254780316

254780316

phenylalanyl-tRNA synthetase subunit beta

GeneID in NCBI database:8209301Locus tag:CLIBASIA_01005
Protein GI in NCBI database:254780316Protein Accession:YP_003064729.1
Gene range:-(207009, 209426)Protein Length:805aa
Gene description:phenylalanyl-tRNA synthetase subunit beta
COG prediction:[R] EMAP domain
KEGG prediction:pheT; phenylalanyl-tRNA synthetase subunit beta (EC:6.1.1.20); K01890 phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
SEED prediction:Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Phe
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-----
MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNREALSPFTIVKVLSVERNPDLDCAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMMCSEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIDVSLTPNRSDCIGVRGIALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNWMRQRLKAVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVLTVRRACSGEKILALDNQEYDLSPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGIITDSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITYKPRKIVFMNSEVKRLSGIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQIKSEPLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQRELEILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTPEGQKYMAAGIRKGSSGIEGSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHPGRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPISQKKRTKTKKVVHLSSLHPVKRDLAFIVDQHIPAGTLVNIIKNVDRLIDDVTVFDVFQGKSLGEGKKSVAIQVLIQPLKDTFRDDDIRILMDRIVENVVKKTNAVLRSS
ccccHHHHHHHccccccHHHHHHHHHHccccccccccccccccEEEEEEEEEEEccccccEEEEEEcccccEEEEEEcccccccccEEEEEccccEEccccEEEEEEEEEccccccEEccHHHcccccccccEEEcccccccccHHHHHcccccEEEEEEccccHHHHHccHHHHHHHHHHHccccccccccccccccccccEEEEEEEccccccEEEEEEEEcccccccHHHHHHHHHHccccccccccHHHHHHHHHcccccccccHHHccccEEEEEcccccEEEEEcccEEccccccEEEEcccEEEEEccccccccccccccccEEEEEEEcccHHHHHHHHHHcccccHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccEEEEEHHHHHHHHcccccHHHHHHHHHHcccEEEEcccEEEEEcccccccccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHcccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEcccccccccccccEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEEEccEEEEEEEEEEcHHHHHHccccccEEEEEEEHHHHHHHHcccccccccccccccccccccEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEEcccccccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcEEEEcc
ccccHHHHHHHccccccHHHHHHHHHHcccEEcccccccccccEEEEEEEEcccccccccEEEEEEccccccEEEEccccccccccEEEEEccccEcccccEEEEEEEEccccccccEEEHHHcccccccccEEEcccccccccHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHHHHccccccccccccccEEccccccEEEEcccccccEEEEEEEEccccccccHHHHHHHHHcccccccHHHHHHHHHHHHcccccEEEEHHHcEcEEEEEEcccccEEEEccccEEEcccccEEEEEEEccEEEcccEEEcccEccccccEEEEEEEEccHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHHHHHHcccEEEcccEEEccccccccEEEcHHHHHHHHcccccHHHHHHHHHHcccEEEcccccEEEEccccccccccHHHHHHHHHHHHcHHHcccccccccccHHHccccHHHHHHHHHHHHHHHHccEEcccccEEcccHHHHccccccccEEcccccccccEEccccHHHHHHHHHHHHHHccccEEEEEEccEEcccccccHHHHHccEEcccccHHccccHHHHHHccccccccEEccHHHHHHHHHHHcccccEEEEccccccccccccEEEEEcccEEEEEEccccHHHHHHccccccEEEEEEEHHHHHHccccccccccccHccccccccccEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEEcccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHccEEEcc
MKFTLSWlkdhldtdVSLEKICDTLTSIGlevekvdnrealspFTIVKVLSvernpdldcailridtgkhqeiQVVCGAPNVRVGLlgvwappgscipennmivNVRKIRGIestgmmcsekelmlsddsasimelpidapvggrlsdylelsdpiidvsltpnrsdcigvRGIALDLVAAGLGKLkeiniscplssesipleikfdlddsslckgFAMCCVKgvrnnvapnWMRQRLKAVGLRSISALVDITnyvsldrgypshvfdasrisdVLTVRRACsgekilaldnqeydlspdnvviasdgriQSIAGiiggkhagcddntTDVLVEVALWdpiniarsgknlgiitdsryrfergvdlqgMIPVLKHIVSLILSLcggtasdiciarnitykprkivFMNSEvkrlsgidvpiedSLRILERLGfsvigeydkfevsvpswrqDVEEKADLVEEILRIYGvdqikseplpltqvedkrnlslqqSRTRYVKRVLASRAMMEVVNWSFISKEqsvlfgggqreleiLNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHvyendtpegQKYMAAGirkgssgiegsgrlwsdkseercrfvdlfdakadalsviepfvsldslrfesgapswyhpgrsgiikTSAEIVLGyfgefhpnildffglsnpicgfevyldsipisqkkrtktkkvvhlsslhpvkrdLAFIVdqhipagtlVNIIKNVDrliddvtvfdvfqgkslgegkkSVAIQVLIQplkdtfrddDIRILMDRIVENVVKKTNAVLRSS
mkftlswlkdhldtdvSLEKICDTLTSIglevekvdnrealsPFTIVkvlsvernpDLDCAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPpgscipennmivNVRKIRGIESTGMMCSEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIdvsltpnrsdcIGVRGIALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNWMRQRLKAVGLRSISALVDITNYVSLDRGYPshvfdasrisdvLTVRRACSGEKilaldnqeydlSPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWdpiniarsgknlgiitdSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITYKPRKIVFmnsevkrlsgidvpiedslRILERLGFSVIGEYDKFevsvpswrqdvEEKADLVEEILRIygvdqikseplpltqvedkrnlslqqsrtrYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQRELEILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTPEGQKYMAAGirkgssgiegsgrlwsdkSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHPGRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPisqkkrtktkkvvhlsslhpvkrDLAFIVDQHIPAGTLVNIIKNVDRLIDDVTVFDVFQgkslgegkksvaiQVLIqplkdtfrdddIRILMDRIvenvvkktnavlrss
MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNREALSPFTIVKVLSVERNPDLDCAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMMCSEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIDVSLTPNRSDCIGVRGIALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNWMRQRLKAVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVLTVRRACSGEKILALDNQEYDLSPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGIITDSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITYKPRKIVFMNSEVKRLSGIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQIKSEPLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQRELEILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTPEGQKYMAAGIRKGSSGIEGSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHPGRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPISQKKRTKTKKVVHLSSLHPVKRDLAFIVDQHIPAGTLVNIIKNVDRLIDDVTVFDVFQGKSLGEGKKSVAIQVLIQPLKDTFrdddirilmdriVENVVKKTNAVLRSS
MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNREALSPFTIVKVLSVERNPDLDCAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMMCSEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIDVSLTPNRSDCIGVRGIALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNWMRQRLKAVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVLTVRRACSGEKILALDNQEYDLSPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGIITDSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITYKPRKIVFMNSEVKRLSGIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQIKSE******************RTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQRELEILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTP*GQKYMAAGIRKGSSGIEGSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHPGRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPISQK**********LSSLHPVKRDLAFIVDQHIPAGTLVNIIKNVDRLIDDVTVFDVFQGKSLGEGKKSVAIQVLIQPLKDTFRDDDIRILMDRIVENVVKKTNAVLRS*
MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNREALSPFTIVKVLSVERNPDLDCAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMMCSEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIDVSLTPNRSDCIGVRGIALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNWMRQRLKAVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVLTVRRACSGEKILALDNQEYDLSPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGIITDSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITYKPRKIVFMNSEVKRLSGIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQIKSEPLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQRELEILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTPEGQKYMAAGIRKGSSGIEGSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHPGRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPIS***********HLSSLHPVKRDLAFIVDQHIPAGTLVNIIKNVDRLIDDVTVFDVFQGKSLGEGKKSVAIQVLIQPLKDTFRDDDIRILMDRIVENVVKKTNAVLRSS
*KFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNREALSPFTIVKVLSVERNPDLDCAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMMCSEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIDVSLTPNRSDCIGVRGIALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNWMRQRLKAVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVLTVRRACSGEKILALDNQEYDLSPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGIITDSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITYKPRKIVFMNSEVKRLSGIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQIKSEPLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQRELEILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTPEGQKYMAAGIRKGSSGIEGSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHPGRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPISQKKRTKTKKVVHLSSLHPVKRDLAFIVDQHIPAGTLVNIIKNVDRLIDDVTVFDVFQGKSLGEGKKSVAIQVLIQPLKDTFRDDDIRILMDRIVENVVKKTNAVLR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNREALSPFTIVKVLSVERNPDLDCAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMMCSEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIDVSLTPNRSDCIGVRGIALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNWMRQRLKAVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVLTVRRACSGEKILALDNQEYDLSPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGIITDSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITYKPRKIVFMNSEVKRLSGIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQIKSEPLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQRELEILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTPEGQKYMAAGIRKGSSGIEGSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHPGRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPISQKKRTKTKKVVHLSSLHPVKRDLAFIVDQHIPAGTLVNIIKNVDRLIDDVTVFDVFQGKSLGEGKKSVAIQVLIQPLKDTFRDDDIRILMDRIVENVVKKTNAVLRSS
MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNREALSPFTIVKVLSVERNPDLDCAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMMCSEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIDVSLTPNRSDCIGVRGIALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNWMRQRLKAVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVLTVRRACSGEKILALDNQEYDLSPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGIITDSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITYKPRKIVFMNSEVKRLSGIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQIKSEPLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQRELEILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTPEGQKYMAAGIRKGSSGIEGSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHPGRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPISQKKRTKTKKVVHLSSLHPVKRDLAFIVDQHIPAGTLVNIIKNVDRLIDDVTVFDVFQGKSLGEGKKSVAIQVLIQPLKDTFRDDDIRILMDRIVENVVKKTNAVLRSS
MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNREALSPFTIVKVLSVERNPDLDCAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMMCSEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIDVSLTPNRSDCIGVRGIALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNWMRQRLKAVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVLTVRRACSGEKILALDNQEYDLSPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGIITDSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITYKPRKIVFMNSEVKRLSGIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQIKSEPLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQRELEILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTPEGQKYMAAGIRKGSSGIEGSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHPGRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPISQKKRTKTKKVVHLSSLHPVKRDLAFIVDQHIPAGTLVNIIKNVDRLIDDVTVFDVFQGKSLGEGKKSVAIQVLIQPLKDTFRDDDIRILMDRIVENVVKKTNAVLRSS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target805 phenylalanyl-tRNA synthetase subunit beta [Candidatus L
315122260807 phenylalanyl-tRNA synthetase subunit beta [Candidatus L 1 0.0
227824129808 phenylalanyl-tRNA synthetase subunit beta [Sinorhizobiu 1 0.0
307301185808 phenylalanyl-tRNA synthetase, beta subunit [Sinorhizobi 1 0.0
222084533807 phenylalanyl-tRNA synthetase [Agrobacterium radiobacter 1 0.0
15964039808 phenylalanyl-tRNA synthetase subunit beta [Sinorhizobiu 1 0.0
150398673808 phenylalanyl-tRNA synthetase subunit beta [Sinorhizobiu 1 0.0
15887609807 phenylalanyl-tRNA synthetase subunit beta [Agrobacteriu 1 0.0
241207217807 phenylalanyl-tRNA synthetase subunit beta [Rhizobium le 1 0.0
209551839810 phenylalanyl-tRNA synthetase subunit beta [Rhizobium le 1 0.0
222147174807 phenylalanyl-tRNA synthetase subunit beta [Agrobacteriu 1 0.0
>gi|315122260|ref|YP_004062749.1| phenylalanyl-tRNA synthetase subunit beta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 807 Back     alignment and organism information
 Score = 1211 bits (3134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/807 (72%), Positives = 693/807 (85%), Gaps = 2/807 (0%)

