254780318

254780318

ribosomal protein L20

GeneID in NCBI database:8209303Locus tag:CLIBASIA_01015
Protein GI in NCBI database:254780318Protein Accession:YP_003064731.1
Gene range:-(210758, 211129)Protein Length:123aa
Gene description:ribosomal protein L20
COG prediction:[J] Ribosomal protein L20
KEGG prediction:rplT; ribosomal protein L20; K02887 large subunit ribosomal protein L20
SEED prediction:LSU ribosomal protein L20p
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVDVAS
cccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcc
cccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccEEcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcc
mtrvkrgvvssakHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVDVAS
mtrvkrgvvssakhkkvlksakgfygrrkntiraakaavdrsqqyayrdrrvkkrdfrslWIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQldsfkkivelsrsrllvdvas
MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVDVAS
*TRVKR*VVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL*****
**************KKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVDVAS
*****RGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVD***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVDVAS
MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVDVAS
MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLLVDVAS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target123 ribosomal protein L20 [Candidatus Liberibacter asiaticu
315122258118 ribosomal protein L20 [Candidatus Liberibacter solanace 1 7e-49
217977996119 50S ribosomal protein L20 [Methylocella silvestris BL2] 1 1e-41
182679948121 50S ribosomal protein L20 [Beijerinckia indica subsp. i 1 3e-41
227824127134 50S ribosomal protein L20 [Sinorhizobium fredii NGR234] 1 3e-41
114706183140 50S ribosomal protein L20 [Fulvimarina pelagi HTCC2506] 1 4e-41
15964037134 50S ribosomal protein L20 [Sinorhizobium meliloti 1021] 1 4e-41
150398671134 50S ribosomal protein L20 [Sinorhizobium medicae WSM419 1 5e-41
190889928134 50S ribosomal protein L20 [Rhizobium etli CIAT 652] Len 1 7e-41
116250036134 50S ribosomal protein L20 [Rhizobium leguminosarum bv. 1 8e-41
241207215134 50S ribosomal protein L20 [Rhizobium leguminosarum bv. 1 9e-41
>gi|315122258|ref|YP_004062747.1| ribosomal protein L20 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 118 Back     alignment and organism information
 Score =  196 bits (499), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 109/118 (92%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           MTRVKRGVVS+AKHKKVLK AKGFYGRRKNTIR AKAAVDRS+QYAYRDRRVKKRDFRSL
Sbjct: 1   MTRVKRGVVSNAKHKKVLKLAKGFYGRRKNTIRTAKAAVDRSRQYAYRDRRVKKRDFRSL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL 118
           WIQRINAAVR+YDLNYSQFINGL KAGI LDR+ LS+LAI +  SF+KIV++S++ L+
Sbjct: 61  WIQRINAAVRLYDLNYSQFINGLQKAGITLDRRTLSELAIEKPGSFEKIVDVSKANLI 118


