254780317

254780317

phenylalanyl-tRNA synthetase, alpha subunit

GeneID in NCBI database:8209302Locus tag:CLIBASIA_01010
Protein GI in NCBI database:254780317Protein Accession:YP_003064730.1
Gene range:-(209439, 210539)Protein Length:366aa
Gene description:phenylalanyl-tRNA synthetase, alpha subunit
COG prediction:[J] Phenylalanyl-tRNA synthetase alpha subunit
KEGG prediction:pheS; phenylalanyl-tRNA synthetase, alpha subunit; K01889 phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
SEED prediction:Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Phe
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------
MTECNVFEDEVERIRSSLYNSIASVTDMDSLNAIRVATLGRKGSISSLLKDLKNLDSQQVSARGAILNQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLPVFSSPCHRGRIHPVTQVIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAGGKHKLLRTHTSPVQIRVMESQDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVSDSATIANLRWVLESFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMVDPRVLRGVGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHYGFSPLDIPPLFSRLA
cccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEcccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEccccccccEEEEEcccHHHHHHHHHccccEEEEEcccEEccccccccccccHHEEEEEEcccccHHHHHHHHHHHHHHHcccccccccEEcccccccccccEEEEEEEcccccccccccccEEEEEccccccHHHHHHccccHHHEEEEEEEccHHHHHHHHcccHHHHHHHcccHHHHHHHccccccccccccccc
ccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHcccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEccccccccccccEccHHHHHHHHHHHHHHccccEEcccccEEEHHHHcccccccccccccccccccEEEcccccccEEEEccccccEEEEHccccccEEEEccccEEEcccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHccccccEEEEccccccccccccEEEEEEEEccccEEEEccccEEEEEccccccHHHHHHccccHccccEEEEEEEHHHHHHHHcccccHHHcccccHHHHHHHccccccccccccccc
MTECNVFEDEVERIRSSLYNSiasvtdmdsLNAIRVATLGRKGSISSLLKDLKNLDSQQVSARGAILNQLKVDISGKISARKDFIRNQLIFEQissqsvdvslpvfsspchrgrihpvtqVIDEVTCIFMDMgfaleegsdietdyynfaalnfpddhparqmhdtffvpgiaggkhkllrthtspvqirvmesqdlpikvivpgktyrrdsdsthspmfhqieglvvsdsaTIANLRWVLESFCKSFFEVSSlqmrfrpsffpftepsfevdvrcsfsdgiikfdeGTEWMEILgcgmvdprvlrgvgidpdiyqgfawgmGLDRIAMLkygmpdvreFFGADVRWiehygfspldipplfsrla
mtecnvfeDEVERIRSSLYNsiasvtdmdsLNAIRVATLGRKGSISSLLKDLKNLDSQQVSARGAILNQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLPVFSSPCHRGRIHPVTQVIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAGGKHKLLRTHTSPVqirvmesqdlpikvivpGKTYRRDSDSTHSPMFHQIEGLVVSDSATIANLRWVLESFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMVDPRVLRGVGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHygfspldipplfsrla
MTECNVFEDEVERIRSSLYNSIASVTDMDSLNAIRVATLGRKGsissllkdlknldsQQVSARGAILNQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLPVFSSPCHRGRIHPVTQVIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAGGKHKLLRTHTSPVQIRVMESQDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVSDSATIANLRWVLESFCKSFFEVSSLQMrfrpsffpftepsfeVDVRCSFSDGIIKFDEGTEWMEILGCGMVDPRVLRGVGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHYGFSPLDIPPLFSRLA
**********VERIRSSLYNSIASVTDMDSLNAIRVATLGRKGSISSLL*************RGAILNQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLPVFS*****GRIHPVTQVIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAGGKHKLLRTHTSPVQIRVMESQDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVSDSATIANLRWVLESFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMVDPRVLRGVGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHYGFSPLDIPPLFS***
*********EVERIRSSLYNSIASVTDMDSLNAIRVATLGRKGSISSLLKDLKNLDSQQVSARGAILNQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLPVFSSPCHRGRIHPVTQVIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAGGKHKLLRTHTSPVQIRVMESQDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVSDSATIANLRWVLESFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMVDPRVLRGVGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHYGFSPLDIPPLFSRLA
****NVFEDEVERIRSSLYNSIASVTDMDSLNAIRVATLGRKGSISSLLKDLKNLDSQQVSARGAILNQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLPVFSSPCHRGRIHPVTQVIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAGGKHKLLRTHTSPVQIRVMESQDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVSDSATIANLRWVLESFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMVDPRVLRGVGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHYGFSPLDIPPLF****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTECNVFEDEVERIRSSLYNSIASVTDMDSLNAIRVATLGRKGSISSLLKDLKNLDSQQVSARGAILNQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLPVFSSPCHRGRIHPVTQVIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAGGKHKLLRTHTSPVQIRVMESQDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVSDSATIANLRWVLESFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMVDPRVLRGVGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHYGFSPLDIPPLFSRLA
MTECNVFEDEVERIRSSLYNSIASVTDMDSLNAIRVATLGRKGSISSLLKDLKNLDSQQVSARGAILNQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLPVFSSPCHRGRIHPVTQVIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAGGKHKLLRTHTSPVQIRVMESQDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVSDSATIANLRWVLESFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMVDPRVLRGVGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHYGFSPLDIPPLFSRLA
MTECNVFEDEVERIRSSLYNSIASVTDMDSLNAIRVATLGRKGSISSLLKDLKNLDSQQVSARGAILNQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLPVFSSPCHRGRIHPVTQVIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAGGKHKLLRTHTSPVQIRVMESQDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVSDSATIANLRWVLESFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMVDPRVLRGVGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHYGFSPLDIPPLFSRLA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target366 phenylalanyl-tRNA synthetase, alpha subunit [Candidatus
315122259366 phenylalanyl-tRNA synthetase, alpha subunit [Candidatus 1 1e-179
222084532360 phenylalanyl-tRNA synthetase [Agrobacterium radiobacter 1 1e-138
24212443360 RecName: Full=Phenylalanyl-tRNA synthetase alpha chain; 1 1e-138
209551838360 phenylalanyl-tRNA synthetase subunit alpha [Rhizobium l 1 1e-138
190889929360 phenylalanyl-tRNA synthetase, alpha subunit [Rhizobium 1 1e-138
116250037360 phenylalanyl-tRNA synthetase subunit alpha [Rhizobium l 1 1e-138
325291694360 phenylalanyl-tRNA synthetase alpha chain [Agrobacterium 1 1e-137
241207216360 phenylalanyl-tRNA synthetase subunit alpha [Rhizobium l 1 1e-137
150398672360 phenylalanyl-tRNA synthetase subunit alpha [Sinorhizobi 1 1e-137
222147173361 phenylalanyl-tRNA synthetase subunit alpha [Agrobacteri 1 1e-137
>gi|315122259|ref|YP_004062748.1| phenylalanyl-tRNA synthetase, alpha subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 366 Back     alignment and organism information
 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 298/365 (81%), Positives = 333/365 (91%)

