254780322

254780322

SAM-dependent methyltransferase protein

GeneID in NCBI database:8209307Locus tag:CLIBASIA_01035
Protein GI in NCBI database:254780322Protein Accession:YP_003064735.1
Gene range:+(214734, 215555)Protein Length:273aa
Gene description:SAM-dependent methyltransferase protein
COG prediction:[Q] [R] SAM-dependent methyltransferases
KEGG prediction:SAM-dependent methyltransferase protein
SEED prediction:probable SAM-dependent methyltransferase protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MNILFDMQLINRNRLRSFRQKDFSVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSVDLILSPLNLHIINDTLEMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAETELTGGASPRVIPFMDIKSAGTLMEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPLIRRSKTPPYKSLFKRASTIYTEENSDLTGNVTASFSIIYVMGWKSTTFKTGTDE
ccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHccccHHHHHHccHHHHHHHHHEEEccHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccEEEEEEEEEEEcccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEccccccccccc
ccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccHHEEccccccHHHHHHHHcccccEEEEEcccHHHHHHHHHHHcccHHHcccccccccEEEcHHHHHHcccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccccccEccccEEEEcccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEccccccccccc
MNILFDMQLINRNRLrsfrqkdfsVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREviscpleeipsisqSVDLILSPLNLHIINDTLEMFSKINHmlkpggmflaaipgiGTLHELRKALLKAETeltggasprvipfmdiksagtlmeksgfispiidqdtYTVYYKSMLHLMHDlrgmgmsnplirrsktppykslFKRASTiyteensdltgnvtASFSIIYVMGwksttfktgtde
mnilfdmqlinrnrlrsfrqkdfSVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSVDLILSPLNLHIINDTLEMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAEteltggasprvipFMDIKSAGTLMEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPLIRRSKTPPYKSLFKRASTiyteensdltgnvTASFSIIYVMGWKSTTFKTGTDE
MNILFDMQLINRNRLRSFRQKDFSVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSVDLILSPLNLHIINDTLEMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAETELTGGASPRVIPFMDIKSAGTLMEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPLIRRSKTPPYKSLFKRASTIYTEENSDLTGNVTASFSIIYVMGWKSTTFKTGTDE
MNILFDMQLINRNRLRSFRQKDFSVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSVDLILSPLNLHIINDTLEMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAETELTGGASPRVIPFMDIKSAGTLMEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPL*******P*KSLFKRASTIYTEENSDLTGNVTASFSIIYVMG************
MNILFDMQLINRNRLRSFRQKDFSVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSVDLILSPLNLHIINDTLEMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAETELTGGASPRVIPFMDIKSAGTLMEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPLIRRSKTPPYKSLFKRASTIYTEENSDLTGNVTASFSIIYVMGWKSTTFKTGTDE
*NILFDMQLINRNRLRSFRQKDFSVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSVDLILSPLNLHIINDTLEMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAETELTGGASPRVIPFMDIKSAGTLMEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPLIRRSKTPPYKSLFKRASTIYTEENSDLTGNVTASFSIIYVMGWKST********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNILFDMQLINRNRLRSFRQKDFSVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSVDLILSPLNLHIINDTLEMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAETELTGGASPRVIPFMDIKSAGTLMEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPLIRRSKTPPYKSLFKRASTIYTEENSDLTGNVTASFSIIYVMGWKSTTFKTGTDE
MNILFDMQLINRNRLRSFRQKDFSVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSVDLILSPLNLHIINDTLEMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAETELTGGASPRVIPFMDIKSAGTLMEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPLIRRSKTPPYKSLFKRASTIYTEENSDLTGNVTASFSIIYVMGWKSTTFKTGTDE
MNILFDMQLINRNRLRSFRQKDFSVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSVDLILSPLNLHIINDTLEMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAETELTGGASPRVIPFMDIKSAGTLMEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPLIRRSKTPPYKSLFKRASTIYTEENSDLTGNVTASFSIIYVMGWKSTTFKTGTDE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target273 SAM-dependent methyltransferase protein [Candidatus Lib
315122253274 SAM-dependent methyltransferase protein [Candidatus Lib 1 1e-120
86359348294 SAM-dependent methyltransferase protein [Rhizobium etli 1 3e-73
222087311294 SAM-dependent methyltransferase protein [Agrobacterium 1 8e-70
159185777293 methyltransferase [Agrobacterium tumefaciens str. C58] 1 2e-69
209551109294 methyltransferase protein [Rhizobium leguminosarum bv. 1 3e-68
190893599294 methyltransferase [Rhizobium etli CIAT 652] Length = 29 1 4e-68
241206510294 methyltransferase protein [Rhizobium leguminosarum bv. 1 8e-68
327193401294 putative methyltransferase protein [Rhizobium etli CNPA 1 9e-68
332716311509 methyltransferase [Agrobacterium sp. H13-3] Length = 50 1 1e-67
116254027294 hypothetical protein RL4291 [Rhizobium leguminosarum bv 1 3e-67