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|217977996|ref|YP_002362143.1| 50S ribosomal protein L20 [Methylocella silvestris BL2] Length = 119 Back     alignment and organism information
>gi|182679948|ref|YP_001834094.1| 50S ribosomal protein L20 [Beijerinckia indica subsp. indica ATCC 9039] Length = 121 Back     alignment and organism information
>gi|227824127|ref|YP_002828100.1| 50S ribosomal protein L20 [Sinorhizobium fredii NGR234] Length = 134 Back     alignment and organism information
>gi|114706183|ref|ZP_01439086.1| 50S ribosomal protein L20 [Fulvimarina pelagi HTCC2506] Length = 140 Back     alignment and organism information
>gi|15964037|ref|NP_384390.1| 50S ribosomal protein L20 [Sinorhizobium meliloti 1021] Length = 134 Back     alignment and organism information
>gi|150398671|ref|YP_001329138.1| 50S ribosomal protein L20 [Sinorhizobium medicae WSM419] Length = 134 Back     alignment and organism information
>gi|190889928|ref|YP_001976470.1| 50S ribosomal protein L20 [Rhizobium etli CIAT 652] Length = 134 Back     alignment and organism information
>gi|116250036|ref|YP_765874.1| 50S ribosomal protein L20 [Rhizobium leguminosarum bv. viciae 3841] Length = 134 Back     alignment and organism information
>gi|241207215|ref|YP_002978311.1| 50S ribosomal protein L20 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 134 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target123 ribosomal protein L20 [Candidatus Liberibacter asiaticu
PRK05185114 PRK05185, rplT, 50S ribosomal protein L20; Provisional 8e-46
COG0292118 COG0292, RplT, Ribosomal protein L20 [Translation, ribo 3e-36
TIGR01032113 TIGR01032, rplT_bact, ribosomal protein L20 6e-33
CHL00068115 CHL00068, rpl20, ribosomal protein L20 1e-26
PTZ00030121 PTZ00030, PTZ00030, 60S ribosomal protein L20; Provisio 3e-25
PRK14537 230 PRK14537, PRK14537, 50S ribosomal protein L20/unknown d 2e-22
KOG4707147 KOG4707, KOG4707, KOG4707, Mitochondrial/chloroplast ri 6e-22
pfam00453107 pfam00453, Ribosomal_L20, Ribosomal protein L20 2e-39
>gnl|CDD|179959 PRK05185, rplT, 50S ribosomal protein L20; Provisional Back     alignment and domain information
>gnl|CDD|30640 COG0292, RplT, Ribosomal protein L20 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|130104 TIGR01032, rplT_bact, ribosomal protein L20 Back     alignment and domain information
>gnl|CDD|177008 CHL00068, rpl20, ribosomal protein L20 Back     alignment and domain information
>gnl|CDD|185406 PTZ00030, PTZ00030, 60S ribosomal protein L20; Provisional Back     alignment and domain information
>gnl|CDD|173003 PRK14537, PRK14537, 50S ribosomal protein L20/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|39905 KOG4707, KOG4707, KOG4707, Mitochondrial/chloroplast ribosomal protein L20 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|144155 pfam00453, Ribosomal_L20, Ribosomal protein L20 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 123 ribosomal protein L20 [Candidatus Liberibacter asiaticu
TIGR01032114 rplT_bact ribosomal protein L20; InterPro: IPR005812 Ri 100.0
COG0292118 RplT Ribosomal protein L20 [Translation, ribosomal stru 100.0
CHL00068117 rpl20 ribosomal protein L20 100.0
PRK05185114 rplT 50S ribosomal protein L20; Provisional 100.0
pfam00453107 Ribosomal_L20 Ribosomal protein L20. 100.0
PTZ00030121 60S ribosomal protein L20; Provisional 100.0
KOG4707147 consensus 100.0
>TIGR01032 rplT_bact ribosomal protein L20; InterPro: IPR005812 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0292 RplT Ribosomal protein L20 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00068 rpl20 ribosomal protein L20 Back     alignment and domain information
>PRK05185 rplT 50S ribosomal protein L20; Provisional Back     alignment and domain information
>pfam00453 Ribosomal_L20 Ribosomal protein L20 Back     alignment and domain information
>PTZ00030 60S ribosomal protein L20; Provisional Back     alignment and domain information
>KOG4707 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target123 ribosomal protein L20 [Candidatus Liberibacter asiaticu
1nkw_O118 Crystal Structure Of The Large Ribosomal Subunit Fr 3e-33
1vs6_Q118 Crystal Structure Of The Bacterial Ribosome From Es 4e-33
2j01_U118 Structure Of The Thermus Thermophilus 70s Ribosome 2e-32
1pnu_O117 Crystal Structure Of A Streptomycin Dependent Ribos 3e-32
1p85_O117 Real Space Refined Coordinates Of The 50s Subunit F 4e-32
2gya_O115 Structure Of The 50s Subunit Of A Pre-Translocation 7e-32
3fin_U117 T. Thermophilus 70s Ribosome In Complex With Mrna, 2e-31
3mrz_Q116 Recognition Of The Amber Stop Codon By Release Fact 2e-29
2ghj_A118 Crystal Structure Of Folded And Partially Unfolded 4e-27
3bbo_S119 Homology Model For The Spinach Chloroplast 50s Subu 7e-24
2ftc_L118 Structural Model For The Large Subunit Of The Mamma 5e-20
1gyz_A60 Bacterial Ribosomal Protein L20 From Aquifex Aeolic 5e-16
gi|28948934|pdb|1NKW|O Chain O, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 118 Back     alignment and structure
 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 62/116 (53%), Positives = 80/116 (68%)