Query: 1   MTECNVFEDEVERIRSSLYNSIASVTDMDSLNAIRVATLGRKGSISSLLKDLKNLDSQQV 60
           M + + F+D+VE++RSS+ +SI S + +D LNAIR + LG+KGS+SSLLKDLKNL+  QV
Sbjct: 1   MVKFDCFDDDVEQLRSSILDSIDSASSIDCLNAIRASALGKKGSVSSLLKDLKNLNPDQV 60

Query: 61  SARGAILNQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLPVFSSPCHRGRIHPVTQ 120
            +RG +LN+L+ ++S KIS+RK FIRNQ I  QISS S+DVSLPV SSPCHRGRIHP+TQ
Sbjct: 61  RSRGLVLNKLRDELSEKISSRKYFIRNQSIVAQISSPSIDVSLPVRSSPCHRGRIHPITQ 120

Query: 121 VIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAGGKHKLL 180
           V+DEVTCIFMDMGF LEEG DIETDYYNF ALNFPD+HPARQMHDTFF+PGI GGKHKLL
Sbjct: 121 VVDEVTCIFMDMGFVLEEGPDIETDYYNFTALNFPDEHPARQMHDTFFMPGIVGGKHKLL 180

Query: 181 RTHTSPVQIRVMESQDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVSDSATIANLRWV 240
           RTHTSPVQI++ME QDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVS SATIANLRWV
Sbjct: 181 RTHTSPVQIKIMEYQDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVSQSATIANLRWV 240

Query: 241 LESFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMV 300
           LESFCKSFFEV SL+MRFRPSFFPFTEPSFEVD+RCS S+GIIKFDEG EWMEILGCGMV
Sbjct: 241 LESFCKSFFEVESLEMRFRPSFFPFTEPSFEVDIRCSRSEGIIKFDEGAEWMEILGCGMV 300

Query: 301 DPRVLRGVGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHYGFSPLDIPP 360
           DPRVLRGVGIDPDIYQGFAWG+GLDRIAMLKYGMPDVR+FFG+DVRWIEHYGFSPL+IPP
Sbjct: 301 DPRVLRGVGIDPDIYQGFAWGIGLDRIAMLKYGMPDVRDFFGSDVRWIEHYGFSPLEIPP 360

