QAIGGNPDLVLSDMAYPTIGHRK DHLRTMSLCEAATFFALEMLN GGDFL
Sbjct: 136 DLESWEFIHQAIGGNPDLVLSDMAYPTIGHRKTDHLRTMSLCEAATFFALEMLNEGGDFL 195

Query: 181 VKTFQGGTTNDILCLLKKHFQKVIHVKPVASRAESVEMFLLAKGFRK 227
           VKTFQGGTT DILCLLKK+FQKVIH+KP+ASRAESVEMFLLAKGF+K
Sbjct: 196 VKTFQGGTTQDILCLLKKNFQKVIHIKPMASRAESVEMFLLAKGFKK 242


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15964509|ref|NP_384862.1| cell division protein [Sinorhizobium meliloti 1021] Length = 245 Back     alignment and organism information
>gi|227820952|ref|YP_002824922.1| putative ribosomal RNA large subunit methyltransferase J [Sinorhizobium fredii NGR234] Length = 245 Back     alignment and organism information
>gi|150395598|ref|YP_001326065.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Sinorhizobium medicae WSM419] Length = 245 Back     alignment and organism information
>gi|222084954|ref|YP_002543483.1| cell division protein [Agrobacterium radiobacter K84] Length = 239 Back     alignment and organism information
>gi|116250616|ref|YP_766454.1| ribosomal RNA methyltransferase/cell division FtsJ protein [Rhizobium leguminosarum bv. viciae 3841] Length = 239 Back     alignment and organism information
>gi|241203222|ref|YP_002974318.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 239 Back     alignment and organism information
>gi|190890496|ref|YP_001977038.1| ribosomal RNA methyltransferase/cell division protein [Rhizobium etli CIAT 652] Length = 239 Back     alignment and organism information
>gi|327189976|gb|EGE57100.1| ribosomal RNA methyltransferase/cell division protein [Rhizobium etli CNPAF512] Length = 239 Back     alignment and organism information
>gi|209548035|ref|YP_002279952.1| ribosomal RNA methyltransferase RrmJ/FtsJ [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 239 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target227 ribosomal RNA methyltransferase RrmJ/FtsJ [Candidatus L
pfam01728176 pfam01728, FtsJ, FtsJ-like methyltransferase 1e-49
TIGR00438188 TIGR00438, rrmJ, cell division protein FtsJ 9e-45
PRK11188209 PRK11188, rrmJ, 23S rRNA methyltransferase J; Provision 5e-41
KOG1099294 KOG1099, KOG1099, KOG1099, SAM-dependent methyltransfer 1e-36
KOG1098 780 KOG1098, KOG1098, KOG1098, Putative SAM-dependent rRNA 5e-26
COG0293205 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosom 8e-65
KOG4589232 KOG4589, KOG4589, KOG4589, Cell division protein FtsJ [ 8e-48
KOG3674 696 KOG3674, KOG3674, KOG3674, FtsJ-like RNA methyltransfer 2e-05
KOG3673 845 KOG3673, KOG3673, KOG3673, FtsJ-like RNA methyltransfer 6e-04
COG1189245 COG1189, COG1189, Predicted rRNA methylase [Translation 2e-04
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent 7e-04
>gnl|CDD|145073 pfam01728, FtsJ, FtsJ-like methyltransferase Back     alignment and domain information
>gnl|CDD|161879 TIGR00438, rrmJ, cell division protein FtsJ Back     alignment and domain information
>gnl|CDD|183025 PRK11188, rrmJ, 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>gnl|CDD|36315 KOG1099, KOG1099, KOG1099, SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning, General function prediction only] Back     alignment and domain information
>gnl|CDD|36314 KOG1098, KOG1098, KOG1098, Putative SAM-dependent rRNA methyltransferase SPB1 [RNA processing and modification, General function prediction only] Back     alignment and domain information
>gnl|CDD|30641 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|39789 KOG4589, KOG4589, KOG4589, Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|38878 KOG3674, KOG3674, KOG3674, FtsJ-like RNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|38877 KOG3673, KOG3673, KOG3673, FtsJ-like RNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31382 COG1189, COG1189, Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 227 ribosomal RNA methyltransferase RrmJ/FtsJ [Candidatus L
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 100.0
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 100.0
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal structu 100.0
KOG4589232 consensus 100.0
KOG1099294 consensus 100.0
KOG1098 780 consensus 100.0
KOG3673 845 consensus 99.92
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.82
COG2521287 Predicted archaeal methyltransferase [General function 96.79
KOG2361264 consensus 94.37
pfam05148214 Methyltransf_8 Hypothetical methyltransferase. This fam 94.08
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 100.0
KOG3674 696 consensus 99.89
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 99.33
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 99.33
COG1189245 Predicted rRNA methylase [Translation, ribosomal struct 99.32
PRK11760356 putative RNA 2'-O-ribose methyltransferase; Provisional 99.26
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 99.14
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 99.09
TIGR00446284 nop2p NOL1/NOP2/sun family putative RNA methylase; Inte 99.04
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 99.0
pfam05175170 MTS Methyltransferase small domain. This domain is foun 98.84
KOG1122460 consensus 98.73
KOG2198375 consensus 98.64
pfam06460300 NSP13 Coronavirus NSP13. This family covers the NSP13 r 98.52