>gi|315122253|ref|YP_004062742.1| SAM-dependent methyltransferase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 274 Back     alignment and organism information
 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/268 (77%), Positives = 235/268 (87%)

Query: 1   MNILFDMQLINRNRLRSFRQKDFSVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIV 60
           MN+LFDMQLIN+NRLRS RQKDFS +FLLD VAKEI+FRLNMIN+TF+NA+ELHG TGIV
Sbjct: 1   MNLLFDMQLINKNRLRSLRQKDFSSHFLLDIVAKEISFRLNMINKTFDNAMELHGATGIV 60

Query: 61  GYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSVDLILSPLNLHIINDTL 120
           G TCM+T+KI RMIR EISTEFST    V++CPLE+IPSI Q +DLILSPL LHIINDTL
Sbjct: 61  GRTCMKTQKISRMIRTEISTEFSTSDNTVLACPLEDIPSIPQPIDLILSPLTLHIINDTL 120

Query: 121 EMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAETELTGGASPRVIPFMDIKSAGTL 180
            MF KI + LK GG+FLAAIPG+GTL ELRK+LL+AETE+TGGASPR+IPFMDIKSAG L
Sbjct: 121 GMFLKIKNTLKRGGVFLAAIPGVGTLRELRKSLLQAETEITGGASPRIIPFMDIKSAGAL 180

Query: 181 MEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPLIRRSKTPPYKSLFKRASTIYT 240
           M+K+GFISPIIDQD YTVYYKSM HLMHDLR MGMSNPLI RS TPP KSLF RA+ IY 
Sbjct: 181 MQKAGFISPIIDQDNYTVYYKSMFHLMHDLRKMGMSNPLIHRSTTPPKKSLFTRAAEIYA 240

Query: 241 EENSDLTGNVTASFSIIYVMGWKSTTFK 268
           EENS+ TGNVTA+FSIIYV+GWKS+  K
Sbjct: 241 EENSESTGNVTANFSIIYVIGWKSSASK 268


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86359348|ref|YP_471240.1| SAM-dependent methyltransferase protein [Rhizobium etli CFN 42] Length = 294 Back     alignment and organism information
>gi|222087311|ref|YP_002545848.1| SAM-dependent methyltransferase protein [Agrobacterium radiobacter K84] Length = 294 Back     alignment and organism information
>gi|159185777|ref|NP_357097.2| methyltransferase [Agrobacterium tumefaciens str. C58] Length = 293 Back     alignment and organism information
>gi|209551109|ref|YP_002283026.1| methyltransferase protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 294 Back     alignment and organism information
>gi|190893599|ref|YP_001980141.1| methyltransferase [Rhizobium etli CIAT 652] Length = 294 Back     alignment and organism information
>gi|241206510|ref|YP_002977606.1| methyltransferase protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 294 Back     alignment and organism information
>gi|327193401|gb|EGE60301.1| putative methyltransferase protein [Rhizobium etli CNPAF512] Length = 294 Back     alignment and organism information
>gi|332716311|ref|YP_004443777.1| methyltransferase [Agrobacterium sp. H13-3] Length = 509 Back     alignment and organism information
>gi|116254027|ref|YP_769865.1| hypothetical protein RL4291 [Rhizobium leguminosarum bv. viciae 3841] Length = 294 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target273 SAM-dependent methyltransferase protein [Candidatus Lib
TIGR02072240 TIGR02072, BioC, biotin biosynthesis protein BioC 7e-16
pfam0824195 pfam08241, Methyltransf_11, Methyltransferase domain 0.002
KOG2940325 KOG2940, KOG2940, KOG2940, Predicted methyltransferase 5e-38
>gnl|CDD|162684 TIGR02072, BioC, biotin biosynthesis protein BioC Back     alignment and domain information
>gnl|CDD|149353 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|38151 KOG2940, KOG2940, KOG2940, Predicted methyltransferase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 273 SAM-dependent methyltransferase protein [Candidatus Lib
KOG2940325 consensus 100.0
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 100.0
PRK10258251 biotin biosynthesis protein BioC; Provisional 100.0
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 97.82
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 100.0
PRK08317241 hypothetical protein; Provisional 99.97
COG4106257 Tam Trans-aconitate methyltransferase [General function 99.97
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 99.94
PRK13341726 recombination factor protein RarA/unknown domain fusion 95.86
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 99.97
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 99.97
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 99.94
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 99.92
KOG1540296 consensus 99.87
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 99.87
PRK11036256 putative metallothionein SmtA; Provisional 99.86
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.83
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.75
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 99.7
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 99.68
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 99.6
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 99.58
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 99.42
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.22
pfam07942268 N2227 N2227-like protein. This family features sequence 98.86