Query: 1   MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSL 60
           M R K G+V   +HKKVLK AKGF+G R    R A   +  +  Y YRDRR KKRDFR L
Sbjct: 1   MPRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRL 60

Query: 61  WIQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR 116
           WIQRINA  R++ +NYS FINGL +A I L+RKVL+D+A  + ++FK +V+ SR+ 
Sbjct: 61  WIQRINAGARLHGMNYSTFINGLKRANIDLNRKVLADIAAREPEAFKALVDASRNA 116


gi|116666586|pdb|1VS6|Q Chain Q, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 118 Back     alignment and structure
gi|116668252|pdb|2J01|U Chain U, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 118 Back     alignment and structure
>gi|34811568|pdb|1PNU|O Chain O, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 117 Back     alignment and structure
>gi|33357916|pdb|1P85|O Chain O, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 117 Back     alignment and structure
>gi|116667449|pdb|2GYA|O Chain O, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 115 Back     alignment and structure
>gi|224510796|pdb|3FIN|U Chain U, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 117 Back     alignment and structure
>gi|300508645|pdb|3MRZ|Q Chain Q, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 3ms0. Molecule A In The Same Asymmetric Unit Is Deposited As 3mr8 (50s) And 3ms1 (30s). Length = 116 Back     alignment and structure
>gi|99032555|pdb|2GHJ|A Chain A, Crystal Structure Of Folded And Partially Unfolded Forms Of Aquifex Aeolicus Ribosomal Protein L20 Length = 118 Back     alignment and structure
>gi|189096141|pdb|3BBO|S Chain S, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 119 Back     alignment and structure
>gi|99032318|pdb|2FTC|L Chain L, Structural Model For The Large Subunit Of The Mammalian Mitochondrial Ribosome Length = 118 Back     alignment and structure
>gi|159162373|pdb|1GYZ|A Chain A, Bacterial Ribosomal Protein L20 From Aquifex Aeolicus Length = 60 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target123 ribosomal protein L20 [Candidatus Liberibacter asiaticu
3ofq_Q117 50S ribosomal protein L20; protein biosynthesis, riboso 5e-36
2zjr_N118 50S ribosomal protein L20; ribosome, large ribosomal su 1e-35
3i1n_Q118 50S ribosomal protein L20; ribosome structure, protein- 5e-35
2j01_U118 50S ribosomal protein L20; ribosome, tRNA, paromomycin, 8e-35
2ftc_L118 MRPL20 protein; mitochondrial ribosome, large ribosomal 2e-31
3bbo_S119 Ribosomal protein L20; large ribosomal subunit, spinach 3e-31
2ghj_A118 50S ribosomal protein L20; folding intermediate, riboso 6e-31
>3ofq_Q 50S ribosomal protein L20; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_O 1p86_O 2awb_Q 2aw4_Q 2i2v_Q 2j28_Q 2i2t_Q* 2qao_Q* 2qba_Q* 2qbc_Q* 2qbe_Q 2qbg_Q 2qbi_Q* 2qbk_Q* 2qov_Q 2qox_Q 2qoz_Q* 2qp1_Q* 2rdo_Q 2vhm_Q ... Length = 117 Back     alignment and structure
 Score =  144 bits (366), Expect = 5e-36
 Identities = 62/115 (53%), Positives = 84/115 (73%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           RVKRGV++ A+HKK+LK AKG+YG R    R A  AV ++ QYAYRDRR +KR FR LWI
Sbjct: 2   RVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R   ++YS+FINGL KA + +DRK+L+D+A+    +F  +VE +++ L
Sbjct: 62  ARINAAARQNGISYSKFINGLKKASVEIDRKILADIAVFDKVAFTALVEKAKAAL 116