Query: 1   MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNREALSPFTIVKVLSVERNPD-LD 59
           MKFTLSWLKDHLDTD SL +ICD LTSIGLEVE VD R++L+PF IV++LSV+R+ +  +
Sbjct: 1   MKFTLSWLKDHLDTDASLGEICDNLTSIGLEVEGVDTRDSLAPFRIVEILSVQRHSNSQN 60

Query: 60  CAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMMC 119
            ++L+ID G+ + +QVVCGAPNVRVGLLG+WAPPGSCIPEN+M +NVRKIRGIES GMMC
Sbjct: 61  LSVLQIDVGEQKTVQVVCGAPNVRVGLLGIWAPPGSCIPENHMTINVRKIRGIESMGMMC 120

Query: 120 SEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIDVSLTPNRSDCIGVRGIALDLV 179
           SEKELMLSD    I+ELPIDAPVGGR SDY  LSDPIID++LTPNRSDC GVRGIALDLV
Sbjct: 121 SEKELMLSDSCVGIIELPIDAPVGGRFSDYFGLSDPIIDIALTPNRSDCSGVRGIALDLV 180

Query: 180 AAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNWMRQRLK 239
           AAGLGKLKEI+     SS SIP+EI+FDLDD+ LCKGFAMCCV+GVRN  +P WMRQRL+
Sbjct: 181 AAGLGKLKEIDAPVFSSSGSIPVEIQFDLDDARLCKGFAMCCVRGVRNTSSPKWMRQRLE 240

Query: 240 AVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVLTVRRACSGEKILALDNQEYDLSP 299
           AVGLR ISALVDITNY+++DRGYPSHVFD+S+IS  +T+RRA SGEK +AL+++EY+LSP
Sbjct: 241 AVGLRPISALVDITNYIAIDRGYPSHVFDSSKISGDITIRRARSGEKFIALNDKEYELSP 300

Query: 300 DNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGIITDSRYR 359
           DNVV+ASD  I+SIAGIIGGK+A CDD+TTDVLVEVALWD +NIA SG  LGI TDSRYR
Sbjct: 301 DNVVVASDNCIESIAGIIGGKNACCDDDTTDVLVEVALWDSLNIAHSGHVLGISTDSRYR 360

Query: 360 FERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITYKPRKIVFMNSEVKRLSGIDV 419
           FERGVDLQGM+P+LK+ VSLILSLCGG ASDI + ++  YKPR I F+NSEVKRL+GI+V
Sbjct: 361 FERGVDLQGMLPILKYEVSLILSLCGGMASDIFVGKHEIYKPRTIEFINSEVKRLAGIEV 420

Query: 420 PIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQIKSEPLPL 479
           P+++SL IL  LGF VI +   + VSVPSWRQDVEEKADLVEEILRIYGVD+IK EPL L
Sbjct: 421 PLKESLCILRNLGFDVIEKKGVWTVSVPSWRQDVEEKADLVEEILRIYGVDKIKGEPLSL 480

Query: 480 TQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQRELEILNPISA 539
           T +  KRNLSLQQSR RY KRVLASR+MME++ WSFI K+QSVLFGGGQ ELE+LNPIS 
Sbjct: 481 THLGKKRNLSLQQSRIRYSKRVLASRSMMELITWSFIPKKQSVLFGGGQPELELLNPISV 540

Query: 540 DMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTPEGQKYMAAGIRKGSSGIE 599
           +MSNMRTSLLPGLLKA  R++DRAI D AIFEVSHVYEND PEGQK MA+GIRKGSS +E
Sbjct: 541 EMSNMRTSLLPGLLKAVSRSIDRAIMDLAIFEVSHVYENDRPEGQKCMASGIRKGSSCME 600

Query: 600 GSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHPGRSGIIKTS 659
           GSGR WS++S ++CRFVD+FDAKADAL+VIE FVS+DSL+ ESGAPSWYHP RSG IK +
Sbjct: 601 GSGRFWSEQSVKKCRFVDVFDAKADALAVIEAFVSIDSLQIESGAPSWYHPKRSGTIKVN 660

Query: 660 AEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPISQKKRTKTKKVVHLSSLHPVKRD 719
             +VLGYFGEFHP ILDFFGLSNPIC FEVYLD IPI + K   +KK+++L S HP++RD
Sbjct: 661 NNVVLGYFGEFHPEILDFFGLSNPICCFEVYLDYIPIPKNKPIASKKIINLPSFHPIRRD 720

Query: 720 LAFIVDQHIPAGTLVNIIKNVDR-LIDDVTVFDVFQGKSLGEGKKSVAIQVLIQPLKDTF 778
            AFI+D+ +P  TL+NI++ +DR LI DV VFDVF+GKSLGE KKS+A++VLIQPLK+ F
Sbjct: 721 FAFIIDKTVPTATLINIVRRIDRQLIVDVRVFDVFEGKSLGEDKKSIALEVLIQPLKEAF 780

Query: 779 RDDDIRILMDRIVENVVKKTNAVLRSS 805
            D+D+R L +RI+ENV KK+NAVLRSS
Sbjct: 781 CDEDVRALTERIIENVTKKSNAVLRSS 807