pfam01234261 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family. 98.74
KOG3178342 consensus 98.46
pfam11968220 DUF3321 Protein of unknown function (DUF3321). This fam 98.05
KOG2798369 consensus 97.88
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.59
COG1189245 Predicted rRNA methylase [Translation, ribosomal struct 97.32
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 96.45
PRK13256226 thiopurine S-methyltransferase; Reviewed 95.74
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 99.96
PRK05785225 hypothetical protein; Provisional 99.89
KOG3010261 consensus 99.68
KOG1541270 consensus 99.6
pfam05175170 MTS Methyltransferase small domain. This domain is foun 99.51
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 99.23
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.19
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 99.18
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 99.14
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 99.03
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 98.94
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 98.89
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 98.81
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.8
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 98.8
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 98.69
pfam01739194 CheR CheR methyltransferase, SAM binding domain. CheR p 98.54
PRK10901428 16S rRNA methyltransferase B; Provisional 98.41
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 98.28
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 98.22
pfam09243275 Rsm22 Mitochondrial small ribosomal subunit Rsm22. Rsm2 98.19
PRK11933471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 97.99
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 97.88
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 97.74
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 97.68
TIGR03438301 probable methyltransferase. This model represents a dis 97.63
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 97.59
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 96.98
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 96.5
TIGR00563487 rsmB ribosomal RNA small subunit methyltransferase B; I 96.45
pfam05185447 PRMT5 PRMT5 arginine-N-methyltransferase. The human hom 95.83
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 95.31
COG0286489 HsdM Type I restriction-modification system methyltrans 95.18
KOG0822649 consensus 95.01
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, ribo 94.46
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 99.95
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 99.92
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 99.78
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 99.75
KOG1270282 consensus 99.71
KOG4300252 consensus 99.68
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 99.61
pfam08003315 Methyltransf_9 Protein of unknown function (DUF1698). T 99.56
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 99.49
KOG2361264 consensus 99.32
pfam05148214 Methyltransf_8 Hypothetical methyltransferase. This fam 99.31
pfam05219265 DREV DREV methyltransferase. This family contains DREV 99.29
KOG2899288 consensus 99.16
KOG3045325 consensus 99.14
TIGR00452316 TIGR00452 methyltransferase, putative; InterPro: IPR010 99.08
pfam05891217 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransfer 98.94
pfam06080201 DUF938 Protein of unknown function (DUF938). This famil 98.82
), spermine synthase () and putrescine N-methyltransferase () . The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00417">TIGR00417284 speE spermidine synthase; InterPro: IPR001045 Synonym(s 98.57
pfam12147311 Hydrolase_5 Putative lysophospholipase. This domain is 98.4
COG2521287 Predicted archaeal methyltransferase [General function 98.35
pfam05724203 TPMT Thiopurine S-methyltransferase (TPMT). This family 98.29
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 98.29
COG4627185 Uncharacterized protein conserved in bacteria [Function 97.98
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: 97.96
pfam03492331 Methyltransf_7 SAM dependent carboxyl methyltransferase 97.93
COG4798238 Predicted methyltransferase [General function predictio 97.5
pfam04672268 DUF574 Protein of unknown function (DUF574). Family of 97.49
COG2520341 Predicted methyltransferase [General function predictio 96.61
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 99.79
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 99.77
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 99.72
PRK11207198 tellurite resistance protein TehB; Provisional 99.51
PRK06202233 hypothetical protein; Provisional 99.4
pfam03848192 TehB Tellurite resistance protein TehB. 99.28
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 99.26
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 99.26