>2zjr_N 50S ribosomal protein L20; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: a.144.2.1 PDB: 1nwx_O* 1nwy_O* 1sm1_O* 1xbp_O* 1yl3_1 2b66_U 2b9n_U 2b9p_U 2zjp_N* 2zjq_N 1nkw_O 3cf5_N* 3dll_N* 1pnu_O 1pny_O 1vor_R 1vou_R 1vow_R 1voy_R 1vp0_R Length = 118 Back     alignment and structure
>3i1n_Q 50S ribosomal protein L20; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_Q 3e1b_J 3e1d_J 1vs6_Q 3i1p_Q 3i1r_Q 3i1t_Q 3i20_Q 3i22_Q 2qam_Q* 1p85_O 1p86_O 2awb_Q 2aw4_Q 2i2v_Q 2j28_Q 2i2t_Q* 2qao_Q* 2qba_Q* 2qbc_Q* ... Length = 118 Back     alignment and structure
>2j01_U 50S ribosomal protein L20; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: a.144.2.1 PDB: 1vsp_O 2hgj_T 2hgq_T 2hgu_T 1vsa_O 2j03_U 2jl6_U 2jl8_U 2v47_U 2v49_U 2wdi_U 2wdj_U 2wdl_U 2wdn_U 2wh2_U 2wh4_U 3d5b_U 3d5d_U 3f1f_U 3f1h_U ... Length = 118 Back     alignment and structure
>2ftc_L MRPL20 protein; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} Length = 118 Back     alignment and structure
>3bbo_S Ribosomal protein L20; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 119 Back     alignment and structure
>2ghj_A 50S ribosomal protein L20; folding intermediate, ribosomal protein extension, structural protein; 2.90A {Aquifex aeolicus} PDB: 1gyz_A Length = 118 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target123 ribosomal protein L20 [Candidatus Liberibacter asiaticu
2zjr_N118 50S ribosomal protein L20; ribosome, large ribosomal su 100.0
2j01_U118 50S ribosomal protein L20; ribosome, tRNA, paromomycin, 100.0
2ghj_A118 50S ribosomal protein L20; folding intermediate, riboso 100.0
3ofq_Q117 50S ribosomal protein L20; protein biosynthesis, riboso 100.0
3bbo_S119 Ribosomal protein L20; large ribosomal subunit, spinach 100.0
2ftc_L118 MRPL20 protein; mitochondrial ribosome, large ribosomal 100.0
>2zjr_N 50S ribosomal protein L20; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: a.144.2.1 PDB: 1nwx_O* 1nwy_O* 1sm1_O* 1xbp_O* 1yl3_1 2b66_U 2b9n_U 2b9p_U 2zjp_N* 2zjq_N 1nkw_O 3cf5_N* 3dll_N* 1pnu_O 1pny_O 1vor_R 1vou_R 1vow_R 1voy_R 1vp0_R Back     alignment and structure
Probab=100.00  E-value=0  Score=336.74  Aligned_cols=118  Identities=53%  Similarity=0.837  Sum_probs=116.8

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHH
Q ss_conf             98775665556899899997413156452369999999999999987469988999999999867799997189999999
Q gi|254780318|r    1 MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFI   80 (123)
Q Consensus         1 M~Rvk~g~~~~~rrkkilk~akGfrG~r~~~~r~A~~~v~kAl~yayrdRk~kKr~fR~LWI~RINAa~r~~g~sYS~fi   80 (123)
                      |||||+|+++++|||+||++|+||+|++++||++|+|+|+|||+|||+||+.+||+||+|||+|||||+|++|++||+||
T Consensus         1 M~Rvkrg~~~~~rrkkilk~akGf~G~~~~~~r~A~~~v~kAl~yayrdRk~kKr~fR~LWI~RINAa~R~~g~~YS~fi   80 (118)
T 2zjr_N            1 MPRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRLWIQRINAGARLHGMNYSTFI   80 (118)
T ss_dssp             -CCCCCTTHHHHHHHHHHTTCSSCCGGGGTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTCCHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             99877728989999999998063677765517999999999999999459999999999999999999999499899999


Q ss_pred             HHHHHCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             99996298646899999974198999999999999855
Q gi|254780318|r   81 NGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL  118 (123)
Q Consensus        81 ~~L~~~~i~LnRKvLa~LAi~dp~~F~~lv~~ak~~l~  118 (123)
                      +||+++||.|||||||||||+||++|++||+++|++|+
T Consensus        81 ~~L~k~~i~LnRKiLs~LAi~dp~~F~~lv~~~k~a~~  118 (118)
T 2zjr_N           81 NGLKRANIDLNRKVLADIAAREPEAFKALVDASRNARQ  118 (118)
T ss_dssp             HHHHHCTTCCCCSSHHHHHHHCHHHHHHHHHHHHTTTC
T ss_pred             HHHHHHCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHCC
T ss_conf             99999388533999999996089999999999998629