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 98.49
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 98.28
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.25
KOG1271227 consensus 98.15
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 98.13
pfam01269229 Fibrillarin Fibrillarin. 98.11
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 98.1
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.07
PRK07402196 precorrin-6B methylase; Provisional 98.05
PRK11207198 tellurite resistance protein TehB; Provisional 98.04
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.01
PRK11036256 putative metallothionein SmtA; Provisional 98.01
PRK04266226 fibrillarin; Provisional 97.99
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 97.97
COG4123248 Predicted O-methyltransferase [General function predict 97.94
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 97.9
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 97.87
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 97.86
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 97.85
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 97.8
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 97.8
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 97.76
COG1041347 Predicted DNA modification methylase [DNA replication, 97.75
KOG1540296 consensus 97.68
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 97.66
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 97.66
PRK04457262 spermidine synthase; Provisional 97.64
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 97.58
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 97.57
pfam05401201 NodS Nodulation protein S (NodS). This family consists 97.55
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 97.47
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 97.45
pfam03848192 TehB Tellurite resistance protein TehB. 97.2
pfam06016 1289 Reovirus_L2 Reovirus core-spike protein lambda-2 (L2). 97.13
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, ribo 97.06
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 97.0
PRK00811283 spermidine synthase; Provisional 96.75
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 96.7
COG2520341 Predicted methyltransferase [General function predictio 96.33
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 96.27
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 96.02
KOG2904328 consensus 95.96
pfam08003315 Methyltransf_9 Protein of unknown function (DUF1698). T 95.86
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 95.81
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 95.68
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 95.67
KOG3010261 consensus 95.5
KOG3045325 consensus 95.3
TIGR00740247 TIGR00740 methyltransferase, putative; InterPro: IPR005 95.15
PRK00536262 speE spermidine synthase; Provisional 94.73
KOG4300252 consensus 94.39
pfam00145 319 DNA_methylase C-5 cytosine-specific DNA methylase. 93.95
KOG2360413 consensus 93.49
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylase 93.0
KOG1661237 consensus 92.71
KOG1541270 consensus 92.44
KOG3191209 consensus 91.18
), spermine synthase () and putrescine N-methyltransferase () . The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00417">TIGR00417284 speE spermidine synthase; InterPro: IPR001045 Synonym(s 90.77
pfam05724203 TPMT Thiopurine S-methyltransferase (TPMT). This family 90.75
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 99.19
PRK10901428 16S rRNA methyltransferase B; Provisional 99.19
PRK08317241 hypothetical protein; Provisional 99.14
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 98.98
TIGR00563487 rsmB ribosomal RNA small subunit methyltransferase B; I 98.93
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 98.78
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 98.78
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 98.72
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 98.68
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 98.64
COG1092393 Predicted SAM-dependent methyltransferases [General fun 98.52
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 98.38
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 98.32
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 98.16
KOG1975 389 consensus 98.08
COG4106257 Tam Trans-aconitate methyltransferase [General function 98.02
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 98.01
PTZ00146296 fibrillarin; Provisional 97.99
KOG1596317 consensus 97.88
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 97.83
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 97.75
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 97.74
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 97.63
pfam04989202 CmcI Cephalosporin hydroxylase. Members of this family 97.6
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 97.59
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 97.41
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 97.29
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 97.27
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 97.15
KOG1499 346 consensus 97.08
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 97.02