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 99.25
pfam05401201 NodS Nodulation protein S (NodS). This family consists 99.2
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 99.18
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.15
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 99.12
PRK06922679 hypothetical protein; Provisional 99.12
COG4123248 Predicted O-methyltransferase [General function predict 99.09
KOG1975389 consensus 99.08
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 99.07
TIGR00740247 TIGR00740 methyltransferase, putative; InterPro: IPR005 99.07
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 99.06
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 99.03
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 99.02
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 99.02
pfam03141 506 DUF248 Putative methyltransferase. Members of this fami 99.02
PRK12335289 tellurite resistance protein TehB; Provisional 98.93
KOG1269364 consensus 98.9
PRK07402196 precorrin-6B methylase; Provisional 98.87
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 98.87
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 98.86
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 98.83
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 98.79
PRK04457262 spermidine synthase; Provisional 98.76
pfam10294171 Methyltransf_16 Putative methyltransferase. 98.73
KOG1271227 consensus 98.73
KOG1331293 consensus 98.73
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 98.71
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 98.7
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 98.68
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 98.66
pfam00891239 Methyltransf_2 O-methyltransferase. This family include 98.66
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 98.61
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 98.56
COG0500257 SmtA SAM-dependent methyltransferases [Secondary metabo 98.56
PRK03612516 spermidine synthase; Provisional 98.56
TIGR00091216 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; Inter 98.53
COG4122219 Predicted O-methyltransferase [General function predict 98.52
KOG2904328 consensus 98.52
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 98.51
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal structu 98.51
PRK00811283 spermidine synthase; Provisional 98.5
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Methylate 98.47
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 98.42
KOG1499346 consensus 98.41
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 98.4
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 98.4
COG1352268 CheR Methylase of chemotaxis methyl-accepting proteins 98.38
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 98.36
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associated met 98.36
PRK00536262 speE spermidine synthase; Provisional 98.35
COG1041347 Predicted DNA modification methylase [DNA replication, 98.32
KOG3987288 consensus 98.25
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 98.19
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.17
KOG1661237 consensus 98.16
PRK01581363 speE spermidine synthase; Validated 98.08
KOG4589232 consensus 98.04
KOG1500 517 consensus 98.01
COG1092393 Predicted SAM-dependent methyltransferases [General fun 97.91
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 97.89
KOG2352 482 consensus 97.84
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 97.83
KOG0820315 consensus 97.73
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 97.67
TIGR00755277 ksgA dimethyladenosine transferase; InterPro: IPR011530 97.65
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 97.56
pfam01269229 Fibrillarin Fibrillarin. 97.51
PTZ00338296 dimethyladenosine transferase; Provisional 97.49
TIGR03439319 methyl_EasF probable methyltransferase domain, EasF fam 97.47
PRK11783 716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 97.29
KOG1709271 consensus 97.24
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 97.23
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 97.17
PRK04266226 fibrillarin; Provisional 97.15
COG4262508 Predicted spermidine synthase with an N-terminal membra 97.11
PTZ00146296 fibrillarin; Provisional 97.11
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 97.03
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 96.98
PRK09880343 L-idonate 5-dehydrogenase; Provisional 96.98
COG5459 484 Predicted rRNA methylase [Translation, ribosomal struct 96.89
KOG1663237 consensus 96.78
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 96.71
KOG3201201 consensus 96.64
pfam05971254 Methyltransf_10 Protein of unknown function (DUF890). T 96.58
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 96.41
pfam03059277 NAS Nicotianamine synthase protein. Nicotianamine synth 96.35
KOG0024354 consensus 96.31
pfam03269177 DUF268 Caenorhabditis protein of unknown function, DUF2 96.21
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 96.2
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 96.04
COG4076252 Predicted RNA methylase [General function prediction on 96.02
KOG1098 780 consensus 96.02
KOG2793248 consensus 95.99
KOG1099294 consensus 95.92
PRK10083339 putative dehydrogenase; Provisional 95.91
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 95.9
PRK11760356 putative RNA 2'-O-ribose methyltransferase; Provisional 95.89
PHA02056279 putative methyltransferase 95.79
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 95.74
KOG2920282 consensus 95.69
PRK13771332 putative alcohol dehydrogenase; Provisional 95.56
COG3897218 Predicted methyltransferase [General function predictio 95.28
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 95.18
pfam07091248 FmrO Ribosomal RNA methyltransferase (FmrO). This famil 95.14
pfam03141506 DUF248 Putative methyltransferase. Members of this fami 94.9
PRK07502307 cyclohexadienyl dehydrogenase; Validated 94.86
KOG1122460 consensus 94.82
PRK09422338 alcohol dehydrogenase; Provisional 94.61
TIGR00478240 tly hemolysin A; InterPro: IPR004538 Hemolysins are exo 93.64
KOG1562337 consensus 92.95
PRK11727326 putative SAM-dependent methyltransferase; Provisional 92.95
COG4301321 Uncharacterized conserved protein [Function unknown] 92.9
KOG2915314 consensus 92.53
TIGR00446284 nop2p NOL1/NOP2/sun family putative RNA methylase; Inte 91.63
PRK08507275 prephenate dehydrogenase; Validated 91.56
PRK00050309 mraW S-adenosyl-methyltransferase MraW; Provisional 91.09
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 98.15
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 97.81
smart00650169 rADc Ribosomal RNA adenine dimethylases. 97.7
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 97.42
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 97.34
KOG3420185 consensus 97.31
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 97.08
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 96.93
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 96.52
KOG3115249 consensus 96.19
KOG2730263 consensus 95.73
pfam04816204 DUF633 Family of unknown function (DUF633). This family 95.47
COG1565370 Uncharacterized conserved protein [Function unknown] 94.73
TIGR02143361 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: 94.65
pfam02636240 DUF185 Uncharacterized ACR, COG1565. This family contai 94.36
COG2384226 Predicted SAM-dependent methyltransferase [General func 94.32
pfam07757112 AdoMet_MTase Predicted AdoMet-dependent methyltransfera 92.8
KOG2187534 consensus 92.51
KOG1501 636 consensus 91.42
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 90.94
KOG3191209 consensus 98.03
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 97.46
pfam06859110 Bin3 Bicoid-interacting protein 3 (Bin3). This family r 93.94
PRK11524284 putative methyltransferase; Provisional 90.23
>KOG2940 consensus Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>pfam07942 N2227 N2227-like protein Back     alignment and domain information
>pfam01234 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family Back     alignment and domain information
>KOG3178 consensus Back     alignment and domain information
>pfam11968 DUF3321 Protein of unknown function (DUF3321) Back     alignment and domain information
>KOG2798 consensus Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein; InterPro: IPR014182 Members of this entry form a distinct subset of the larger family of oxidoreductases that includes zinc-binding alcohol dehydrogenases and NADPH:quinone reductases Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>KOG3010 consensus Back     alignment and domain information
>KOG1541 consensus Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>pfam01739 CheR CheR methyltransferase, SAM binding domain Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00107 gidB glucose-inhibited division protein B; Reviewed Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>pfam09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22 Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR00138 gidB methyltransferase GidB; InterPro: IPR003682 GidB (glucose-inhibited division protein B) appears to be present and in a single copy in all complete eubacterial genomes so far Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase B; InterPro: IPR004573 This family consists of bacterial sequences related to Escherichia coli rsmB, an rRNA SAM-dependent methyltransferase Back     alignment and domain information
>pfam05185 PRMT5 PRMT5 arginine-N-methyltransferase Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L-threonine 3-dehydrogenase (1 Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>KOG0822 consensus Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>pfam05148 Methyltransf_8 Hypothetical methyltransferase Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>KOG3045 consensus Back     alignment and domain information
>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>pfam05891 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransferase Back     alignment and domain information
>pfam06080 DUF938 Protein of unknown function (DUF938) Back     alignment and domain information
>TIGR00417 speE spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (Back     alignment and domain information
>pfam12147 Hydrolase_5 Putative lysophospholipase Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT) Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: IPR014088 Members of this protein family include S-adenosylmethionine-dependent C-20 methyltransferase (BchU), part of the pathway of bacteriochlorophyll c production in photosynthetic green sulphur bacteria Back     alignment and domain information
>pfam03492 Methyltransf_7 SAM dependent carboxyl methyltransferase Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>pfam04672 DUF574 Protein of unknown function (DUF574) Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>pfam05401 NodS Nodulation protein S (NodS) Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1975 consensus Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 TIGR00740 methyltransferase, putative; InterPro: IPR005271 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>pfam01728 FtsJ FtsJ-like methyltransferase Back     alignment and domain information
>pfam03141 DUF248 Putative methyltransferase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG1269 consensus Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>KOG1331 consensus Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>pfam00891 Methyltransf_2 O-methyltransferase Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2 Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395 This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>KOG1499 consensus Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3987 consensus Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>KOG1661 consensus Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>KOG4589 consensus Back     alignment and domain information
>KOG1500 consensus Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG2352 consensus Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG0820 consensus Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase; InterPro: IPR011530 This family of proteins represent the rRNA adenine dimethylases (e Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>pfam01269 Fibrillarin Fibrillarin Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG1709 consensus Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>pfam08123 DOT1 Histone methylation protein DOT1 Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1663 consensus Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>KOG3201 consensus Back     alignment and domain information
>pfam05971 Methyltransf_10 Protein of unknown function (DUF890) Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>pfam03059 NAS Nicotianamine synthase protein Back     alignment and domain information
>KOG0024 consensus Back     alignment and domain information
>pfam03269 DUF268 Caenorhabditis protein of unknown function, DUF268 Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>KOG1098 consensus Back     alignment and domain information
>KOG2793 consensus Back     alignment and domain information
>KOG1099 consensus Back     alignment and domain information
>PRK10083 putative dehydrogenase; Provisional Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>PRK11760 putative RNA 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PHA02056 putative methyltransferase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>KOG2920 consensus Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam07091 FmrO Ribosomal RNA methyltransferase (FmrO) Back     alignment and domain information
>pfam03141 DUF248 Putative methyltransferase Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>KOG1122 consensus Back     alignment and domain information
>PRK09422 alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR00478 tly hemolysin A; InterPro: IPR004538 Hemolysins are exotoxins that attack blood cell membranes and cause cell rupture Back     alignment and domain information
>KOG1562 consensus Back     alignment and domain information
>PRK11727 putative SAM-dependent methyltransferase; Provisional Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2915 consensus Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase; InterPro: IPR011023 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
</
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information