Query: 361 LFSRL 365
           LFS L
Sbjct: 361 LFSYL 365


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084532|ref|YP_002543061.1| phenylalanyl-tRNA synthetase [Agrobacterium radiobacter K84] Length = 360 Back     alignment and organism information
>gi|24212443|sp|Q8UIN5|SYFA_AGRT5 RecName: Full=Phenylalanyl-tRNA synthetase alpha chain; AltName: Full=Phenylalanine--tRNA ligase alpha chain; Short=PheRS Length = 360 Back     alignment and organism information
>gi|209551838|ref|YP_002283755.1| phenylalanyl-tRNA synthetase subunit alpha [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 360 Back     alignment and organism information
>gi|190889929|ref|YP_001976471.1| phenylalanyl-tRNA synthetase, alpha subunit [Rhizobium etli CIAT 652] Length = 360 Back     alignment and organism information
>gi|116250037|ref|YP_765875.1| phenylalanyl-tRNA synthetase subunit alpha [Rhizobium leguminosarum bv. viciae 3841] Length = 360 Back     alignment and organism information
>gi|325291694|ref|YP_004277558.1| phenylalanyl-tRNA synthetase alpha chain [Agrobacterium sp. H13-3] Length = 360 Back     alignment and organism information
>gi|241207216|ref|YP_002978312.1| phenylalanyl-tRNA synthetase subunit alpha [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 360 Back     alignment and organism information
>gi|150398672|ref|YP_001329139.1| phenylalanyl-tRNA synthetase subunit alpha [Sinorhizobium medicae WSM419] Length = 360 Back     alignment and organism information
>gi|222147173|ref|YP_002548130.1| phenylalanyl-tRNA synthetase subunit alpha [Agrobacterium vitis S4] Length = 361 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target366 phenylalanyl-tRNA synthetase, alpha subunit [Candidatus
PRK00488339 PRK00488, pheS, phenylalanyl-tRNA synthetase subunit al 1e-149
COG0016335 COG0016, PheS, Phenylalanyl-tRNA synthetase alpha subun 1e-108
pfam01409243 pfam01409, tRNA-synt_2d, tRNA synthetases class II core 1e-98
cd00496218 cd00496, PheRS_alpha_core, Phenylalanyl-tRNA synthetase 7e-84
PRK04172489 PRK04172, pheS, phenylalanyl-tRNA synthetase subunit al 1e-55
PTZ00326494 PTZ00326, PTZ00326, phenylalanyl-tRNA synthetase alpha 2e-36
PLN02853492 PLN02853, PLN02853, Probable phenylalanyl-tRNA syntheta 3e-33
KOG2783436 KOG2783, KOG2783, KOG2783, Phenylalanyl-tRNA synthetase 4e-32
KOG2784483 KOG2784, KOG2784, KOG2784, Phenylalanyl-tRNA synthetase 1e-30
TIGR00468294 TIGR00468, pheS, phenylalanyl-tRNA synthetase, alpha su 9e-90
PLN02788402 PLN02788, PLN02788, phenylalanine-tRNA synthetase 1e-32
TIGR00469460 TIGR00469, pheS_mito, phenylalanyl-tRNA synthetase, mit 3e-16
COG2024 536 COG2024, COG2024, Phenylalanyl-tRNA synthetase alpha su 5e-08
TIGR00470 533 TIGR00470, sepS, O-phosphoseryl-tRNA(Cys) synthetase 3e-05
PRK06253 529 PRK06253, PRK06253, O-phosphoseryl-tRNA synthetase; Rev 0.003
TIGR00469 460 TIGR00469, pheS_mito, phenylalanyl-tRNA synthetase, mit 5e-12
pfam0291273 pfam02912, Phe_tRNA-synt_N, Aminoacyl tRNA synthetase c 8e-11
>gnl|CDD|179046 PRK00488, pheS, phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|30366 COG0016, PheS, Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|144850 pfam01409, tRNA-synt_2d, tRNA synthetases class II core domain (F) Back     alignment and domain information
>gnl|CDD|29807 cd00496, PheRS_alpha_core, Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>gnl|CDD|179764 PRK04172, pheS, phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|185556 PTZ00326, PTZ00326, phenylalanyl-tRNA synthetase alpha chain; Provisional Back     alignment and domain information
>gnl|CDD|178445 PLN02853, PLN02853, Probable phenylalanyl-tRNA synthetase alpha chain Back     alignment and domain information
>gnl|CDD|37994 KOG2783, KOG2783, KOG2783, Phenylalanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|37995 KOG2784, KOG2784, KOG2784, Phenylalanyl-tRNA synthetase, beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161893 TIGR00468, pheS, phenylalanyl-tRNA synthetase, alpha subunit Back     alignment and domain information
>gnl|CDD|178385 PLN02788, PLN02788, phenylalanine-tRNA synthetase Back     alignment and domain information
>gnl|CDD|129561 TIGR00469, pheS_mito, phenylalanyl-tRNA synthetase, mitochondrial Back     alignment and domain information
>gnl|CDD|32207 COG2024, COG2024, Phenylalanyl-tRNA synthetase alpha subunit (archaeal type) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129562 TIGR00470, sepS, O-phosphoseryl-tRNA(Cys) synthetase Back     alignment and domain information
>gnl|CDD|180491 PRK06253, PRK06253, O-phosphoseryl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|129561 TIGR00469, pheS_mito, phenylalanyl-tRNA synthetase, mitochondrial Back     alignment and domain information
>gnl|CDD|111764 pfam02912, Phe_tRNA-synt_N, Aminoacyl tRNA synthetase class II, N-terminal domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 366 phenylalanyl-tRNA synthetase, alpha subunit [Candidatus
PRK00488338 pheS phenylalanyl-tRNA synthetase subunit alpha; Valida 100.0
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [Transl 100.0
KOG2784483 consensus 100.0
pfam01409243 tRNA-synt_2d tRNA synthetases class II core domain (F). 100.0
PRK04172501 pheS phenylalanyl-tRNA synthetase subunit alpha; Provis 100.0
PTZ00326505 phenylalanyl-tRNA synthetase; Provisional 100.0
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) a 100.0
TIGR00469460 pheS_mito phenylalanyl-tRNA synthetase; InterPro: IPR00 100.0
KOG2783436 consensus 100.0
COG2024 536 Phenylalanyl-tRNA synthetase alpha subunit (archaeal ty 99.95
PRK09616546 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewe 99.32
cd00777280 AspRS_core Asp tRNA synthetase (aspRS) class II core do 99.23
PRK00629786 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewe 99.16
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 99.16
cd00776322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II c 99.06
CHL00192702 syfB phenylalanyl-tRNA synthetase beta chain; Provision 99.03
PRK05159434 aspC aspartyl-tRNA synthetase; Provisional 98.95
cd00769198 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) be 98.81
COG0072650 PheT Phenylalanyl-tRNA synthetase beta subunit [Transla 98.63
PRK09537420 pylS pyrolysyl-tRNA synthetase; Reviewed 98.59
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA s 98.07
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II 98.01
TIGR02367453 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 Py 97.81
TIGR00472848 pheT_bact phenylalanyl-tRNA synthetase, beta subunit; I 97.58
PRK05431422 seryl-tRNA synthetase; Provisional 97.38
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II core 97.15
TIGR00462330 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR0 96.72
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) clas 95.12
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core 94.98
COG0017435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation 94.46
cd00673232 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II core 92.39
TIGR00468362 pheS phenylalanyl-tRNA synthetase, alpha subunit; Inter 100.0
PRK06253 527 O-phosphoseryl-tRNA synthetase; Reviewed 100.0