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227824129|ref|YP_002828102.1| phenylalanyl-tRNA synthetase subunit beta [Sinorhizobium fredii NGR234] Length = 808 Back     alignment and organism information
>gi|307301185|ref|ZP_07580947.1| phenylalanyl-tRNA synthetase, beta subunit [Sinorhizobium meliloti BL225C] Length = 808 Back     alignment and organism information
>gi|222084533|ref|YP_002543062.1| phenylalanyl-tRNA synthetase [Agrobacterium radiobacter K84] Length = 807 Back     alignment and organism information
>gi|15964039|ref|NP_384392.1| phenylalanyl-tRNA synthetase subunit beta [Sinorhizobium meliloti 1021] Length = 808 Back     alignment and organism information
>gi|150398673|ref|YP_001329140.1| phenylalanyl-tRNA synthetase subunit beta [Sinorhizobium medicae WSM419] Length = 808 Back     alignment and organism information
>gi|15887609|ref|NP_353290.1| phenylalanyl-tRNA synthetase subunit beta [Agrobacterium tumefaciens str. C58] Length = 807 Back     alignment and organism information
>gi|241207217|ref|YP_002978313.1| phenylalanyl-tRNA synthetase subunit beta [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 807 Back     alignment and organism information
>gi|209551839|ref|YP_002283756.1| phenylalanyl-tRNA synthetase subunit beta [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 810 Back     alignment and organism information
>gi|222147174|ref|YP_002548131.1| phenylalanyl-tRNA synthetase subunit beta [Agrobacterium vitis S4] Length = 807 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target805 phenylalanyl-tRNA synthetase subunit beta [Candidatus L
PRK00629791 PRK00629, pheT, phenylalanyl-tRNA synthetase subunit be 0.0
TIGR00472798 TIGR00472, pheT_bact, phenylalanyl-tRNA synthetase, bet 0.0
CHL00192704 CHL00192, syfB, phenylalanyl-tRNA synthetase beta chain 8e-66
COG0072650 COG0072, PheT, Phenylalanyl-tRNA synthetase beta subuni 1e-157
pfam03483174 pfam03483, B3_4, B3/4 domain 3e-54
smart00873174 smart00873, B3_4, B3/4 domain 2e-44
cd00769198 cd00769, PheRS_beta_core, Phenylalanyl-tRNA synthetase 7e-39
PRK09616552 PRK09616, pheT, phenylalanyl-tRNA synthetase subunit be 6e-31
KOG2472578 KOG2472, KOG2472, KOG2472, Phenylalanyl-tRNA synthetase 2e-16
cd02796103 cd02796, tRNA_bind_bactPheRS, tRNA-binding-domain-conta 4e-25
COG0073123 COG0073, ARC1, EMAP domain [General function prediction 3e-17
cd0215399 cd02153, tRNA_bindingDomain, The tRNA binding domain is 3e-14
pfam0158894 pfam01588, tRNA_bind, Putative tRNA binding domain 1e-09
pfam0314794 pfam03147, FDX-ACB, Ferredoxin-fold anticodon binding d 3e-22
TIGR00471551 TIGR00471, pheT_arch, phenylalanyl-tRNA synthetase, bet 3e-17
smart0087471 smart00874, B5, tRNA synthetase B5 domain 1e-16
pfam0348469 pfam03484, B5, tRNA synthetase B5 domain 9e-16
PLN02265597 PLN02265, PLN02265, probable phenylalanyl-tRNA syntheta 2e-13
>gnl|CDD|179078 PRK00629, pheT, phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|161895 TIGR00472, pheT_bact, phenylalanyl-tRNA synthetase, beta subunit, non-spirochete bacterial Back     alignment and domain information
>gnl|CDD|177091 CHL00192, syfB, phenylalanyl-tRNA synthetase beta chain; Provisional Back     alignment and domain information
>gnl|CDD|30421 COG0072, PheT, Phenylalanyl-tRNA synthetase beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|146236 pfam03483, B3_4, B3/4 domain Back     alignment and domain information
>gnl|CDD|129106 smart00873, B3_4, B3/4 domain Back     alignment and domain information
>gnl|CDD|29814 cd00769, PheRS_beta_core, Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain Back     alignment and domain information
>gnl|CDD|181993 PRK09616, pheT, phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|37683 KOG2472, KOG2472, KOG2472, Phenylalanyl-tRNA synthetase beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|48399 cd02796, tRNA_bind_bactPheRS, tRNA-binding-domain-containing prokaryotic phenylalanly tRNA synthetase (PheRS) beta chain Back     alignment and domain information
>gnl|CDD|30422 COG0073, ARC1, EMAP domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|48398 cd02153, tRNA_bindingDomain, The tRNA binding domain is also known as the Myf domain in literature Back     alignment and domain information
>gnl|CDD|110582 pfam01588, tRNA_bind, Putative tRNA binding domain Back     alignment and domain information
>gnl|CDD|145994 pfam03147, FDX-ACB, Ferredoxin-fold anticodon binding domain Back     alignment and domain information
>gnl|CDD|161894 TIGR00471, pheT_arch, phenylalanyl-tRNA synthetase, beta subunit Back     alignment and domain information
>gnl|CDD|129107 smart00874, B5, tRNA synthetase B5 domain Back     alignment and domain information
>gnl|CDD|146237 pfam03484, B5, tRNA synthetase B5 domain Back     alignment and domain information
>gnl|CDD|177906 PLN02265, PLN02265, probable phenylalanyl-tRNA synthetase beta chain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 805 phenylalanyl-tRNA synthetase subunit beta [Candidatus L
PRK00629786 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewe 100.0
TIGR00472848 pheT_bact phenylalanyl-tRNA synthetase, beta subunit; I 100.0
CHL00192702 syfB phenylalanyl-tRNA synthetase beta chain; Provision 100.0
COG0072650 PheT Phenylalanyl-tRNA synthetase beta subunit [Transla 100.0
PRK09616546 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewe 100.0
TIGR00471605 pheT_arch phenylalanyl-tRNA synthetase, beta subunit; I 100.0
KOG2472578 consensus 100.0
pfam03483174 B3_4 B3/4 domain. This domain is found in tRNA syntheta 100.0
smart00873174 B3_4 B3/4 domain. This domain is found in tRNA syntheta 100.0
COG3382229 Solo B3/4 domain (OB-fold DNA/RNA-binding) of Phe-aaRS- 99.33
cd00769198 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) be 100.0
PRK04172501 pheS phenylalanyl-tRNA synthetase subunit alpha; Provis 99.06
pfam01409243 tRNA-synt_2d tRNA synthetases class II core domain (F). 99.02
PTZ00326505 phenylalanyl-tRNA synthetase; Provisional 98.95
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [Transl 98.78
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) a 98.63
PRK00488338 pheS phenylalanyl-tRNA synthetase subunit alpha; Valida 98.35
PRK09537420 pylS pyrolysyl-tRNA synthetase; Reviewed 97.7
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 97.49
TIGR02367453 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 Py 97.27
cd02796103 tRNA_bind_bactPheRS tRNA-binding-domain-containing prok 99.98
COG0073123 ARC1 EMAP domain [General function prediction only] 99.95
cd0215399 tRNA_bindingDomain The tRNA binding domain is also know 99.91
pfam0158894 tRNA_bind Putative tRNA binding domain. This domain is 99.84
cd02799105 tRNA_bind_EMAP-II_like tRNA-binding-domain-containing E 99.68
cd02800105 tRNA_bind_EcMetRS_like tRNA-binding-domain-containing E 99.39
cd02798107 tRNA_bind_CsaA tRNA-binding-domain-containing CsaA-like 99.21
PRK10089110 hypothetical protein; Provisional 99.21
COG2517219 Predicted RNA-binding protein containing a C-terminal E 98.98
KOG2241255 consensus 98.79
TIGR00399149 metG_C_term methionyl-tRNA synthetase, beta subunit; In 98.7
pfam09513356 consensus 98.51
PHA02142366 putative RNA ligase 98.47
TIGR02222107 chap_CsaA export-related chaperone CsaA; InterPro: IPR0 92.71
pfam0314794 FDX-ACB Ferredoxin-fold anticodon binding domain. This 99.92
TIGR00469460 pheS_mito phenylalanyl-tRNA synthetase; InterPro: IPR00 99.79
KOG2783436 consensus 99.79
PRK08655441 prephenate dehydrogenase; Provisional 98.51
pfam0348469 B5 tRNA synthetase B5 domain. This domain is found in p 99.71
smart0087471 B5 tRNA synthetase B5 domain. This domain is found in p 99.66
PRK12267644 methionyl-tRNA synthetase; Reviewed 99.34
PRK00133666 metG methionyl-tRNA synthetase; Reviewed 99.32
PRK06253527 O-phosphoseryl-tRNA synthetase; Reviewed 98.93
TIGR00470558 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR 97.48
TIGR02306374 RNA_lig_DRB0094 RNA ligase, DRB0094 family; InterPro: I 97.87
COG4937171 Predicted regulatory domain of prephenate dehydrogenase 97.75
COG2024536 Phenylalanyl-tRNA synthetase alpha subunit (archaeal ty 97.55
TIGR00468362 pheS phenylalanyl-tRNA synthetase, alpha subunit; Inter 97.54
KOG2784483 consensus 97.37
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetase (Hi 96.44
pfam00587170 tRNA-synt_2b tRNA synthetase class II core domain (G, H 93.01
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II 92.15
PRK09616546 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewe 94.75
PRK12292388 hisZ ATP phosphoribosyltransferase regulatory subunit; 94.21
PRK12421391 ATP phosphoribosyltransferase regulatory subunit; Provi 91.45
CHL00192702 syfB phenylalanyl-tRNA synthetase beta chain; Provision 91.13
CHL00201424 syh histidine-tRNA synthetase; Provisional 90.13
PRK12295373 hisZ ATP phosphoribosyltransferase regulatory subunit; 93.91
PRK00037417 hisS histidyl-tRNA synthetase; Reviewed 92.93
>PRK00629 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>TIGR00472 pheT_bact phenylalanyl-tRNA synthetase, beta subunit; InterPro: IPR004532 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>CHL00192 syfB phenylalanyl-tRNA synthetase beta chain; Provisional Back     alignment and domain information
>COG0072 PheT Phenylalanyl-tRNA synthetase beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09616 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>TIGR00471 pheT_arch phenylalanyl-tRNA synthetase, beta subunit; InterPro: IPR004531 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2472 consensus Back     alignment and domain information
>pfam03483 B3_4 B3/4 domain Back     alignment and domain information
>smart00873 B3_4 B3/4 domain Back     alignment and domain information
>COG3382 Solo B3/4 domain (OB-fold DNA/RNA-binding) of Phe-aaRS-beta [General function prediction only] Back     alignment and domain information
>cd00769 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>pfam01409 tRNA-synt_2d tRNA synthetases class II core domain (F) Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 PylS is the archaeal enzyme responsible for charging the pyrrolysine tRNA, PylT, by ligating a free molecule of pyrrolysine Back     alignment and domain information
>cd02796 tRNA_bind_bactPheRS tRNA-binding-domain-containing prokaryotic phenylalanly tRNA synthetase (PheRS) beta chain Back     alignment and domain information
>COG0073 ARC1 EMAP domain [General function prediction only] Back     alignment and domain information
>cd02153 tRNA_bindingDomain The tRNA binding domain is also known as the Myf domain in literature Back     alignment and domain information
>pfam01588 tRNA_bind Putative tRNA binding domain Back     alignment and domain information
>cd02799 tRNA_bind_EMAP-II_like tRNA-binding-domain-containing EMAP2-like proteins Back     alignment and domain information
>cd02800 tRNA_bind_EcMetRS_like tRNA-binding-domain-containing Escherichia coli methionyl-tRNA synthetase (EcMetRS)-like proteins Back     alignment and domain information
>cd02798 tRNA_bind_CsaA tRNA-binding-domain-containing CsaA-like proteins Back     alignment and domain information
>PRK10089 hypothetical protein; Provisional Back     alignment and domain information
>COG2517 Predicted RNA-binding protein containing a C-terminal EMAP domain [General function prediction only] Back     alignment and domain information
>KOG2241 consensus Back     alignment and domain information
>TIGR00399 metG_C_term methionyl-tRNA synthetase, beta subunit; InterPro: IPR004495 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam09513 consensus Back     alignment and domain information
>PHA02142 putative RNA ligase Back     alignment and domain information
>TIGR02222 chap_CsaA export-related chaperone CsaA; InterPro: IPR008231 The CsaA protein is required for SecA-mediated translocation of a subset of proteins , Back     alignment and domain information
>pfam03147 FDX-ACB Ferredoxin-fold anticodon binding domain Back     alignment and domain information
>TIGR00469 pheS_mito phenylalanyl-tRNA synthetase; InterPro: IPR004530 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2783 consensus Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>pfam03484 B5 tRNA synthetase B5 domain Back     alignment and domain information
>smart00874 B5 tRNA synthetase B5 domain Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK06253 O-phosphoseryl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR005246 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR02306 RNA_lig_DRB0094 RNA ligase, DRB0094 family; InterPro: IPR012646 RNA repair, though not as well characterised as DNA repair, is an important component of many biological systems Back     alignment and domain information
>COG4937 Predicted regulatory domain of prephenate dehydrogenase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2024 Phenylalanyl-tRNA synthetase alpha subunit (archaeal type) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit; InterPro: IPR004529 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2784 consensus Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>pfam00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>PRK09616 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>CHL00192 syfB phenylalanyl-tRNA synthetase beta chain; Provisional Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target805 phenylalanyl-tRNA synthetase subunit beta [Candidatus L
3pco_B795 Crystal Structure Of E. Coli Phenylalanine-Trna Syn 1e-173
2rhs_B800 Phers From Staphylococcus Haemolyticus- Rational Pr 1e-161
2rhq_B795 Phers From Staphylococcus Haemolyticus- Rational Pr 1e-154
1pys_B785 Phenylalanyl-Trna Synthetase From Thermus Thermophi 1e-123
2iy5_B785 Phenylalanyl-Trna Synthetase From Thermus Thermophi 1e-123
3bu2_A199 Crystal Structure Of A Trna-Binding Protein From St 1e-24
1ntg_A172 Crystal Structure Of The Emap Ii-Like Cytokine Rele 2e-09
2e8g_A241 The Structure Of Protein From P. Horikoshii At 1.7 8e-09
1mkh_A107 C-Terminal Domain Of Methionyl-Trna Synthetase From 5e-06
1euj_A166 A Novel Anti-Tumor Cytokine Contains A Rna-Binding 2e-05
1e7z_A174 Crystal Structure Of The Emap2RNA BINDING DOMAIN OF 2e-05
1rqg_A722 Methionyl-Trna Synthetase From Pyrococcus Abyssi Le 2e-05
1fl0_A171 Crystal Structure Of The Emap2RNA-Binding Domain Of 2e-05
1pxf_A111 Crystal Structure Of Trbp111: A Structure Specific 9e-05
3ers_X118 Crystal Structure Of E. Coli Trbp111 Length = 118 1e-04
3l4g_B589 Crystal Structure Of Homo Sapiens Cytoplasmic Pheny 9e-17
3cmq_A415 Crystal Structure Of Human Mitochondrial Phenylalan 1e-15
3ica_A213 The Crystal Structure Of The Beta Subunit Of A Phen 1e-11
3ig2_A213 The Crystal Structure Of A Putative Phenylalanyl-Tr 5e-10
gi|325053952|pdb|3PCO|B Chain B, Crystal Structure Of E. Coli Phenylalanine-Trna Synthetase Complexed With Phenylalanine And Amp Length = 795 Back     alignment and structure
 Score =  613 bits (1581), Expect = e-173,   Method: Composition-based stats.
 Identities = 246/809 (30%), Positives = 409/809 (50%), Gaps = 21/809 (2%)