>2j01_U 50S ribosomal protein L20; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: a.144.2.1 PDB: 1vsp_O 2hgj_T 2hgq_T 2hgu_T 1vsa_O 2j03_U 2jl6_U 2jl8_U 2v47_U 2v49_U 2wdi_U 2wdj_U 2wdl_U 2wdn_U 2wh2_U 2wh4_U 2wrj_U 2wrl_U 2wro_U 2wrr_U ... Back     alignment and structure
>2ghj_A 50S ribosomal protein L20; folding intermediate, ribosomal protein extension, structural protein; 2.90A {Aquifex aeolicus} PDB: 1gyz_A Back     alignment and structure
>3ofq_Q 50S ribosomal protein L20; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_O 1p86_O 2awb_Q 2aw4_Q 2i2v_Q 2j28_Q 2i2t_Q* 2qao_Q* 2qba_Q* 2qbc_Q* 2qbe_Q 2qbg_Q 2qbi_Q* 2qbk_Q* 2qov_Q 2qox_Q 2qoz_Q* 2qp1_Q* 2rdo_Q 2vhm_Q ... Back     alignment and structure
>3bbo_S Ribosomal protein L20; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2ftc_L MRPL20 protein; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 123 ribosomal protein L20 [Candidatus Liberibacter asiaticu
d2j01u1117 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus ther 6e-36
d2zjrn1117 a.144.2.1 (N:2-118) Ribosomal protein L20 {Deinococcus 4e-35
d2gyco1115 a.144.2.1 (O:2-116) Ribosomal protein L20 {Escherichia 9e-35
d1gyza_60 a.144.2.1 (A:) Ribosomal protein L20 {Aquifex aeolicus 4e-19
>d2j01u1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]} Length = 117 Back     information, alignment and structure

class: All alpha proteins
fold: PABP domain-like
superfamily: Ribosomal protein L20
family: Ribosomal protein L20
domain: Ribosomal protein L20
species: Thermus thermophilus [TaxId: 274]
 Score =  142 bits (361), Expect = 6e-36
 Identities = 58/115 (50%), Positives = 78/115 (67%)

Query: 3   RVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWI 62
           R K GVV   KHKK+LK AKG++G R  + R A+  +  +  YAY  R+ +KRDFR LWI
Sbjct: 2   RAKTGVVRRRKHKKILKLAKGYWGLRSKSFRKARETLFAAGNYAYAHRKRRKRDFRRLWI 61

Query: 63  QRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
            RINAA R + LNYS FI+GL KAGI +DRK L+DLA+ +   F ++VE +++  
Sbjct: 62  VRINAACRQHGLNYSTFIHGLKKAGIEVDRKNLADLAVREPQVFAELVERAKAAQ 116