TIGR00470 558 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR 100.0
pfam0291273 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-t 99.45
PRK00476 587 aspS aspartyl-tRNA synthetase; Validated 99.26
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl 99.12
PRK03932462 asnC asparaginyl-tRNA synthetase; Validated 99.04
PRK09350325 lysyl-tRNA synthetase; Provisional 99.04
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 99.04
pfam00152341 tRNA-synt_2 tRNA synthetases class II (D, K and N). 99.03
PRK029831099 lysS lysyl-tRNA synthetase; Provisional 98.98
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class I 98.93
cd00775329 LysRS_core Lys_tRNA synthetase (LysRS) class II core do 98.85
PRK12445505 lysyl-tRNA synthetase; Reviewed 98.78
PRK06462332 asparagine synthetase A; Reviewed 98.63
PRK12292 388 hisZ ATP phosphoribosyltransferase regulatory subunit; 98.03
pfam00587170 tRNA-synt_2b tRNA synthetase class II core domain (G, H 97.99
PRK12295 373 hisZ ATP phosphoribosyltransferase regulatory subunit; 97.76
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetase (Hi 97.74
PRK12421 391 ATP phosphoribosyltransferase regulatory subunit; Provi 97.69
PRK12420 421 histidyl-tRNA synthetase; Provisional 97.61
PRK00037 417 hisS histidyl-tRNA synthetase; Reviewed 97.61
COG0124 429 HisS Histidyl-tRNA synthetase [Translation, ribosomal s 97.61
CHL00201 424 syh histidine-tRNA synthetase; Provisional 97.49
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subunit; 97.44
COG2269322 Truncated, possibly inactive, lysyl-tRNA synthetase (cl 97.14
KOG1936 518 consensus 96.5
COG0173 585 AspS Aspartyl-tRNA synthetase [Translation, ribosomal s 95.01
COG0172429 SerS Seryl-tRNA synthetase [Translation, ribosomal stru 94.67
TIGR00457495 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 T 92.79
COG3705 390 HisZ ATP phosphoribosyltransferase involved in histidin 92.33
KOG1885560 consensus 98.47
COG1190502 LysU Lysyl-tRNA synthetase (class II) [Translation, rib 97.08
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II co 95.5
TIGR00442 446 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The 95.05
COG0441 589 ThrS Threonyl-tRNA synthetase [Translation, ribosomal s 94.08
PRK12305 576 thrS threonyl-tRNA synthetase; Reviewed 90.42
TIGR00471605 pheT_arch phenylalanyl-tRNA synthetase, beta subunit; I 98.23
KOG1035 1351 consensus 96.0
KOG2472578 consensus 95.06
TIGR00459653 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 96.84
COG0173585 AspS Aspartyl-tRNA synthetase [Translation, ribosomal s 96.64
COG0423 558 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ri 95.94
TIGR00389 606 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR00231 95.75
PRK04173460 glycyl-tRNA synthetase; Provisional 95.25
KOG0556533 consensus 95.12
PRK01584 593 alanyl-tRNA synthetase; Provisional 94.06
COG1190502 LysU Lysyl-tRNA synthetase (class II) [Translation, rib 91.08
PRK00960516 seryl-tRNA synthetase; Provisional 93.57
PRK13902 898 alaS lanyl-tRNA synthetase; Provisional 91.54
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2784 consensus Back     alignment and domain information
>pfam01409 tRNA-synt_2d tRNA synthetases class II core domain (F) Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>TIGR00469 pheS_mito phenylalanyl-tRNA synthetase; InterPro: IPR004530 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2783 consensus Back     alignment and domain information
>COG2024 Phenylalanyl-tRNA synthetase alpha subunit (archaeal type) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09616 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>PRK00629 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>CHL00192 syfB phenylalanyl-tRNA synthetase beta chain; Provisional Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00769 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain Back     alignment and domain information
>COG0072 PheT Phenylalanyl-tRNA synthetase beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 PylS is the archaeal enzyme responsible for charging the pyrrolysine tRNA, PylT, by ligating a free molecule of pyrrolysine Back     alignment and domain information
>TIGR00472 pheT_bact phenylalanyl-tRNA synthetase, beta subunit; InterPro: IPR004532 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR004525 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00673 AlaRS_core Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain Back     alignment and domain information
>TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit; InterPro: IPR004529 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK06253 O-phosphoseryl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR005246 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>pfam02912 Phe_tRNA-synt_N Aminoacyl tRNA synthetase class II, N-terminal domain Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK09350 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>pfam00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>pfam00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1936 consensus Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1885 consensus Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00471 pheT_arch phenylalanyl-tRNA synthetase, beta subunit; InterPro: IPR004531 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG1035 consensus Back     alignment and domain information
>KOG2472 consensus Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR002315 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG0556 consensus Back     alignment and domain information
>PRK01584 alanyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00960 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK13902 alaS lanyl-tRNA synthetase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target366 phenylalanyl-tRNA synthetase, alpha subunit [Candidatus
3pco_A327 Crystal Structure Of E. Coli Phenylalanine-Trna Syn 1e-102
1pys_A350 Phenylalanyl-Trna Synthetase From Thermus Thermophi 1e-82
2rhq_A294 Phers From Staphylococcus Haemolyticus- Rational Pr 4e-73
2akw_A266 Crystal Structure Of T.Thermophilus Phenylalanyl-Tr 3e-60
3cmq_A415 Crystal Structure Of Human Mitochondrial Phenylalan 3e-40
3l4g_A508 Crystal Structure Of Homo Sapiens Cytoplasmic Pheny 7e-40
2du5_A 534 Crystal Structure Of Archaeoglobus Fulgidus O-Phosp 6e-17
2du3_A 534 Crystal Structure Of Archaeoglobus Fulgidus O-Phosp 7e-17
2du7_A 549 Crystal Structure Of Methanococcus Jannacshii O- Ph 5e-15
2odr_B 648 Methanococcus Maripaludis Phosphoseryl-Trna Synthet 1e-11
2odr_A 665 Methanococcus Maripaludis Phosphoseryl-Trna Synthet 1e-11
2odr_C 701 Methanococcus Maripaludis Phosphoseryl-Trna Synthet 1e-11
2odr_D 685 Methanococcus Maripaludis Phosphoseryl-Trna Synthet 1e-11
gi|325053951|pdb|3PCO|A Chain A, Crystal Structure Of E. Coli Phenylalanine-Trna Synthetase Complexed With Phenylalanine And Amp Length = 327 Back     alignment and structure
 Score =  377 bits (967), Expect = e-102,   Method: Composition-based stats.
 Identities = 146/345 (42%), Positives = 222/345 (64%), Gaps = 18/345 (5%)

Query: 8   EDEVERIRSSLYNSIASVTDMDSLNAIRVATLGRKGSISSLLKDLKNLDSQQVSARGAIL 67
              +  + +S   +I+  +D+ +L+ +RV  LG+KG ++  +  L+ L  ++  A GA++
Sbjct: 1   MSHLAELVASAKAAISQASDVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVI 60

Query: 68  NQLKVDISGKISARKDFIRNQLIFEQISSQSVDVSLPVFSSPCHRGRIHPVTQVIDEVTC 127
           N+ K  +   ++ARK  + +  +  +++++++DVSLP        G +HPVT+ ID +  
Sbjct: 61  NEAKEQVQQALNARKAELESAALNARLAAETIDVSLPGRR--IENGGLHPVTRTIDRIES 118

Query: 128 IFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAGGKHKLLRTHTSPV 187
            F ++GF +  G +IE DY+NF ALN P  HPAR  HDTF+         +LLRT TS V
Sbjct: 119 FFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDT-----TRLLRTQTSGV 173

Query: 188 QIRVMESQDLPIKVIVPGKTYRRDSDSTHSPMFHQIEGLVVSDSATIANLRWVLESFCKS 247
           QIR M++Q  PI++I PG+ YR D D TH+PMFHQ+EGL+V  + +  NL+  L  F ++
Sbjct: 174 QIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRN 233

Query: 248 FFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMVDPRVLRG 307
           FFE   LQ+RFRPS+FPFTEPS EVDV            +  +W+E+LGCGMV P VLR 
Sbjct: 234 FFE-EDLQIRFRPSYFPFTEPSAEVDVM----------GKNGKWLEVLGCGMVHPNVLRN 282

Query: 308 VGIDPDIYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHYG 352
           VGIDP++Y GFA+GMG++R+ ML+YG+ D+R FF  D+R+++ + 
Sbjct: 283 VGIDPEVYSGFAFGMGMERLTMLRYGVTDLRSFFENDLRFLKQFK 327


gi|2781285|pdb|1PYS|A Chain A, Phenylalanyl-Trna Synthetase From Thermus Thermophilus Length = 350 Back     alignment and structure
>gi|160286085|pdb|2RHQ|A Chain A, Phers From Staphylococcus Haemolyticus- Rational Protein Engineering And Inhibitor Studies Length = 294 Back     alignment and structure
>gi|85544102|pdb|2AKW|A Chain A, Crystal Structure Of T.Thermophilus Phenylalanyl-Trna Synthetase Complexed With P-Cl-Phenylalanine Length = 266 Back     alignment and structure
>gi|193506716|pdb|3CMQ|A Chain A, Crystal Structure Of Human Mitochondrial Phenylalanine Trna Synthetase Length = 415 Back     alignment and structure
gi|290790147|pdb|3L4G|A Chain A, Crystal Structure Of Homo Sapiens Cytoplasmic Phenylalanyl-T Synthetase Length = 508 Back     alignment and structure
>gi|145579185|pdb|2DU5|A Chain A, Crystal Structure Of Archaeoglobus Fulgidus O-Phosphoseryl- Trna Synthetase E418nE420N MUTANT COMPLEXED WITH TRNAOPAL And O-Phosphoserine ("opal Complex") Length = 534 Back     alignment and structure
gi|145579179|pdb|2DU3|A Chain A, Crystal Structure Of Archaeoglobus Fulgidus O-Phosphoseryl- Trna Synthetase Complexed With Trnacys And O-Phosphoserine Length = 534 Back     alignment and structure
gi|145579191|pdb|2DU7|A Chain A, Crystal Structure Of Methanococcus Jannacshii O- Phosphoseryl-Trna Synthetase Length = 549 Back     alignment and structure
>gi|134105131|pdb|2ODR|B Chain B, Methanococcus Maripaludis Phosphoseryl-Trna Synthetase Length = 648 Back     alignment and structure
>gi|134105130|pdb|2ODR|A Chain A, Methanococcus Maripaludis Phosphoseryl-Trna Synthetase Length = 665 Back     alignment and structure
>gi|134105132|pdb|2ODR|C Chain C, Methanococcus Maripaludis Phosphoseryl-Trna Synthetase Length = 701 Back     alignment and structure
>gi|134105133|pdb|2ODR|D Chain D, Methanococcus Maripaludis Phosphoseryl-Trna Synthetase Length = 685 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target366 phenylalanyl-tRNA synthetase, alpha subunit [Candidatus
1b7y_A350 Phers, protein (phenylalanyl-tRNA synthetase); enzyme, 1e-81
3l4g_A508 Phenylalanyl-tRNA synthetase alpha chain; aminoacylatio 4e-78
2du3_A 534 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase 5e-77
2rhq_A294 Phenylalanyl-tRNA synthetase alpha chain; heterotetrame 2e-71
2odr_D 685 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 6e-70
2odr_A 665 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 7e-69
2odr_B 648 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 2e-67
2du7_A 549 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase 5e-59
3cmq_A415 Phenylalanyl-tRNA synthetase, mitochondrial; classii aa 4e-57
2zin_A291 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 1e-36
2odr_D 685 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 4e-22
2odr_A 665 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 2e-21
2odr_B 648 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 5e-20
2odr_C 701 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 2e-21
2odr_C 701 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 9e-60
2du7_A 549 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase 4e-19
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA s 1e-25
>1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 2aly_A* 2akw_A* 2amc_A* Length = 350 Back     alignment and structure
 Score =  298 bits (764), Expect = 1e-81
 Identities = 119/358 (33%), Positives = 199/358 (55%), Gaps = 32/358 (8%)

Query: 14  IRSSLYNSIASVTDMDSLNAIRVATLGRKGSISSLLKDLKNLDSQQVSARGAILNQLKVD 73
           +      +I +  D++ L A++   LG+KG ++  +K L  L  ++   RG  LN +K  
Sbjct: 1   MLEEALAAIQNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAA 60

Query: 74  ISGKISARKDFIRNQLIFEQISSQSVDVSLPVFSSPCHRGRIHPVTQVIDEVTCIFMDMG 133
           +   + AR+  +    + E +  + VDVSLP        G +HP+T +  E+  IF  +G
Sbjct: 61  LEAALEAREKALEEAALKEALERERVDVSLPGA--SLFSGGLHPITLMERELVEIFRALG 118

Query: 134 FALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIAG----------GKHKLLRTH 183
           +   EG ++E++++NF ALN P+ HPAR M DTF++ G                 LLRTH
Sbjct: 119 YQAVEGPEVESEFFNFDALNIPEHHPARDMWDTFWLTGEGFRLEGPLGEEVEGRLLLRTH 178

Query: 184 TSPVQIRVMESQDLPIKVIVPGKTYRRD-SDSTHSPMFHQIEGLVVSDSATIANLRWVLE 242
           TSP+Q+R M +   P +++VPG+ +R + +D+TH  +FHQ+EGLVV +   +A+L+  + 
Sbjct: 179 TSPMQVRYMVAHTPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIY 238

Query: 243 SFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMVDP 302
              ++ F     ++RF+P +FPF EP  +  V            EG +W+E+ G GMV P
Sbjct: 239 ELAQALFG-PDSKVRFQPVYFPFVEPGAQFAVWWP---------EGGKWLELGGAGMVHP 288

Query: 303 RVLRGVGIDPD---------IYQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHY 351
           +V + V    +            GFA+G+G++R+AML+YG+PD+R FFG  ++++E +
Sbjct: 289 KVFQAVDAYRERLGLPPAYRGVTGFAFGLGVERLAMLRYGIPDIRYFFGGRLKFLEQF 346


>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Length = 508 Back     alignment and structure
>2du3_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase/RNA complex; HET: SEP; 2.60A {Archaeoglobus fulgidus} PDB: 2du4_A 2du5_A* 2du6_A* Length = 534 Back     alignment and structure
>2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* Length = 294 Back     alignment and structure
>2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 685 Back     alignment and structure
>2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 665 Back     alignment and structure
>2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 648 Back     alignment and structure
>2du7_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase, structural genomics, NPPSFA; 3.60A {Methanocaldococcus jannaschii} Length = 549 Back     alignment and structure
>3cmq_A Phenylalanyl-tRNA synthetase, mitochondrial; classii aarss fold, RRM domain, RNA recogntion, aminoacyl-tRNA synthetase, ATP-binding, ligase; HET: FA5; 2.20A {Homo sapiens} PDB: 3hfv_A* Length = 415 Back     alignment and structure
>2zin_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, pyrrolysine, ATP analogue, non-natural amino acid, unnatural amino acid, ATP-binding; HET: ANP LBY; 1.79A {Methanosarcina mazei} PDB: 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* Length = 291 Back     alignment and structure
>2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 685 Back     alignment and structure
>2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 665 Back     alignment and structure
>2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 648 Back     alignment and structure
>2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 701 Back     alignment and structure
>2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Length = 701 Back     alignment and structure
>2du7_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase, structural genomics, NPPSFA; 3.60A {Methanocaldococcus jannaschii} Length = 549 Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Length = 288 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target366 phenylalanyl-tRNA synthetase, alpha subunit [Candidatus
1b7y_A350 Phers, protein (phenylalanyl-tRNA synthetase); enzyme, 100.0
1ses_A421 Seryl-tRNA synthetase; ligase(synthetase); HET: AHX AMP 97.76
2rhq_A294 Phenylalanyl-tRNA synthetase alpha chain; heterotetrame 100.0
2du3_A 534 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase 100.0
3l4g_A508 Phenylalanyl-tRNA synthetase alpha chain; aminoacylatio 100.0
3cmq_A415 Phenylalanyl-tRNA synthetase, mitochondrial; classii aa 100.0
2zin_A291 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 100.0
3l4g_B589 Phenylalanyl-tRNA synthetase beta chain; aminoacylation 99.25
2rhq_B795 Phenylalanyl-tRNA synthetase beta chain; heterotetramer 99.16
1nnh_A294 Asparaginyl-tRNA synthetase-related peptide; structural 99.08
3i7f_A548 Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding 99.06
1b7y_B785 Phers, protein (phenylalanyl-tRNA synthetase); enzyme, 98.92
1nj1_A 501 Proline-tRNA synthetase, proline--tRNA ligase; protein- 96.89
3ial_A 518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA 92.81
1hc7_A 477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP 91.4
2du7_A 549 O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase 100.0
2odr_C 701 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 100.0
2odr_A 665 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 100.0
2odr_D 685 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 100.0
2odr_B 648 Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthe 100.0
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA s 100.0
1c0a_A 585 Aspartyl tRNA synthetase; protein-RNA complex, ligase/R 99.22
1l0w_A 580 Aspartyl-tRNA synthetase; space-grown crystal, dimeric 99.18
3bju_A 521 Lysyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP- 99.16
3a74_A493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligas 98.99
1e1o_A504 Lysyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetas 98.93
1eov_A487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthet 98.91
3m4p_A456 Ehasnrs, asparaginyl-tRNA synthetase, putative; aminoac 98.9
1x54_A434 Asparaginyl-tRNA synthetase; aminoacyl-tRNA synthetase, 98.88
1wyd_A429 Hypothetical aspartyl-tRNA synthetase; archaea, ligase; 98.85
3a5y_A345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA sy 98.84
1n9w_A422 Aspartyl-tRNA synthetase 2; biosynthetic protein; 2.30A 98.82
3nem_A438 Aspartyl-tRNA synthetase; rossmann fold, OB fold, ligas 98.78
1z7m_A344 ATP phosphoribosyltransferase regulatory subunit; ATP-P 97.75
3net_A 465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, li 97.65
1qe0_A 420 Histidyl-tRNA synthetase; class II tRNA synthetase, bet 97.59
3od1_A 400 ATP phosphoribosyltransferase regulatory subunit; struc 97.57
3lc0_A 456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA s 97.2
1wu7_A 434 Histidyl-tRNA synthetase; ligase, structural genomics, 96.88
1htt_A 423 Histidyl-tRNA synthetase; complex (tRNA synthetase/His- 96.8
1nyr_A 645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET 96.67
1qf6_A 642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, zinc, 96.44
1h4v_B 421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synt 96.23
1nj8_A 459 Proline-tRNA synthetase, proline--tRNA ligase; class-II 96.09
1usy_A275 ATP phosphoribosyltransferase regulatory subunit; amino 95.96
3a32_A 471 Probable threonyl-tRNA synthetase 1; aeropyrum pernix K 95.78
1evl_A 401 Threonyl-tRNA synthetase; amino acid recognition, zinc 94.95
3ica_A213 Phenylalanyl-tRNA synthetase beta chain; APC61692.1, be 98.85
3ig2_A213 Phenylalanyl-tRNA synthetase beta chain; phers, PSI, MC 98.82
2dq3_A425 Seryl-tRNA synthetase; coiled-coil, homodimer, structur 98.14
2dq0_A455 Seryl-tRNA synthetase; coiled-coil, homodimer, structur 98.03
1wle_A501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos tau 98.03
2cja_A522 Seryl-tRNA synthetase; ligase, zinc ION; HET: MSE ATP; 97.59
3err_A536 Fusion protein of microtubule binding domain from mouse 97.28
3lss_A484 Seryl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA 97.05
3mf2_A346 BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA 98.04
3ikl_A 459 DNA polymerase subunit gamma-2, mitochondrial; transfer 94.42
1g5h_A 454 Mitochondrial DNA polymerase accessory subunit; intermo 91.44
>1b7y_A Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: d.104.1.1 PDB: 1b70_A* 1eiy_A 1jjc_A* 1pys_A 2iy5_A* 3hfz_A* 2aly_A* 2akw_A* 2amc_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=975.61  Aligned_cols=327  Identities=36%  Similarity=0.738  Sum_probs=312.2