Query: 1   MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDN-REALSPFTIVKVLSVERNPDLD 59
           MKF+  WL++ ++  +  + + + +T  GLEV+ V+    +     + +V+   ++P+ D
Sbjct: 1   MKFSELWLREWVNPAIDSDALANQITMAGLEVDGVEPVAGSFHGVVVGEVVECAQHPNAD 60

Query: 60  -CAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMM 118
              + +++ G  + + +VCGAPN R GL    A  G+ +P  +  +   K+RG  S GM+
Sbjct: 61  KLRVTKVNVGGDRLLDIVCGAPNCRQGLRVAVATIGAVLP-GDFKIKAAKLRGEPSEGML 119

Query: 119 CSEKELMLSDDSASIMELPIDAPVGGRLSDYLELSDPIIDVSLTPNRSDCIGVRGIALDL 178
           CS  EL +SDD + I+ELP DAP+G  + +YL+L D  I++S+TPNR+DC+G+ G+A D+
Sbjct: 120 CSFSELGISDDHSGIIELPADAPIGTDIREYLKLDDNTIEISVTPNRADCLGIIGVARDV 179

Query: 179 VAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNN-VAPNWMRQR 237
                  L +  I       +I   +   ++    C  +    VKG+      P WM+++
Sbjct: 180 AVLNQLPLVQPEI--VPVGATIDDTLPITVEAPEACPRYLGRVVKGINVKAPTPLWMKEK 237

Query: 238 LKAVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVLTVRRACSGEKILALDNQEYDL 297
           L+  G+RSI A+VD+TNYV L+ G P H FD  RI   + VR A  GE ++ LD  E  L
Sbjct: 238 LRRCGIRSIDAVVDVTNYVLLELGQPMHAFDKDRIEGGIVVRMAKEGETLVLLDGTEAKL 297

Query: 298 SPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGIITDSR 357
           + D +VIA   +  ++ GI GG+H+G +D T +VL+E A + P++I    +  G+ TD+ 
Sbjct: 298 NADTLVIADHNKALAMGGIFGGEHSGVNDETQNVLLECAFFSPLSITGRARRHGLHTDAS 357

Query: 358 YRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIARNITYKPRKIVF--MNSEVKRLS 415
           +R+ERGVD       ++    L++ +CGG A  +    N    P++       S++ RL 
Sbjct: 358 HRYERGVDPALQHKAMERATRLLIDICGGEAGPVIDITNEATLPKRATITLRRSKLDRLI 417

Query: 416 GIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQIKSE 475
           G  +  E    IL RLG  V    D+++   PSWR D+E + DLVEE+ R+YG + I  E
Sbjct: 418 GHHIADEQVTDILRRLGCEVTEGKDEWQAVAPSWRFDMEIEEDLVEEVARVYGYNNIPDE 477

Query: 476 PLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQRELEILN 535
           P+  + +             + VK +L  +   EV+ +SF+  +   +   G   L + +
Sbjct: 478 PVQASLIM--GTHREADLSLKRVKTLLNDKGYQEVITYSFVDPKVQQMIHPGVEALLLPS 535

Query: 536 PISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTPEGQKYMAAGIRKGS 595
           PIS +MS MR SL  GLL     N +R      IFE    +  DT           +   
Sbjct: 536 PISVEMSAMRLSLWTGLLATVVYNQNRQQNRVRIFESGLRFVPDTQAP----LGIRQDLM 591

Query: 596 SGIEGSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHPGRSGI 655
                 G  + +        VD +D K D  SV++    L+ + F + A    HPG+S  
Sbjct: 592 LAGVICGNRYEEHWNLAKETVDFYDLKGDLESVLDLTGKLNEVEFRAEANPALHPGQSAA 651

Query: 656 IKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPISQKKRTKTKKVVHLSSLHP 715
           I    E + G+ G  HP +     L+     FE+  + +           +   +S    
Sbjct: 652 IYLKGERI-GFVGVVHPELERKLDLNGRTLVFELEWNKL-----ADRVVPQAREISRFPA 705

Query: 716 VKRDLAFIVDQHIPAGTLVNIIKN-VDRLIDDVTVFDVFQGKSLGEGKKSVAIQVLIQPL 774
            +RD+A +V +++PA  +++  K      +  V +FDV++GK + EG KS+AI +++Q  
Sbjct: 706 NRRDIAVVVAENVPAADILSECKKVGVNQVVGVNLFDVYRGKGVAEGYKSLAISLILQDT 765

Query: 775 KDTFRDDDIRILMDRIVENVVKKTNAVLR 803
             T  +++I   + + VE + ++  A LR
Sbjct: 766 SRTLEEEEIAATVAKCVEALKERFQASLR 794


>gi|160286089|pdb|2RHS|B Chain B, Phers From Staphylococcus Haemolyticus- Rational Protein Engineering And Inhibitor Studies Length = 800 Back     alignment and structure
>gi|160286086|pdb|2RHQ|B Chain B, Phers From Staphylococcus Haemolyticus- Rational Protein Engineering And Inhibitor Studies Length = 795 Back     alignment and structure
gi|2781286|pdb|1PYS|B Chain B, Phenylalanyl-Trna Synthetase From Thermus Thermophilus Length = 785 Back     alignment and structure
>gi|116668186|pdb|2IY5|B Chain B, Phenylalanyl-Trna Synthetase From Thermus Thermophilus Complexed With Trna And A Phenylalanyl-Adenylate Analog Length = 785 Back     alignment and structure
>gi|166007369|pdb|3BU2|A Chain A, Crystal Structure Of A Trna-Binding Protein From Staphylococcus Saprophyticus Subsp. Saprophyticus. Northeast Structural Genomics Consortium Target Syr77 Length = 199 Back     alignment and structure
>gi|31615708|pdb|1NTG|A Chain A, Crystal Structure Of The Emap Ii-Like Cytokine Released From Human Tyrosyl-Trna Synthetase Length = 172 Back     alignment and structure
gi|166007018|pdb|2E8G|A Chain A, The Structure Of Protein From P. Horikoshii At 1.7 Angstrom Resolution Length = 241 Back     alignment and structure
>gi|28373694|pdb|1MKH|A Chain A, C-Terminal Domain Of Methionyl-Trna Synthetase From Pyrococcus Abyssi Length = 107 Back     alignment and structure
>gi|10120516|pdb|1EUJ|A Chain A, A Novel Anti-Tumor Cytokine Contains A Rna-Binding Motif Present In Aminoacyl-Trna Synthetases Length = 166 Back     alignment and structure
>gi|12084782|pdb|1E7Z|A Chain A, Crystal Structure Of The Emap2RNA BINDING DOMAIN OF THE P43 Protein From Human Aminoacyl-Trna Synthetase Complex Length = 174 Back     alignment and structure
gi|49258778|pdb|1RQG|A Chain A, Methionyl-Trna Synthetase From Pyrococcus Abyssi Length = 722 Back     alignment and structure
>gi|12084657|pdb|1FL0|A Chain A, Crystal Structure Of The Emap2RNA-Binding Domain Of The P43 Protein From Human Aminoacyl-Trna Synthetase Complex Length = 171 Back     alignment and structure
>gi|215794768|pdb|3ERS|X Chain X, Crystal Structure Of E. Coli Trbp111 Length = 118 Back     alignment and structure
>gi|290790148|pdb|3L4G|B Chain B, Crystal Structure Of Homo Sapiens Cytoplasmic Phenylalanyl-T Synthetase Length = 589 Back     alignment and structure
>gi|193506716|pdb|3CMQ|A Chain A, Crystal Structure Of Human Mitochondrial Phenylalanine Trna Synthetase Length = 415 Back     alignment and structure
>gi|254839707|pdb|3ICA|A Chain A, The Crystal Structure Of The Beta Subunit Of A Phenylalanyl- Trna Synthetase From Porphyromonas Gingivalis W83 Length = 213 Back     alignment and structure
>gi|257097716|pdb|3IG2|A Chain A, The Crystal Structure Of A Putative Phenylalanyl-Trna Synthetase (Phers) Beta Chain Domain From Bacteroides Fragilis To 2.1a Length = 213 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target805 phenylalanyl-tRNA synthetase subunit beta [Candidatus L
2rhq_B795 Phenylalanyl-tRNA synthetase beta chain; heterotetramer 1e-135
1b7y_B785 Phers, protein (phenylalanyl-tRNA synthetase); enzyme, 1e-133
3l4g_B589 Phenylalanyl-tRNA synthetase beta chain; aminoacylation 1e-87
2odr_C 701 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 6e-61
2cxi_A348 Phenylalanyl-tRNA synthetase beta chain; aminoacyl-tRNA 4e-49
3cmq_A415 Phenylalanyl-tRNA synthetase, mitochondrial; classii aa 3e-37
3ica_A213 Phenylalanyl-tRNA synthetase beta chain; APC61692.1, be 1e-32
3ig2_A213 Phenylalanyl-tRNA synthetase beta chain; phers, PSI, MC 4e-21
3bu2_A199 Putative tRNA-binding protein; structural genomics, PSI 1e-21
1mkh_A107 Metrs;, C-terminal domain of methionyl-tRNA synthetase; 9e-10
2nzh_A113 Protein CSAA; beta barrel, oligonucleotide/oligosacchar 3e-08
2cwp_A112 Metrs related protein; structural genomics, riken struc 1e-07
1pxf_A111 Hypothetical protein YGJH; oligonucleotide-oligosacchar 1e-06
1gd7_A109 CSAA protein; oligonucleotide-binding fold, functional 2e-06
1pyb_A111 Methionyl-tRNA synthetase beta subunit; oligonucleotide 2e-05
3g48_A112 Chaperone CSAA; structural genomics, niaid structural g 0.002
1rqg_A722 Methionyl-tRNA synthetase; translation, dimerization, l 0.004
2e8g_A241 Hypothetical protein PH0536; oligonucleotide/oligosacch 9e-19
1ntg_A172 Tyrrs, tyrosyl-tRNA synthetase; beta barrel, ligase; 2. 7e-11
1fl0_A171 Endothelial-monocyte activating polypeptide II; RNA-bin 2e-16
>2rhq_B Phenylalanyl-tRNA synthetase beta chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_B* Length = 795 Back     alignment and structure
 Score =  478 bits (1231), Expect = e-135
 Identities = 222/813 (27%), Positives = 398/813 (48%), Gaps = 29/813 (3%)

Query: 1   MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNR-EALSPFTIVKVLSVERNPDLD 59
           M  +  WLKD++D  V +E + + +T  G+EV+ + +  + +    +  + S E+     
Sbjct: 1   MLISNEWLKDYVDAGVKVEDLAERITRTGIEVDNMIDYSKDIKNLVVGYIQSKEKGSG-- 58

Query: 60  CAILRIDTGKHQEIQVVCGAPNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMMC 119
             I ++D G+ + +Q+VCGAPNV  G   + A  G  +P   + +   K+RG  S GM+C
Sbjct: 59  -NICQVDIGEEEPVQIVCGAPNVDAGQHVIVAKVGGRLP-GGIKIKRAKLRGERSEGMIC 116

Query: 120 SEKELMLSDDSAS------IMELPIDAPVGGRLSDYLELSDPIIDVSLTPNRSDCIGVRG 173
           S +E+ +S +         I   P +   G      L L+D +++  LTPNR+D + + G
Sbjct: 117 SLQEIGISSNVVPKAYENGIFVFPTEVEPGTDALTALYLNDQVMEFDLTPNRADALSMVG 176

Query: 174 IALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNW 233
            A ++ A    ++ +       +SES   E+   +D+      ++   VK V    +P W
Sbjct: 177 TAYEVAALYQTEMTKPETQSNETSESATNELSVTIDNPEKVPYYSARVVKNVSIEPSPIW 236

Query: 234 MRQRLKAVGLRSISALVDITNYVSLDRGYPSHVFDASRISDVL-TVRRACSGEKILALDN 292
           ++ RL   G+R I+ +VDI+NYV L+ G P H+FD   I      VR+A   E +  LDN
Sbjct: 237 VQARLIKAGIRPINNVVDISNYVLLEYGQPLHMFDQDHIGSKEIVVRQAKDEETMTTLDN 296

Query: 293 QEYDLSPDNVVIASDGRIQSIAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGI 352
            E  L   ++VI++     ++AG++GG  +   + TT+V++E A++DP++I  + + L +
Sbjct: 297 NERKLVDTDIVISNGQEPIALAGVMGGDFSEVTEQTTNVVIEGAIFDPVSIRHTSRRLNL 356

Query: 353 ITDSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTASDICIAR-NITYKPRKIVFMNSEV 411
            +++  RFE+G+  + +   +     L+  L  G      ++  ++      I     +V
Sbjct: 357 RSEASSRFEKGIATEFVDEAVDRACYLLQELASGEVLQDRVSSGDLGSFVTPIDITAEKV 416

Query: 412 KRLSGIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQ 471
            +  G ++  ++   I  +LGF    + +   V+VPS R+D+  K DL+EE+ RIYG D+
Sbjct: 417 NKTIGFNLSNDEIQSIFRQLGFETTLKGETLTVNVPSRRKDITIKEDLIEEVARIYGYDE 476

Query: 472 IKSEPLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGGQREL 531
           I S  LP+        L+ +Q +TR +K  L    + + + +S +SK+ +  F   +R  
Sbjct: 477 IPSS-LPVFGEVTSGELTDRQHKTRTLKETLEGAGLNQAITYSLVSKDHAKDFALQERPT 535

Query: 532 -EILNPISADMSNMRTSLLPGLLKATGRNVDRAIADFAIFEVSHVYENDTPEGQKYMAAG 590
             +L P+S   + +R SLLP L++AT  NV R   D  ++E+  V+  +           
Sbjct: 536 ISLLMPMSEAHATLRQSLLPHLIEATAYNVARKNKDVRLYEIGRVFFGNGEGELPDEVEY 595

Query: 591 IRKGSSGIEGSGRLWSDKSEERCRFVDLFDAKADALSVIEPFVSLDSLRFESGAPSWYHP 650
           +    SGI     + +    ++   +D F AK     V E         +++G     HP
Sbjct: 596 L----SGILTGEYVVNAWQGKKEE-IDFFIAKGVVDRVAEKLN--LEFSYKAGKIEGLHP 648

Query: 651 GRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPISQKKRTKTKKVVHL 710
           GR+ I+    + + G+ GE HP +     L      FE+  D++          +++   
Sbjct: 649 GRTAIVSLEGQDI-GFIGELHPQVAADNDL-KRTYVFELNYDAMMQVAVGYINYEQI--- 703

Query: 711 SSLHPVKRDLAFIVDQHIPAGTLVNIIKNVDR-LIDDVTVFDVFQGKSLGEGKKSVAIQV 769
                V RD+A  V+  +P+  L  II N    ++    VFDV++G+ L +GKKSVAI++
Sbjct: 704 PKFPGVTRDIALEVNHDVPSSELKQIIHNNGEDILQSTLVFDVYEGEHLEKGKKSVAIRL 763

Query: 770 LIQPLKDTFRDDDIRILMDRIVENVVKKTNAVL 802
                +DT  D+ +  + D+I+E  ++   A +
Sbjct: 764 NYLDTEDTLTDERVSKIHDKILEA-LQAEGATI 795


>1b7y_B Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer; HET: FYA; 2.50A {Thermus thermophilus} SCOP: a.6.1.1 a.6.1.1 b.40.4.4 b.153.1.1 d.58.13.1 d.104.1.1 PDB: 1b70_B* 1eiy_B 1jjc_B* 1pys_B 2akw_B* 2aly_B* 2amc_B* 3hfz_B* 2iy5_B* Length = 785 Back     alignment and structure
>3l4g_B Phenylalanyl-tRNA synthetase beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Length = 589 Back     alignment and structure
>2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 701 Back     alignment and structure
>2cxi_A Phenylalanyl-tRNA synthetase beta chain; aminoacyl-tRNA synthetase, ligase, structural genomics, NPPSFA; HET: MSE; 1.94A {Pyrococcus horikoshii OT3} Length = 348 Back     alignment and structure
>3cmq_A Phenylalanyl-tRNA synthetase, mitochondrial; classii aarss fold, RRM domain, RNA recogntion, aminoacyl-tRNA synthetase, ATP-binding, ligase; HET: FA5; 2.20A {Homo sapiens} PDB: 3hfv_A* Length = 415 Back     alignment and structure
>3ica_A Phenylalanyl-tRNA synthetase beta chain; APC61692.1, beta subunit, structural genomics, PSI-2, protein structure initiative; HET: TAM; 2.44A {Porphyromonas gingivalis} Length = 213 Back     alignment and structure
>3ig2_A Phenylalanyl-tRNA synthetase beta chain; phers, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 2.09A {Bacteroides fragilis} Length = 213 Back     alignment and structure
>3bu2_A Putative tRNA-binding protein; structural genomics, PSI-2, protein structure initiative; 2.70A {Staphylococcus saprophyticus subsp} Length = 199 Back     alignment and structure
>1mkh_A Metrs;, C-terminal domain of methionyl-tRNA synthetase; beta barrel, dimerization domain, ligase; 2.01A {Pyrococcus abyssi} SCOP: b.40.4.4 Length = 107 Back     alignment and structure
>2nzh_A Protein CSAA; beta barrel, oligonucleotide/oligosaccharide binding fold, homodimer, chaperone; 1.90A {Bacillus subtilis} PDB: 2nzo_A Length = 113 Back     alignment and structure
>2cwp_A Metrs related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.10A {Pyrococcus horikoshii} Length = 112 Back     alignment and structure
>1gd7_A CSAA protein; oligonucleotide-binding fold, functional dimer, hydrophobic cavity, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: b.40.4.4 Length = 109 Back     alignment and structure
>1pyb_A Methionyl-tRNA synthetase beta subunit; oligonucleotide, oligosaccharide-binding fold, OB-fold, beta-barrel, RNA binding protein; 2.50A {Aquifex aeolicus} SCOP: b.40.4.4 Length = 111 Back     alignment and structure
>3g48_A Chaperone CSAA; structural genomics, niaid structural genomic centers for infectious diseases; 1.50A {Bacillus anthracis} Length = 112 Back     alignment and structure
>1rqg_A Methionyl-tRNA synthetase; translation, dimerization, ligase; 2.90A {Pyrococcus abyssi} SCOP: a.27.1.1 c.26.1.1 g.41.1.1 Length = 722 Back     alignment and structure
>2e8g_A Hypothetical protein PH0536; oligonucleotide/oligosaccharide-binding fold, alpha-helices bundle, structural genomics, NPPSFA; 1.70A {Pyrococcus horikoshii} Length = 241 Back     alignment and structure
>1ntg_A Tyrrs, tyrosyl-tRNA synthetase; beta barrel, ligase; 2.21A {Homo sapiens} SCOP: b.40.4.4 Length = 172 Back     alignment and structure
>1fl0_A Endothelial-monocyte activating polypeptide II; RNA-binding domain, OB-fold, tRNA synthetase complex, RNA binding protein; 1.50A {Homo sapiens} SCOP: b.40.4.4 PDB: 1e7z_A 1euj_A Length = 171 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target805 phenylalanyl-tRNA synthetase subunit beta [Candidatus L
2rhq_B795 Phenylalanyl-tRNA synthetase beta chain; heterotetramer 100.0
1b7y_B785 Phers, protein (phenylalanyl-tRNA synthetase); enzyme, 100.0
3l4g_B589 Phenylalanyl-tRNA synthetase beta chain; aminoacylation 100.0
2cxi_A348 Phenylalanyl-tRNA synthetase beta chain; aminoacyl-tRNA 100.0
2odr_A 665 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 100.0
2odr_D 685 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 100.0
2odr_C 701 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 100.0
2odr_B 648 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 100.0
3cmq_A415 Phenylalanyl-tRNA synthetase, mitochondrial; classii aa 100.0
3ica_A213 Phenylalanyl-tRNA synthetase beta chain; APC61692.1, be 100.0
3ig2_A213 Phenylalanyl-tRNA synthetase beta chain; phers, PSI, MC 100.0
2zin_A291 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 99.52
3l4g_A508 Phenylalanyl-tRNA synthetase alpha chain; aminoacylatio 99.14
2rhq_A294 Phenylalanyl-tRNA synthetase alpha chain; heterotetrame 98.8
1b7y_A350 Phers, protein (phenylalanyl-tRNA synthetase); enzyme, 98.53
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA s 98.53
3bu2_A199 Putative tRNA-binding protein; structural genomics, PSI 100.0
2e8g_A241 Hypothetical protein PH0536; oligonucleotide/oligosacch 99.85
2nzh_A113 Protein CSAA; beta barrel, oligonucleotide/oligosacchar 99.72
2cwp_A112 Metrs related protein; structural genomics, riken struc 99.72
1ntg_A172 Tyrrs, tyrosyl-tRNA synthetase; beta barrel, ligase; 2. 99.89
1mkh_A107 Metrs;, C-terminal domain of methionyl-tRNA synthetase; 99.81
1fl0_A171 Endothelial-monocyte activating polypeptide II; RNA-bin 99.71
1pyb_A111 Methionyl-tRNA synthetase beta subunit; oligonucleotide 99.71
1pxf_A111 Hypothetical protein YGJH; oligonucleotide-oligosacchar 99.65
1gd7_A109 CSAA protein; oligonucleotide-binding fold, functional 99.45
3g48_A112 Chaperone CSAA; structural genomics, niaid structural g 99.45
2q2h_A131 AGR_C_4014P, secretion chaperone, phage-display derived 98.96
2q2i_A116 AGR_C_4014P, secretion chaperone; beta barrel, OB fold, 98.89
2du7_A549 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase 99.18
2du3_A534 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase 99.12
1rqg_A722 Methionyl-tRNA synthetase; translation, dimerization, l 98.98
3l4g_B589 Phenylalanyl-tRNA synthetase beta chain; aminoacylation 97.24
2cxi_A348 Phenylalanyl-tRNA synthetase beta chain; aminoacyl-tRNA 97.07
3a2k_A464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligas 93.99
3hj7_A142 TRNA(Ile)-lysidine synthase; helix-turn-helix, pseudo-k 96.39
3od1_A400 ATP phosphoribosyltransferase regulatory subunit; struc 95.4
3lc0_A456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA s 93.84
1z7m_A344 ATP phosphoribosyltransferase regulatory subunit; ATP-P 90.69
1htt_A423 Histidyl-tRNA synthetase; complex (tRNA synthetase/His- 90.52
3net_A465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, li 93.71
1qe0_A420 Histidyl-tRNA synthetase; class II tRNA synthetase, bet 92.42
1wu7_A434 Histidyl-tRNA synthetase; ligase, structural genomics, 92.12
>2rhq_B Phenylalanyl-tRNA synthetase beta chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_B* Back     alignment and structure
Probab=100.00  E-value=0  Score=1714.77  Aligned_cols=781  Identities=28%  Similarity=0.480  Sum_probs=723.2

Q ss_pred             CCCCHHHHHHHCCCCCCHHHHHHHHHHCCCEEEEEECCC-CCCCEEEEEEEEEEECCCCCCCEEEEECCCCCEEEEECCC
Q ss_conf             977867998847899988999999874586042111246-5687489999997565799870899975999579897548
Q gi|254780316|r    1 MKFTLSWLKDHLDTDVSLEKICDTLTSIGLEVEKVDNRE-ALSPFTIVKVLSVERNPDLDCAILRIDTGKHQEIQVVCGA   79 (805)
Q Consensus         1 M~is~~WL~~~v~~~~~~~~l~~~lt~~G~EVe~i~~~~-~~~~vvvg~v~~~~~hP~adl~v~~Vd~g~~~~~~IvcgA   79 (805)
                      |+||++||+||+|+++++++|+++||++|+|||+++..+ .+++||||+|++++||||   ++|+||+|+++.+||||||
T Consensus         1 M~is~~WL~e~v~~~~~~~~l~~~lt~~G~EVE~~~~~~~~~~~vvvg~v~~~~~hp~---~vc~V~~g~~~~~~IvcgA   77 (795)
T 2rhq_B            1 MLISNEWLKDYVDAGVKVEDLAERITRTGIEVDNMIDYSKDIKNLVVGYIQSKEKGSG---NICQVDIGEEEPVQIVCGA   77 (795)
T ss_dssp             CEEEHHHHTTTBCCSSCHHHHHHHHHHTTCEEEEEEETTTTCEEEEEEEEEEEECSSS---CEEEEECSSSSCEEEECCC
T ss_pred             CCCCHHHHHHHHCCCCCHHHHHHHHHHCEEEEEEEEECCCCCCCEEEEEEECCCCCCC---CEEEEECCCCCEEEEECCC
T ss_conf             9478899998719998999999998656081127884576779889999935658999---6799986899568898699


Q ss_pred             CCCCCCCEEEEECCCCEECCCCEEEEEEHHCCCCCCCHHHHHHHCCCCCC------CCCEEEECCCCCCCCCHHHHHCCC
Q ss_conf             34558978989668779258983983312058650545411887699854------775078168888884558870888
Q gi|254780316|r   80 PNVRVGLLGVWAPPGSCIPENNMIVNVRKIRGIESTGMMCSEKELMLSDD------SASIMELPIDAPVGGRLSDYLELS  153 (805)
Q Consensus        80 ~Nv~~g~~V~~A~~Ga~lp~g~~~i~~~~irGv~S~GMlCS~~ELgl~~~------~~gI~~l~~~~~~G~~~~~~l~l~  153 (805)
                      |||++|++||||+|||+|| |+++||++||||++|+|||||++||||+++      |+|||+||+++++|+++.+|++++
T Consensus        78 ~Nv~~g~~V~vA~~Ga~lp-~~~~i~~~klrGv~S~GMlcS~~ELGl~~~~~~~~~~~gI~~l~~~~~~G~~~~~~l~l~  156 (795)
T 2rhq_B           78 PNVDAGQHVIVAKVGGRLP-GGIKIKRAKLRGERSEGMICSLQEIGISSNVVPKAYENGIFVFPTEVEPGTDALTALYLN  156 (795)
T ss_dssp             TTCCTTCEEEEEEEEEEET-TTEECCCEEETTEEECSEECCSGGGTCCGGGSCHHHHTSCCBCSSCCCTTSBHHHHTTCS
T ss_pred             CCCCCCCEEEEECCCCEEC-CCCEEEEEEECCCCCCCEECCHHHCCCCCCCCCCCCCCCEEECCCCCCCCCCHHHHHCCC
T ss_conf             7236899999978698947-997896301378326732569878699866676667784598789888996889971899


Q ss_pred             CEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEEEEEECCCHHHHHHHCCCCCCCCCCCCHH
Q ss_conf             55999870878576655578999877641156666554566777777741589840731112332011232245566377
Q gi|254780316|r  154 DPIIDVSLTPNRSDCIGVRGIALDLVAAGLGKLKEINISCPLSSESIPLEIKFDLDDSSLCKGFAMCCVKGVRNNVAPNW  233 (805)
Q Consensus       154 D~i~ei~iTpNR~D~ls~~GiARElaa~~~~~l~~~~~~~~~~~~~~~~~i~v~i~~~~~c~~y~~~~i~~v~~~~SP~w  233 (805)
                      |++|||++||||||||||+|+||||||+++.+++.|..............+.+.+++++.||+|.+++|+||++++||+|
T Consensus       157 D~iieieitpNR~D~lS~~GiARelaa~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~v~~~~Sp~~  236 (795)
T 2rhq_B          157 DQVMEFDLTPNRADALSMVGTAYEVAALYQTEMTKPETQSNETSESATNELSVTIDNPEKVPYYSARVVKNVSIEPSPIW  236 (795)
T ss_dssp             CEEEEEECCGGGGGGSSHHHHHHHHHHHHTCCBCCCCCCCCCCSCBGGGTCEEEESCTTTCSEEEEEEEECCCCCCCCHH
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCEEEEEEECCCCCCCCCHH
T ss_conf             83899856898488765888999999874676567632233324456765057630645586465799626677899499


Q ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHCCCEEEECCCCCC-CEEEEEECCCCCCHHHHHHHCCCCCCCCEEEECCCCCCC
Q ss_conf             8788886401321039999989998608700000102233-326886235543114554201124543200002567631
Q gi|254780316|r  234 MRQRLKAVGLRSISALVDITNYVSLDRGYPSHVFDASRIS-DVLTVRRACSGEKILALDNQEYDLSPDNVVIASDGRIQS  312 (805)
Q Consensus       234 l~~rL~~~Gir~inniVDitNyvmle~GqPlHafD~dki~-~~i~vr~a~~~E~~~~Ld~~e~~L~~~~lvI~d~~~~ia  312 (805)
                      +|+||+++|+||+||+||||||+|+++|||+||||+||+. +.+.||.|+++|+|.+||+++|.|+++++||+|+++|+|
T Consensus       237 l~~rL~~~Gir~in~iVDitNyvmle~GqPlhafD~~~i~~~~i~vr~a~~~e~~~~Ld~~~~~l~~~~lvI~d~~~~ia  316 (795)
T 2rhq_B          237 VQARLIKAGIRPINNVVDISNYVLLEYGQPLHMFDQDHIGSKEIVVRQAKDEETMTTLDNNERKLVDTDIVISNGQEPIA  316 (795)
T ss_dssp             HHHHHHHTTCCCCCHHHHHHHHHHHHHSCCCEEEEGGGSSSSEEEEEECCTTCEEEBTTSCEEECCTTCEEEESSSSEEE
T ss_pred             HHHHHHHCCCCCCCCCCCCHHHCHHHCCCCCCCCCCCCCCCCCEEEEECCCCCCEEECCCCCCCCCCCEEEEECCCCCEE
T ss_conf             99999986997501014742102133289641045541247752898436665301115530114553058954997355


Q ss_pred             CHHHCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHCCCCHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCC-CCC
Q ss_conf             0011135531201367269999715787888778876165401554413455301358899988875212334555-652
Q gi|254780316|r  313 IAGIIGGKHAGCDDNTTDVLVEVALWDPINIARSGKNLGIITDSRYRFERGVDLQGMIPVLKHIVSLILSLCGGTA-SDI  391 (805)
Q Consensus       313 laGImGg~~s~v~~~T~~illEsA~F~p~~Ir~tar~l~l~TdaS~RfERgvd~~~~~~al~r~~~Li~e~~gg~~-~~~  391 (805)
                      |||||||.+|+|+++|||||||||+|||..||+|+|+++++||||+|||||+||..+..++.|+++|+.++|||++ ...
T Consensus       317 laGImgg~~s~V~~~T~~iliE~a~fdp~~Ir~tsr~l~l~tdas~Rfergvd~~~~~~a~~~~~~li~~~~~~~~~~~~  396 (795)
T 2rhq_B          317 LAGVMGGDFSEVTEQTTNVVIEGAIFDPVSIRHTSRRLNLRSEASSRFEKGIATEFVDEAVDRACYLLQELASGEVLQDR  396 (795)
T ss_dssp             ETTTEEBSSSBCCTTCCEEEEEEEECCHHHHHHHHHHTTCCCHHHHHHHTCCCGGGHHHHHHHHHHHHHHHSCCEECBCC
T ss_pred             ECCEECCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCHHHEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCE
T ss_conf             35556675556776650344010346889999998874013201111036777410799999999987754266423330


Q ss_pred             EEEEECCCCCCCEECCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHHHHHCCCCC
Q ss_conf             58741355431000043113333113458789999999840222103456236640345433440256767676535233
Q gi|254780316|r  392 CIARNITYKPRKIVFMNSEVKRLSGIDVPIEDSLRILERLGFSVIGEYDKFEVSVPSWRQDVEEKADLVEEILRIYGVDQ  471 (805)
Q Consensus       392 ~~~~~~~~~~~~I~l~~~~i~~ilG~~i~~~ei~~iL~~Lgf~v~~~~~~~~V~vPs~R~DI~~e~DLiEEIaRiyGYdn  471 (805)
                      .+.+..+..+++|.++.++++++||++++.+++.++|++|||+++.+++.|.|+||+||+||.+++||||||+|+|||||
T Consensus       397 ~~~~~~~~~~~~I~l~~~~i~~ilG~~i~~~~i~~iL~~Lg~~v~~~~~~~~V~vP~~R~DI~~e~DliEEIaRiyGydn  476 (795)
T 2rhq_B          397 VSSGDLGSFVTPIDITAEKVNKTIGFNLSNDEIQSIFRQLGFETTLKGETLTVNVPSRRKDITIKEDLIEEVARIYGYDE  476 (795)
T ss_dssp             EEEECCCCSEEEEEEEHHHHHHHHTCCCCHHHHHHHHHHTTCEEEEETTEEEEEEETTCTTCCSHHHHHHHHHHHHCTTT
T ss_pred             EECCCCCCCCEEEEECHHHHHHHCCCCCCHHHHHHHHHHCCCEEEECCCEEEEECCCCCCCCCCCCCHHHHHHHHCCCCC
T ss_conf             21144434321465038999765298751366999998558879962870899899854534766537776774437300


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHH-HHHCCCCCCCCCCCCCCCCHHHC
Q ss_conf             46676554434576789988954678988787787740232100482576552000-00000246776432101512211
Q gi|254780316|r  472 IKSEPLPLTQVEDKRNLSLQQSRTRYVKRVLASRAMMEVVNWSFISKEQSVLFGGG-QRELEILNPISADMSNMRTSLLP  550 (805)
Q Consensus       472 Ip~~~l~~~~~~~~~~~~~~~~~~~~ir~~L~~~Gf~Ev~tysl~s~~~~~~~~~~-~~~i~l~NPlS~e~s~lR~SLlp  550 (805)
                      ||++++.... .........+...+++|+.|+++||+|++||||++++....++.. .+.++|+||+|+|+++||+||+|
T Consensus       477 ip~~~p~~~~-~~~~~~~~~~~~~~~lr~~L~~~Gf~Ev~tysf~s~~~~~~~~~~~~~~v~l~NPls~e~s~lR~SLlp  555 (795)
T 2rhq_B          477 IPSSLPVFGE-VTSGELTDRQHKTRTLKETLEGAGLNQAITYSLVSKDHAKDFALQERPTISLLMPMSEAHATLRQSLLP  555 (795)
T ss_dssp             SCCCCCCCSS-CCCCCCCHHHHHHHHHHHHHHHTTCEECCCCSEECTTTTTTTCSSCCCCEECSSCSCTTSSEECSCSHH
T ss_pred             CCCCCCCHHC-CCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHCCCCCCHHHHCCCHHHHHHHHHCCCHH
T ss_conf             7676862000-245678878988999999998649864345224330021110234654332157213425565065326


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHCCCCCCCCCCC---CCEEHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             067764321015861134543024444777544---31000221035431012462023454433331468887531111
Q gi|254780316|r  551 GLLKATGRNVDRAIADFAIFEVSHVYENDTPEG---QKYMAAGIRKGSSGIEGSGRLWSDKSEERCRFVDLFDAKADALS  627 (805)
Q Consensus       551 ~LL~~~~~N~~r~~~~i~lFEiG~Vf~~~~~~~---~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~df~dlKg~v~~  627 (805)
                      |||+++++|++|+++++++||+|+||.++....   +...++++        ..|......|....+.+|||++||.+++
T Consensus       556 ~LL~~~~~N~~r~~~~~~lFEiG~vf~~~~~~~~~~~~~~l~~~--------~~g~~~~~~~~~~~~~~df~~~Kg~ve~  627 (795)
T 2rhq_B          556 HLIEATAYNVARKNKDVRLYEIGRVFFGNGEGELPDEVEYLSGI--------LTGEYVVNAWQGKKEEIDFFIAKGVVDR  627 (795)
T ss_dssp             HHHHHHHHHHHTTCCCEEEEEEEEEEECCCTTSCCEEEEEEEEE--------EESEEEEEGGGTEEEECCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHCCCCCCCHHCCCEEEECCCCCCCCCCHHCEEEE--------EECCCCCHHHCCCCCCCCHHHHHHHHHH
T ss_conf             67888887774589875510064289647764453101204677--------7156340121267656788999889999


Q ss_pred             HHHHCCCCCCEEEECCCCCCCCCCCEEEEEECCEEEEEEEEEECHHHHHHCCCCCCEEEEEEEHHHHHHHHHCCCCCCCC
Q ss_conf             11101453330330588656789816999987929999985477899996687997899998787623545202456631
Q gi|254780316|r  628 VIEPFVSLDSLRFESGAPSWYHPGRSGIIKTSAEIVLGYFGEFHPNILDFFGLSNPICGFEVYLDSIPISQKKRTKTKKV  707 (805)
Q Consensus       628 ll~~l~~~~~~~~~~~~~~~~hPgrsa~I~~~gk~iiG~iG~ihP~i~~~~~i~~~v~~~EI~ld~L~~~~~~~~~~~~~  707 (805)
                      ++..++.  .+.+.+..+++|||||||.|+++|+.+ |++|+|||.++++|+|+ ++|+|||+|+.|...   .....+|
T Consensus       628 ll~~l~~--~~~~~~~~~~~~hpgrsA~I~~~~~~I-G~iGelhP~v~~~~~i~-~v~~~Ei~l~~l~~~---~~~~~~~  700 (795)
T 2rhq_B          628 VAEKLNL--EFSYKAGKIEGLHPGRTAIVSLEGQDI-GFIGELHPQVAADNDLK-RTYVFELNYDAMMQV---AVGYINY  700 (795)
T ss_dssp             HHHHHTC--CCEEEECCCTTEEEEEEEEEEETTEEE-EEEEEECHHHHHHTTCC-SEEEEEEEHHHHTTC---CCCSCCC
T ss_pred             HHHHHHH--HCEECCCCCCCCCCCCEEEEEECCEEE-EEEEEECHHHHHHCCCC-CEEEEEEEHHHHHHH---HCCCCCC
T ss_conf             9998433--122213777667888569999999399-99999999999876999-769999997994420---1157777


Q ss_pred             CCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHCC-CCEEEEEEEEEEECCCCCCCCEEEEEEEEEECCCCCCCHHHHHHH
Q ss_conf             3689888720018999668879999999997111-003576989876367799884269999998477988899999999
Q gi|254780316|r  708 VHLSSLHPVKRDLAFIVDQHIPAGTLVNIIKNVD-RLIDDVTVFDVFQGKSLGEGKKSVAIQVLIQPLKDTFRDDDIRIL  786 (805)
Q Consensus       708 ~~~s~fP~v~RDls~iv~~~v~~~~I~~~i~~~~-~ll~~v~lfDvY~g~~i~~gkkSla~rl~fqs~~kTLtd~EI~~i  786 (805)
                      +++|+||+++|||||++|+++++++|+++|++++ ++|+++++||+|+|+++++||||+||||+|||.+|||||+||+++
T Consensus       701 ~~~s~fP~v~RDls~vv~~~v~~~~i~~~i~~~~~~ll~~v~lfDvY~g~~i~~gkkSla~rl~fqs~~kTLtd~ev~~~  780 (795)
T 2rhq_B          701 EQIPKFPGVTRDIALEVNHDVPSSELKQIIHNNGEDILQSTLVFDVYEGEHLEKGKKSVAIRLNYLDTEDTLTDERVSKI  780 (795)
T ss_dssp             CCCCSSCCEEEEEECBEETTSCHHHHHHHHHHHCGGGEEEEEEEEEEC-----CCEEEEEEEEEECCSSSCCCHHHHHHH
T ss_pred             CCCCCCCCEEEEEEEEECCCCCHHHHHHHHHHCCCCCEEEEEEEEEECCCCCCCCCEEEEEEEEEECCCCCCCHHHHHHH
T ss_conf             97899998657899998998959999999985591517187899997899999996699999999999989799999999


Q ss_pred             HHHHHHHHHHHHCCEE
Q ss_conf             9999999999951198
Q gi|254780316|r  787 MDRIVENVVKKTNAVL  802 (805)
Q Consensus       787 ~~~ii~~l~~k~ga~L  802 (805)
                      +++|++.|+++ ||+|
T Consensus       781 ~~~ii~~l~~~-Ga~l  795 (795)
T 2rhq_B          781 HDKILEALQAE-GATI  795 (795)
T ss_dssp             HHHHHHHHHHH-TCBC
T ss_pred             HHHHHHHHHHC-CCCC
T ss_conf             99999999975-8899



>1b7y_B Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: a.6.1.1 a.6.1.1 b.40.4.4 b.153.1.1 d.58.13.1 d.104.1.1 PDB: 1b70_B* 1eiy_B 1jjc_B* 1pys_B 2akw_B* 2aly_B* 2amc_B* 3hfz_B* 2iy5_B* Back     alignment and structure
>3l4g_B Phenylalanyl-tRNA synthetase beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>2cxi_A Phenylalanyl-tRNA synthetase beta chain; aminoacyl-tRNA synthetase, ligase, structural genomics, NPPSFA; HET: MSE; 1.94A {Pyrococcus horikoshii OT3} Back     alignment and structure
>2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Back     alignment and structure
>2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Back     alignment and structure
>2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Back     alignment and structure
>2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Back     alignment and structure
>3cmq_A Phenylalanyl-tRNA synthetase, mitochondrial; classii aarss fold, RRM domain, RNA recogntion, aminoacyl-tRNA synthetase, ATP-binding, ligase; HET: FA5; 2.20A {Homo sapiens} PDB: 3hfv_A* Back     alignment and structure
>3ica_A Phenylalanyl-tRNA synthetase beta chain; APC61692.1, beta subunit, structural genomics, PSI-2, protein structure initiative; HET: TAM; 2.44A {Porphyromonas gingivalis} Back     alignment and structure
>3ig2_A Phenylalanyl-tRNA synthetase beta chain; phers, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 2.09A {Bacteroides fragilis} Back     alignment and structure
>2zin_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, pyrrolysine, ATP analogue, non-natural amino acid, unnatural amino acid, ATP-binding; HET: ANP LBY; 1.79A {Methanosarcina mazei} PDB: 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* Back     alignment and structure
>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* Back     alignment and structure
>1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 2aly_A* 2akw_A* 2amc_A* Back     alignment and structure