>d2zjrn1 a.144.2.1 (N:2-118) Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 1299]} Length = 117 Back     information, alignment and structure
>d2gyco1 a.144.2.1 (O:2-116) Ribosomal protein L20 {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1gyza_ a.144.2.1 (A:) Ribosomal protein L20 {Aquifex aeolicus [TaxId: 63363]} Length = 60 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target123 ribosomal protein L20 [Candidatus Liberibacter asiaticu
d2zjrn1117 Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 100.0
d2j01u1117 Ribosomal protein L20 {Thermus thermophilus [TaxId: 274 100.0
d2gyco1115 Ribosomal protein L20 {Escherichia coli [TaxId: 562]} 100.0
d1gyza_60 Ribosomal protein L20 {Aquifex aeolicus [TaxId: 63363]} 99.9
>d2zjrn1 a.144.2.1 (N:2-118) Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: All alpha proteins
fold: PABP domain-like
superfamily: Ribosomal protein L20
family: Ribosomal protein L20
domain: Ribosomal protein L20
species: Deinococcus radiodurans [TaxId: 1299]
Probab=100.00  E-value=0  Score=331.81  Aligned_cols=117  Identities=52%  Similarity=0.832  Sum_probs=115.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             87756655568998999974131564523699999999999999874699889999999998677999971899999999
Q gi|254780318|r    2 TRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFIN   81 (123)
Q Consensus         2 ~Rvk~g~~~~~rrkkilk~akGfrG~r~~~~r~A~~~v~kAl~yayrdRk~kKr~fR~LWI~RINAa~r~~g~sYS~fi~   81 (123)
                      ||||+|+++++||++||++||||+|++|+||++|+|+|+|||+|||+||+.+||+||+|||+|||||+|++|++||+||+
T Consensus         1 pRvk~g~~~~~rrkkilk~akGfrG~~s~~~r~A~~~v~kAl~yayrdRk~kKr~fR~LWI~RINAa~r~~gl~YS~fi~   80 (117)
T d2zjrn1           1 PRAKTGIVRRRRHKKVLKRAKGFWGSRSKQYRNAFQTLLNAATYEYRDRRNKKRDFRRLWIQRINAGARLHGMNYSTFIN   80 (117)
T ss_dssp             CCCCCTTHHHHHHHHHHTTCSSCCGGGGTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTCCHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             99866289999999999981646777655289999999999999996798889899999999999999990999999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             9996298646899999974198999999999999855
Q gi|254780318|r   82 GLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRLL  118 (123)
Q Consensus        82 ~L~~~~i~LnRKvLa~LAi~dp~~F~~lv~~ak~~l~  118 (123)
                      ||+++||+|||||||||||+||++|++||+++|++|+
T Consensus        81 ~L~~~~I~LnRK~Ls~lAi~dp~~F~~lv~~aK~a~~  117 (117)
T d2zjrn1          81 GLKRANIDLNRKVLADIAAREPEAFKALVDASRNARQ  117 (117)
T ss_dssp             HHHHCTTCCCCSSHHHHHHHCHHHHHHHHHHHHTTTC
T ss_pred             HHHHHCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHCC
T ss_conf             9999589773999999996099999999999998639



>d2j01u1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gyco1 a.144.2.1 (O:2-116) Ribosomal protein L20 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gyza_ a.144.2.1 (A:) Ribosomal protein L20 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 123 ribosomal protein L20 [Candidatus Liberibacter asi
2ftc_L_118 (L:) MRPL20 protein; mitochondrial ribosome, large 5e-31
2ghj_A_118 (A:) 50S ribosomal protein L20; folding intermedia 7e-31
2j01_U_47-11872 (U:47-118) 50S ribosomal protein L20; ribosome, tR 7e-23
3i1n_Q_50-11869 (Q:50-118) 50S ribosomal protein L20; ribosome str 3e-22
2zjr_N_52-11867 (N:52-118) 50S ribosomal protein L20; ribosome, la 8e-22
3bbo_S_1-7474 (S:1-74) Ribosomal protein L20; large ribosomal su 1e-22
2zjr_N_1-5151 (N:1-51) 50S ribosomal protein L20; ribosome, larg 1e-12
>2ftc_L (L:) MRPL20 protein; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus}Length = 118 Back     alignment and structure
 Score =  127 bits (321), Expect = 5e-31
 Identities = 41/116 (35%), Positives = 63/116 (54%), Gaps = 1/116 (0%)

Query: 3   RVK-RGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLW 61
            ++ R      + ++VLK A+ F GR+    R A   V R+     + R +KK++ R+LW
Sbjct: 2   WLRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMRTLW 61

Query: 62  IQRINAAVRVYDLNYSQFINGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSRL 117
           I RI AA + + L Y   I  L K  + L+RKVL+DLAI +  +FK +  L+  R 
Sbjct: 62  INRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRR 117