Q ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999850699899999999980864068999876158998899999999999999999999999999985676667
Q gi|254780317|r   14 IRSSLYNSIASVTDMDSLNAIRVATLGRKGSISSLLKDLKNLDSQQVSARGAILNQLKVDISGKISARKDFIRNQLIFEQ   93 (366)
Q Consensus        14 L~~e~~~~I~~a~~~~eLe~lrv~~LGKKG~Lt~llK~Lk~Ls~EeKk~~Gk~iNelK~~Ie~~i~~kk~~L~~~~~~~k   93 (366)
                      |.++++++|++|+|+++|+++|++||||||.||.++|+||++|+|+||++|+.+|++|+.|+++|++++.+|+.++++++
T Consensus         1 L~~eal~~I~~a~dleeLe~lr~~yLGKKG~lt~l~k~Lk~l~~eeKk~~Gk~iN~lK~~ie~~i~~k~~~l~~~~~~~~   80 (350)
T 1b7y_A            1 MLEEALAAIQNARDLEELKALKARYLGKKGLLTQEMKGLSALPLEERRKRGQELNAIKAALEAALEAREKALEEAALKEA   80 (350)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CHHHHHHHHHHCCCHHHHHHHHHHHHCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             97899999872899999999999994871599999987437998999999999999999999999999999998888877


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCEEECCCEEECHHHHHHHHCCCCCCCCCCCCCEEEEECCC
Q ss_conf             65431000001123212267423899999999999987398762372341588988861898877331633127750566
Q gi|254780317|r   94 ISSQSVDVSLPVFSSPCHRGRIHPVTQVIDEVTCIFMDMGFALEEGSDIETDYYNFAALNFPDDHPARQMHDTFFVPGIA  173 (366)
Q Consensus        94 l~~E~iDVTLP~~~~~~~~G~~HPItqvi~eI~~IF~~lGF~v~eGPEIEtd~~NFdaLNiP~~HPARdmqDTFyl~~~~  173 (366)
                      +++|++|||||  +++...|++||||+|+++|++||.+|||+|++|||||||||||||||+|+||||||||||||+++..
T Consensus        81 l~~e~iDvTlP--~~~~~~G~~HPit~v~~eI~dIF~~mGF~v~~GpeIE~d~~NFdaLn~P~dHPARd~~DTFyl~~~~  158 (350)
T 1b7y_A           81 LERERVDVSLP--GASLFSGGLHPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDMWDTFWLTGEG  158 (350)
T ss_dssp             -----CCTTSC--CCCCCCCBCCHHHHHHHHHHHHHHTTTCEECCCCSEEEHHHHTTTTTCCSSSTTTTSSCCCBEECSS
T ss_pred             HHCCCCCCCCC--CCCCCCCCCCHHHHHHHHHHHHHHHCCCEECCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEEEECCC
T ss_conf             63045256532--4557877748799999999999973694450387535566668876799755103356438970555


Q ss_pred             ----------CCCCCCCCCCCCCHHHHHHHHCCCEEEEEECCCCCCCCC-CCCCCCCCCCCCEEEECCCCCHHHHHHHHH
Q ss_conf             ----------655632244676305555430363122541057647454-421378100200578617866899988999
Q gi|254780317|r  174 ----------GGKHKLLRTHTSPVQIRVMESQDLPIKVIVPGKTYRRDS-DSTHSPMFHQIEGLVVSDSATIANLRWVLE  242 (366)
Q Consensus       174 ----------~~~~~lLRthTS~vQiR~m~~~~pP~~~~~~GrvyR~d~-D~tH~~~FhQ~egl~v~~~i~~~~lk~~l~  242 (366)
                                .+.++|||||||+||||+|++++||+|+||||||||||+ |+||+|+|||+||++||+++||+||||+|+
T Consensus       159 ~~~~~~~~~~~~~~~lLRTHTS~~q~r~m~~~~pp~r~i~~GrVyR~d~~D~tH~p~FhQ~Egl~vd~~it~~~Lk~~l~  238 (350)
T 1b7y_A          159 FRLEGPLGEEVEGRLLLRTHTSPMQVRYMVAHTPPFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAHLKGAIY  238 (350)
T ss_dssp             CCCBCTTSCBCCSCEEECSSSTHHHHHHHHHCCSSEEEEEEEEEECCCCCCSSCCSEEEEEEEEEEETTCCHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHCCCCCCCCCHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHH
T ss_conf             34578752011103150446868899998624998169836765468998875587546889998130022798899999


Q ss_pred             HHHHHHCCCCCCEEEEEECCCCCCCCCCEEEEEEECCCCEEEECCCCCEEEEECCCCCCHHHHHHCCCCCCC--------
Q ss_conf             999997088866264542388985266103678750588042246883489845756388899856988000--------
Q gi|254780317|r  243 SFCKSFFEVSSLQMRFRPSFFPFTEPSFEVDVRCSFSDGIIKFDEGTEWMEILGCGMVDPRVLRGVGIDPDI--------  314 (366)
Q Consensus       243 ~~~~~~fg~~~~~~r~rp~~fPftePs~Evdv~~~~~~~~~~~~~~~~WiEi~g~Gm~~p~vl~~~g~d~~~--------  314 (366)
                      .|++++|| +++++|||||||||||||+||||+|         |++++||||||||||||+||+++||||+.        
T Consensus       239 ~~~~~~f~-~~~~~R~rp~yFPfTePs~Evdi~~---------~~~~~WiEi~G~Gmv~p~vl~~~g~~~~~~g~~~~~~  308 (350)
T 1b7y_A          239 ELAQALFG-PDSKVRFQPVYFPFVEPGAQFAVWW---------PEGGKWLELGGAGMVHPKVFQAVDAYRERLGLPPAYR  308 (350)
T ss_dssp             HHHHHHSC-SSCCEEEEECCBTTEEEEEEEEEEE---------TTTTEEEEEEEEEEECHHHHHHHHHHHHHTTCCCCCT
T ss_pred             HHHHHHCC-CCCEEEECCCCCCCCCCCCEEEEEE---------CCCCEEEEEECCCCCCHHHHHHCCCCHHHCCCCCCCC
T ss_conf             99997418-9864875788789888873499996---------8799568980563777899975589766517885456


Q ss_pred             -EEEEEEECCHHHHHHHHCCCCCHHHHHHCCHHHHHHCC
Q ss_conf             -37996313446997997389705876635888887448
Q gi|254780317|r  315 -YQGFAWGMGLDRIAMLKYGMPDVREFFGADVRWIEHYG  352 (366)
Q Consensus       315 -~~g~AfG~G~eRlaml~~gi~diR~~~~~d~rfl~qf~  352 (366)
                       |+|||||+||||||||+|||+|||+||+||+|||+||+
T Consensus       309 ~~~g~AfG~GleRlaMl~~gi~DiR~~~~~D~rfl~qfk  347 (350)
T 1b7y_A          309 GVTGFAFGLGVERLAMLRYGIPDIRYFFGGRLKFLEQFK  347 (350)
T ss_dssp             TCEEEEEEEEHHHHHHHHTTCCCGGGTTSCCHHHHGGGT
T ss_pred             CCEEEEEEECHHHHHHHHCCCCHHHHHHCCCHHHHHHHC
T ss_conf             675999864388999997399768877517878999731



>1ses_A Seryl-tRNA synthetase; ligase(synthetase); HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Back     alignment and structure
>2rhq_A Phenylalanyl-tRNA synthetase alpha chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_A* Back     alignment and structure
>2du3_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase/RNA complex; HET: SEP; 2.60A {Archaeoglobus fulgidus} PDB: 2du4_A 2du5_A* 2du6_A* Back     alignment and structure
>3l4g_A Phenylalanyl-tRNA synthetase alpha chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>3cmq_A Phenylalanyl-tRNA synthetase, mitochondrial; classii aarss fold, RRM domain, RNA recogntion, aminoacyl-tRNA synthetase, ATP-binding, ligase; HET: FA5; 2.20A {Homo sapiens} PDB: 3hfv_A* Back     alignment and structure
>2zin_A Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, pyrrolysine, ATP analogue, non-natural amino acid, unnatural amino acid, ATP-binding; HET: ANP LBY; 1.79A {Methanosarcina mazei} PDB: 2e3c_A* 2zcd_A* 2zce_A* 2zio_A* 2q7e_A* 2q7g_A* 2q7h_A* 2zim_A* Back     alignment and structure
>3l4g_B Phenylalanyl-tRNA synthetase beta chain; aminoacylation, tRNA-binding, DNA-binding domain, four-helix acetylation, aminoacyl-tRNA synthetase; HET: PHE; 3.30A {Homo sapiens} Back     alignment and structure
>2rhq_B Phenylalanyl-tRNA synthetase beta chain; heterotetramer, phenylalanine, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase; HET: GAX; 2.20A {Staphylococcus haemolyticus} PDB: 2rhs_B* Back     alignment and structure
>1nnh_A Asparaginyl-tRNA synthetase-related peptide; structural genomics, PSI, protein structure initiative; 1.65A {Pyrococcus furiosus} SCOP: d.104.1.1 Back     alignment and structure
>3i7f_A Aspartyl-tRNA synthetase; tRNA ligase, APO, ATP-binding, aminoacyl-tRNA synthetase, ligase, nucleotide-binding, protein biosynthesis; 2.80A {Entamoeba histolytica} Back     alignment and structure
>1b7y_B Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer, ligase; HET: FYA; 2.50A {Thermus thermophilus} SCOP: a.6.1.1 a.6.1.1 b.40.4.4 b.153.1.1 d.58.13.1 d.104.1.1 PDB: 1b70_B* 1eiy_B 1jjc_B* 1pys_B 2akw_B* 2aly_B* 2amc_B* 3hfz_B* 2iy5_B* Back     alignment and structure
>1nj1_A Proline-tRNA synthetase, proline--tRNA ligase; protein-aminoacyladenylate complex class-II tRNA synthetase; HET: 5CA; 2.55A {Methanothermobacterthermautotrophicus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1nj2_A 1nj5_A* 1nj6_A* Back     alignment and structure
>3ial_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA ligase, AARS, prors, cysrs, Pro(Cys)RS, translation, ATP-binding; HET: PR8; 2.20A {Giardia lamblia atcc 50803} Back     alignment and structure
>1hc7_A Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP + L-proline + tRNA(Pro) AMP + PPI + L-prolyl-tRNA(Pro); 2.43A {Thermus thermophilus} SCOP: c.51.1.1 d.68.5.1 d.104.1.1 PDB: 1h4q_A* 1h4t_A 1h4s_A Back     alignment and structure
>2du7_A O-phosphoseryl-tRNA synthetase; alpha4 tetramer, ligase, structural genomics, NPPSFA; 3.60A {Methanocaldococcus jannaschii} Back     alignment and structure
>2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Back     alignment and structure
>2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Back     alignment and structure
>2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Back     alignment and structure
>2odr_B Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} Back     alignment and structure
>3dsq_A Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA synthetase, ligase; 2.10A {Desulfitobacterium hafniense} PDB: 2znj_A 2zni_A Back     alignment and structure