PRK06922679 hypothetical protein; Provisional 97.0
pfam00891239 Methyltransf_2 O-methyltransferase. This family include 96.99
PRK12335289 tellurite resistance protein TehB; Provisional 96.98
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 96.98
KOG1270282 consensus 96.91
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 96.8
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 96.71
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 96.6
KOG1500 517 consensus 96.59
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 96.37
KOG3420185 consensus 96.32
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 96.07
COG4122219 Predicted O-methyltransferase [General function predict 96.05
pfam10294171 Methyltransf_16 Putative methyltransferase. 95.91
COG3510237 CmcI Cephalosporin hydroxylase [Defense mechanisms] 95.88
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 95.81
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 95.81
smart00650169 rADc Ribosomal RNA adenine dimethylases. 95.76
KOG2940 325 consensus 95.65
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 95.36
PHA02056279 putative methyltransferase 95.11
KOG1663237 consensus 95.01
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 94.95
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 94.73
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 94.55
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 94.48
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 94.43
pfam03686127 UPF0146 Uncharacterized protein family (UPF0146). The f 94.36
KOG0024354 consensus 94.12
COG1255129 Uncharacterized protein conserved in archaea [Function 94.02
KOG2671421 consensus 93.84
pfam05206256 TRM13 Methyltransferase TRM13. This is a family of euka 93.64
PRK09422338 alcohol dehydrogenase; Provisional 92.27
PRK10083339 putative dehydrogenase; Provisional 92.11
PRK04148135 hypothetical protein; Provisional 92.1
PRK10611287 chemotaxis methyltransferase CheR; Provisional 91.52
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 91.32
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 90.74
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 90.24
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 90.16
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 90.03
TIGR00478240 tly hemolysin A; InterPro: IPR004538 Hemolysins are exo 98.86
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 98.5
COG2933358 Predicted SAM-dependent methyltransferase [General func 98.44
pfam01795 310 Methyltransf_5 MraW methylase family. Members of this f 97.45
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 97.31
PRK00050 309 mraW S-adenosyl-methyltransferase MraW; Provisional 97.13
COG0275 314 Predicted S-adenosylmethionine-dependent methyltransfer 97.12
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 97.01
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 96.42
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 96.05
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 96.01
KOG0820315 consensus 96.01
TIGR00006 323 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: 96.0
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 95.85
KOG2915314 consensus 95.75
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 95.45
KOG2187534 consensus 94.57
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 91.3
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 98.73
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 98.52
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 98.13
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 97.7
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 97.57
COG4076252 Predicted RNA methylase [General function prediction on 95.28
pfam05185 447 PRMT5 PRMT5 arginine-N-methyltransferase. The human hom 92.41
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 97.66
PRK06202233 hypothetical protein; Provisional 97.1
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 96.81
PRK05785225 hypothetical protein; Provisional 95.87
PTZ00338 296 dimethyladenosine transferase; Provisional 95.69
TIGR00182344 plsX fatty acid/phospholipid synthesis protein PlsX; In 91.05
TIGR01181 340 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: 90.96
KOG2899288 consensus 96.26
pfam01234261 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family. 95.12
COG4798238 Predicted methyltransferase [General function predictio 92.34
pfam06962140 rRNA_methylase Putative rRNA methylase. This family con 92.75
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2 Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4589 consensus Back     alignment and domain information
>KOG1099 consensus Back     alignment and domain information
>KOG1098 consensus Back     alignment and domain information
>KOG3673 consensus Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>pfam05148 Methyltransf_8 Hypothetical methyltransferase Back     alignment and domain information
>pfam01728 FtsJ FtsJ-like methyltransferase Back     alignment and domain information
>KOG3674 consensus Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11760 putative RNA 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase; InterPro: IPR011023 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>KOG1122 consensus Back     alignment and domain information
>KOG2198 consensus Back     alignment and domain information
>pfam06460 NSP13 Coronavirus NSP13 Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>pfam01269 Fibrillarin Fibrillarin Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>pfam05401 NodS Nodulation protein S (NodS) Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>pfam06016 Reovirus_L2 Reovirus core-spike protein lambda-2 (L2) Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3010 consensus Back     alignment and domain information
>KOG3045 consensus Back     alignment and domain information
>TIGR00740 TIGR00740 methyltransferase, putative; InterPro: IPR005271 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>pfam00145 DNA_methylase C-5 cytosine-specific DNA methylase Back     alignment and domain information
>KOG2360 consensus Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>KOG1661 consensus Back     alignment and domain information
>KOG1541 consensus Back     alignment and domain information
>KOG3191 consensus Back     alignment and domain information
>TIGR00417 speE spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (Back     alignment and domain information
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT) Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase B; InterPro: IPR004573 This family consists of bacterial sequences related to Escherichia coli rsmB, an rRNA SAM-dependent methyltransferase Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>KOG1975 consensus Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>KOG1596 consensus Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>pfam04989 CmcI Cephalosporin hydroxylase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1499 consensus Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>pfam00891 Methyltransf_2 O-methyltransferase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1500 consensus Back     alignment and domain information
>pfam08123 DOT1 Histone methylation protein DOT1 Back     alignment and domain information
>KOG3420 consensus Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK00274 ksgA dimethyladenosine transferase; Reviewed Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>KOG2940 consensus Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>PHA02056 putative methyltransferase Back     alignment and domain information
>KOG1663 consensus Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>pfam03686 UPF0146 Uncharacterized protein family (UPF0146) Back     alignment and domain information
>KOG0024 consensus Back     alignment and domain information
>COG1255 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>KOG2671 consensus Back     alignment and domain information
>pfam05206 TRM13 Methyltransferase TRM13 Back     alignment and domain information
>PRK09422 alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK10083 putative dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR00478 tly hemolysin A; InterPro: IPR004538 Hemolysins are exotoxins that attack blood cell membranes and cause cell rupture Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>pfam01795 Methyltransf_5 MraW methylase family Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>PRK00050 mraW S-adenosyl-methyltransferase MraW; Provisional Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>KOG0820 consensus Back     alignment and domain information
>TIGR00006 TIGR00006 S-adenosyl-methyltransferase MraW; InterPro: IPR002903 This is a family of methyltransferases Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2915 consensus Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>KOG2187 consensus Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>pfam05185 PRMT5 PRMT5 arginine-N-methyltransferase Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>TIGR00182 plsX fatty acid/phospholipid synthesis protein PlsX; InterPro: IPR003664 The plsX gene is part of the bacterial fab gene cluster which encodes several key fatty acid biosynthetic enzymes Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: IPR005888 The conversion of dTDP-glucose into dTDP-4-keto-6-deoxyglucose by Escherichia coli dTDP-glucose 4,6-dehydratase) takes place in the active site in three steps: dehydrogenation to dTDP-4-ketoglucose, dehydration to dTDP-4-ketoglucose-5,6-ene, and rereduction of C6 to the methyl group Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>pfam01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>pfam06962 rRNA_methylase Putative rRNA methylase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target227 ribosomal RNA methyltransferase RrmJ/FtsJ [Candidatus L
1eiz_A180 Ftsj Rna Methyltransferase Complexed With S- Adenos 2e-37
2nyu_A196 Crystal Structure Of Human Ftsj Homolog 2 (E.Coli) 6e-30
2plw_A201 Crystal Structure Of A Ribosomal Rna Methyltransfer 2e-28
3dou_A191 Crystal Structure Of Methyltransferase Involved In 4e-23
>gi|10120640|pdb|1EIZ|A Chain A, Ftsj Rna Methyltransferase Complexed With S- Adenosylmethionine Length = 180 Back     alignment and structure
 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 63/182 (34%), Positives = 100/182 (54%), Gaps = 4/182 (2%)

Query: 46  GWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDILD 105
           G R+R+ +KL +I +  ++ +    +VDLG++PG WSQ      G      R++A D+L 
Sbjct: 1   GLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQIGGK---GRIIACDLLP 57

Query: 106 MEPILGVKFFKFDFLDLDSWEFIRQAI-GGNPDLVLSDMAYPTIGHRKIDHLRTMSLCEA 164
           M+PI+GV F + DF D    + + + +      +V+SDMA    G   +D  R M L E 
Sbjct: 58  MDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVEL 117

Query: 165 ATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHVKPVASRAESVEMFLLAKG 224
           A     ++L  GG F+VK FQG   ++ L  ++  F KV   KP +SRA S E++++A G
Sbjct: 118 ALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVATG 177

Query: 225 FR 226
            +
Sbjct: 178 RK 179


>gi|119390695|pdb|2NYU|A Chain A, Crystal Structure Of Human Ftsj Homolog 2 (E.Coli) Protein In Complex With S-Adenosylmethionine Length = 196 Back     alignment and structure
>gi|149243225|pdb|2PLW|A Chain A, Crystal Structure Of A Ribosomal Rna Methyltransferase, Putative, From Plasmodium Falciparum (Pf13_0052) Length = 201 Back     alignment and structure
>gi|197725282|pdb|3DOU|A Chain A, Crystal Structure Of Methyltransferase Involved In Cell Division From Thermoplasma Volcanicum Gss1 Length = 191 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target227 ribosomal RNA methyltransferase RrmJ/FtsJ [Candidatus L
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methionine, h 5e-54
3dou_A191 Ribosomal RNA large subunit methyltransferase J; cell d 3e-40
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria, SAM 1e-39
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, struct 3e-38
3lkz_A321 Non-structural protein 5; flavivirus, methyltransferase 2e-20
3opn_A232 Putative hemolysin; structural genomics, PSI-2, protein 8e-11
3lpm_A259 Putative methyltransferase; structural genomics, protei 0.002
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanylyltra 1e-40
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransferase, 1e-36
2p41_A305 Type II methyltransferase; vizier, viral enzymes involv 2e-32
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransferase 2e-29
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, viral en 4e-28
2px2_A269 Genome polyprotein [contains: capsid protein C (core pr 1e-23
3hp7_A291 Hemolysin, putative; structural genomics, APC64019, PSI 1e-04
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F21; 2 0.002
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Length = 180 Back     alignment and structure
 Score =  206 bits (524), Expect = 5e-54
 Identities = 64/182 (35%), Positives = 102/182 (56%), Gaps = 4/182 (2%)

Query: 46  GWRARSAYKLLQINEKHQILQSNRRIVDLGSSPGSWSQVAARITGSNANNTRVVAIDILD 105
           G R+R+ +KL +I +  ++ +    +VDLG++PG WSQ      G      R++A D+L 
Sbjct: 1   GLRSRAWFKLDEIQQSDKLFKPGMTVVDLGAAPGGWSQYVVTQIG---GKGRIIACDLLP 57

Query: 106 MEPILGVKFFKFDFLDLDSWEFIRQAIGGNP-DLVLSDMAYPTIGHRKIDHLRTMSLCEA 164
           M+PI+GV F + DF D    + + + +G +   +V+SDMA    G   +D  R M L E 
Sbjct: 58  MDPIVGVDFLQGDFRDELVMKALLERVGDSKVQVVMSDMAPNMSGTPAVDIPRAMYLVEL 117

Query: 165 ATFFALEMLNIGGDFLVKTFQGGTTNDILCLLKKHFQKVIHVKPVASRAESVEMFLLAKG 224
           A     ++L  GG F+VK FQG   ++ L  ++  F KV   KP +SRA S E++++A G
Sbjct: 118 ALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRSLFTKVKVRKPDSSRARSREVYIVATG 177

Query: 225 FR 226
            +
Sbjct: 178 RK 179


>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} Length = 191 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum 3D7} Length = 201 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Length = 196 Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Length = 321 Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Length = 232 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransferase, viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Length = 300 Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, ATP-binding, capsid protein, cleavage on PAIR of basic residues; HET: GTA SAH; 1.45A {Yellow fever virus 17D} PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Length = 277 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* 3evg_A* Length = 305 Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme structure, ATP-binding, nucleotide-binding; HET: SAM; 1.70A {Yokose virus} Length = 282 Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Length = 265 Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Length = 269 Back     alignment and structure