>2ghj_A (A:) 50S ribosomal protein L20; folding intermediate, ribosomal protein extension, structural protein; 2.90A {Aquifex aeolicus} PDB: 1gyz_ALength = 118 Back     alignment and structure
>2j01_U (U:47-118) 50S ribosomal protein L20; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus}Length = 72 Back     alignment and structure
>3i1n_Q (Q:50-118) 50S ribosomal protein L20; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_Q 3e1b_J 3e1d_J 1vs6_Q 3i1p_Q 3i1r_Q 3i1t_Q 3i20_Q 3i22_Q 2qam_Q* 1p85_O 1p86_O 2awb_Q 2aw4_Q 2i2v_Q 2j28_Q 2i2t_Q* 2qao_Q* 2qba_Q* 2qbc_Q* ...Length = 69 Back     alignment and structure
>2zjr_N (N:52-118) 50S ribosomal protein L20; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}Length = 67 Back     alignment and structure
>3bbo_S (S:1-74) Ribosomal protein L20; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 74 Back     alignment and structure
>2zjr_N (N:1-51) 50S ribosomal protein L20; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}Length = 51 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target123 ribosomal protein L20 [Candidatus Liberibacter asiaticu
2ftc_L_118 MRPL20 protein; mitochondrial ribosome, large ribo 100.0
2ghj_A_118 50S ribosomal protein L20; folding intermediate, r 100.0
2j01_U_47-11872 50S ribosomal protein L20; ribosome, tRNA, paromom 99.97
3i1n_Q_50-11869 50S ribosomal protein L20; ribosome structure, pro 99.96
2zjr_N_52-11867 50S ribosomal protein L20; ribosome, large ribosom 99.96
3bbo_S_1-7474 Ribosomal protein L20; large ribosomal subunit, sp 99.97
2zjr_N_1-5151 50S ribosomal protein L20; ribosome, large ribosom 99.74
>2ftc_L (L:) MRPL20 protein; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus} Back     alignment and structure
Probab=100.00  E-value=0  Score=312.68  Aligned_cols=115  Identities=37%  Similarity=0.516  Sum_probs=112.3

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHH
Q ss_conf             98775665556899899997413156452369999999999999987469988999999999867799997189999999
Q gi|254780318|r    1 MTRVKRGVVSSAKHKKVLKSAKGFYGRRKNTIRAAKAAVDRSQQYAYRDRRVKKRDFRSLWIQRINAAVRVYDLNYSQFI   80 (123)
Q Consensus         1 M~Rvk~g~~~~~rrkkilk~akGfrG~r~~~~r~A~~~v~kAl~yayrdRk~kKr~fR~LWI~RINAa~r~~g~sYS~fi   80 (123)
                      |+|. +|+++++|||+||++|+||+|++++||++|+|+|+|||+|||+||+.+||+||+|||+|||||+|++|+|||+||
T Consensus         2 ~~r~-Rg~~~~~Rrkkilk~AkGfrG~~s~~~r~A~~~v~kAl~yayr~Rk~kKR~fR~LWI~RINAa~r~~g~sYs~fi   80 (118)
T 2ftc_L            2 WLRN-RVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALI   80 (118)
T ss_pred             CCCC-CCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             4235-561579999999998164676765327999999999999999879988899999999999999987699899999


Q ss_pred             HHHHHCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             999962986468999999741989999999999998
Q gi|254780318|r   81 NGLHKAGIVLDRKVLSDLAITQLDSFKKIVELSRSR  116 (123)
Q Consensus        81 ~~L~~~~i~LnRKvLa~LAi~dp~~F~~lv~~ak~~  116 (123)
                      +||+++||.|||||||||||+||.+|++||+++|+.
T Consensus        81 ~~Lk~~~I~LnRKvLs~LAi~dp~~F~~lv~~ak~~  116 (118)
T 2ftc_L           81 GNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRR  116 (118)
T ss_pred             HHHHHHCCCCCHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             798996886649999999942999999999999861



>2ghj_A (A:) 50S ribosomal protein L20; folding intermediate, ribosomal protein extension, structural protein; 2.90A {Aquifex aeolicus} PDB: 1gyz_A Back     alignment and structure
>2j01_U (U:47-118) 50S ribosomal protein L20; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
>3i1n_Q (Q:50-118) 50S ribosomal protein L20; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1vs8_Q 3e1b_J 3e1d_J 1vs6_Q 3i1p_Q 3i1r_Q 3i1t_Q 3i20_Q 3i22_Q 2qam_Q* 1p85_O 1p86_O 2awb_Q 2aw4_Q 2i2v_Q 2j28_Q 2i2t_Q* 2qao_Q* 2qba_Q* 2qbc_Q* ... Back     alignment and structure
>2zjr_N (N:52-118) 50S ribosomal protein L20; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure
>3bbo_S (S:1-74) Ribosomal protein L20; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2zjr_N (N:1-51) 50S ribosomal protein L20; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure