254780323

254780323

ATP/ADP translocase

GeneID in NCBI database:8209308Locus tag:CLIBASIA_01040
Protein GI in NCBI database:254780323Protein Accession:YP_003064736.1
Gene range:-(215813, 217288)Protein Length:491aa
Gene description:ATP/ADP translocase
COG prediction:[C] ATP/ADP translocase
KEGG prediction:ATP/ADP translocase; K03301 ATP:ADP antiporter, AAA family
SEED prediction:Nucleotide related transporter , NTT family
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM12 TM-Helix
TOPPREDnone TM-Helix
HMMTOP12 TM-Helix
MEMSAT7 TM-Helix
MEMSAT_SVM11 TM-Helix
PHOBIUS14 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-
MAHNQKILSVLLKIWQVFCAVKMSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYVLTDPQQYSPKRGSVKKKLKLSVLESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVIQSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEHHcccccEEEEEccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcc
ccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHcccccccHEEEccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MAHNQKILSVLLKIWQVFCAVKMSEAKKFIPMTLMMFLVLFNfstlrpikdslvvphmGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLlypyrdflhpspESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLyvltdpqqyspkrgsvkkkLKLSVLESLRMALNSKYLGYLVLLVICYGTainlvegpwkekvrqlyptQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFedallpftedVIKLVPLALAVFLGSLQNVLSKATKytmfdstkemafiplddefrtkGKAVVDVIGGRMAKSGGAVIQSFIFMlfpmatfssivPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE
MAHNQKILSVLLKIWQVFCAVKMSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYVLtdpqqyspkrgsvkkkLKLSVLESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEmafiplddefrtKGKAVVDVIGGRMAKSGGAVIQSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE
MAHNQKILSVLLKIWQVFCAVKMSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLfyvvvsffvsffaifafLLYPYRDFLHPSPESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMiyysmltlilssillmAVYRWMNLYVLTDPQQYSPKRGsvkkklklsvleslRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITgggffvfvIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVIQSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE
**************WQVFCAVKMSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYV*************************LRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVIQSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYT******
MAHNQKILSVLLKIWQVFCAVKMSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYVLTDPQQYSPKRGSVKKKLKLSVLESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVIQSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE
****QKILSVLLKIWQVFCAVKMSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYVLTDPQQYSPKRGSVKKKLKLSVLESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVIQSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHNQKILSVLLKIWQVFCAVKMSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYVLTDPQQYSPKRGSVKKKLKLSVLESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVIQSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE
MAHNQKILSVLLKIWQVFCAVKMSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYVLTDPQQYSPKRGSVKKKLKLSVLESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVIQSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE
MAHNQKILSVLLKIWQVFCAVKMSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYVLTDPQQYSPKRGSVKKKLKLSVLESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVIQSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target491 ATP/ADP translocase [Candidatus Liberibacter asiaticus
261363601469 nucleotide tansporter [Candidatus Liberibacter asiaticu 1 0.0
272573848477 ATP/ADP translocase [Candidatus Liberibacter solanacear 1 0.0
315122252469 ATP/ADP translocase [Candidatus Liberibacter solanacear 1 0.0
229586293501 ATP/ADP translocase [Rickettsia africae ESF-5] Length = 1 1e-137
157825209498 ADP,ATP carrier protein [Rickettsia akari str. Hartford 1 1e-137
157826528498 ATP/ADP translocase [Rickettsia bellii OSU 85-389] Leng 1 1e-135
91206170498 ATP/ADP translocase [Rickettsia bellii RML369-C] Length 1 1e-134
15603932498 ADP,ATP carrier protein [Rickettsia prowazekii str. Mad 1 1e-134
51473290498 ADP/ATP carrier protein 1 [Rickettsia typhi str. Wilmin 1 1e-133
189183706491 ADP,ATP carrier protein homolog [Orientia tsutsugamushi 1 1e-133
>gi|261363601|gb|ACX71867.1| nucleotide tansporter [Candidatus Liberibacter asiaticus] Length = 469 Back     alignment and organism information
 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/469 (100%), Positives = 469/469 (100%)

Query: 23  MSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILY 82
           MSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILY
Sbjct: 1   MSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMGAEIISFVKLWCVFPSAILFTILY 60

Query: 83  MKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIY 142
           MKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIY
Sbjct: 61  MKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIY 120

Query: 143 LAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGI 202
           LAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGI
Sbjct: 121 LAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGI 180

Query: 203 VKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYVLTDPQQYSPKRGSVKKKLKLSV 262
           VKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYVLTDPQQYSPKRGSVKKKLKLSV
Sbjct: 181 VKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYVLTDPQQYSPKRGSVKKKLKLSV 240

Query: 263 LESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTG 322
           LESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTG
Sbjct: 241 LESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTG 300

Query: 323 IVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPL 382
           IVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPL
Sbjct: 301 IVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPL 360

Query: 383 ALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVI 442
           ALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVI
Sbjct: 361 ALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVI 420

Query: 443 QSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE 491
           QSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE
Sbjct: 421 QSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISKE 469


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|272573848|gb|ACZ95367.1| ATP/ADP translocase [Candidatus Liberibacter solanacearum] Length = 477 Back     alignment and organism information
>gi|315122252|ref|YP_004062741.1| ATP/ADP translocase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 469 Back     alignment and organism information
>gi|229586293|ref|YP_002844794.1| ATP/ADP translocase [Rickettsia africae ESF-5] Length = 501 Back     alignment and organism information
>gi|157825209|ref|YP_001492929.1| ADP,ATP carrier protein [Rickettsia akari str. Hartford] Length = 498 Back     alignment and organism information
>gi|157826528|ref|YP_001495592.1| ATP/ADP translocase [Rickettsia bellii OSU 85-389] Length = 498 Back     alignment and organism information
>gi|91206170|ref|YP_538525.1| ATP/ADP translocase [Rickettsia bellii RML369-C] Length = 498 Back     alignment and organism information
>gi|15603932|ref|NP_220447.1| ADP,ATP carrier protein [Rickettsia prowazekii str. Madrid E] Length = 498 Back     alignment and organism information
>gi|51473290|ref|YP_067047.1| ADP/ATP carrier protein 1 [Rickettsia typhi str. Wilmington] Length = 498 Back     alignment and organism information
>gi|189183706|ref|YP_001937491.1| ADP,ATP carrier protein homolog [Orientia tsutsugamushi str. Ikeda] Length = 491 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target491 ATP/ADP translocase [Candidatus Liberibacter asiaticus
TIGR00769472 TIGR00769, AAA, ADP/ATP carrier protein family 1e-135
COG3202509 COG3202, COG3202, ATP/ADP translocase [Energy productio 1e-124
pfam03219491 pfam03219, TLC, TLC ATP/ADP transporter 1e-172
>gnl|CDD|162032 TIGR00769, AAA, ADP/ATP carrier protein family Back     alignment and domain information
>gnl|CDD|33015 COG3202, COG3202, ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|146045 pfam03219, TLC, TLC ATP/ADP transporter Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 491 ATP/ADP translocase [Candidatus Liberibacter asiaticus
pfam03219491 TLC TLC ATP/ADP transporter. 100.0
TIGR00769491 AAA ADP/ATP carrier protein family; InterPro: IPR004667 100.0
COG3202509 ATP/ADP translocase [Energy production and conversion] 100.0
pfam01306413 LacY_symp LacY proton/sugar symporter. This family is c 99.59
PRK11646400 multidrug resistance protein MdtH; Provisional 99.56
PRK09528418 lacY galactoside permease; Reviewed 99.49
PRK03545390 sugar efflux transporter; Provisional 99.43
PRK10489416 enterobactin exporter EntS; Provisional 99.33
PRK05122395 major facilitator superfamily transporter; Provisional 99.19
PRK11652394 emrD multidrug resistance protein D; Provisional 99.11
PRK12382393 hypothetical protein; Provisional 99.01
COG2814394 AraJ Arabinose efflux permease [Carbohydrate transport 98.36
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion transpo 97.36
PRK09874406 drug efflux system protein MdtG; Provisional 99.78
PRK10054395 putative MFS-type transporter YdeE; Provisional 99.54
TIGR00792470 gph sugar (Glycoside-Pentoside-Hexuronide) transporter; 99.53
pfam07690345 MFS_1 Major Facilitator Superfamily. 99.43
PRK12307426 putative sialic acid transporter; Provisional 99.34
PRK11128383 putative 3-phenylpropionic acid transporter; Provisiona 99.2
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT; Pro 99.13
PRK10091389 MFS transport protein AraJ; Provisional 99.07
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a large 98.93
PRK03893486 putative sialic acid transporter; Provisional 98.85
PRK10213394 nepI ribonucleoside transporter; Reviewed 98.56
pfam05977 524 DUF894 Bacterial protein of unknown function (DUF894). 98.51
PRK03633381 putative MFS family transporter protein; Provisional 98.38
TIGR00882397 2A0105 oligosaccharide:H+ symporter; InterPro: IPR00057 98.31
KOG1330493 consensus 98.31
TIGR00900387 2A0121 H+ Antiporter protein; InterPro: IPR004751 Drug 98.21
KOG2615451 consensus 97.95
KOG2816463 consensus 97.9
TIGR00895413 2A0115 MFS transporter, aromatic acid:H+ symporter (AAH 97.15
PRK08633 1150 2-acyl-glycerophospho-ethanolamine acyltransferase; Val 95.83
PRK06814 1139 acylglycerophosphoethanolamine acyltransferase; Provisi 93.15
TIGR00899377 2A0120 sugar efflux transporter; InterPro: IPR004750 Th 93.01
PRK10429473 melibiose:sodium symporter; Provisional 99.5
PRK11902402 ampG muropeptide transporter; Reviewed 98.52
pfam03825400 Nuc_H_symport Nucleoside H+ symporter. 99.33
PRK09952438 shikimate transporter; Provisional 99.04
TIGR00893427 2A0114 d-galactonate transporter; InterPro: IPR004744 D 98.09
pfam11700477 ATG22 Vacuole effluxer Atg22 like. Autophagy is a major 97.53
TIGR00883413 2A0106 MFS transporter, metabolite:H+ symporter (MHS) f 95.84
TIGR00898557 2A0119 cation transport protein; InterPro: IPR004749 Or 94.93
KOG2504509 consensus 94.66
PRK11462460 putative transporter; Provisional 99.15
COG2211467 MelB Na+/melibiose symporter and related transporters [ 99.13
PRK09669442 putative symporter YagG; Provisional 98.99
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.01
TIGR00710400 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA s 98.53
PRK11043401 inner membrane transport protein YdhC; Provisional 98.52
KOG2533495 consensus 98.23
PRK10406432 alpha-ketoglutarate transporter; Provisional 98.09
pfam03092425 BT1 BT1 family. Members of this family are transmembran 96.49
pfam01306413 LacY_symp LacY proton/sugar symporter. This family is c 96.36
KOG2532466 consensus 96.15
PRK09528418 lacY galactoside permease; Reviewed 96.08
COG2270438 Permeases of the major facilitator superfamily [General 95.45
PRK09848457 glucuronide transporter; Provisional 98.98
pfam03137582 OATP Organic Anion Transporter Polypeptide (OATP) famil 97.22
PRK09874406 drug efflux system protein MdtG; Provisional 97.12
KOG3626 735 consensus 96.83
pfam11700477 ATG22 Vacuole effluxer Atg22 like. Autophagy is a major 96.78
PRK03893486 putative sialic acid transporter; Provisional 96.64
pfam03209402 PUCC PUCC protein. This protein is required for high-le 94.22
TIGR02718391 sider_RhtX_FptX siderophore transporter, RhtX/FptX fami 91.36
PRK10473392 multidrug efflux system protein MdtL; Provisional 98.93
PRK09556463 uhpT sugar phosphate antiporter; Reviewed 98.92
PRK03699394 hypothetical protein; Provisional 98.82
PRK11663434 regulatory protein UhpC; Provisional 98.81
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisional 98.72
PRK10642490 proline/glycine betaine transporter; Provisional 97.97
COG0738422 FucP Fucose permease [Carbohydrate transport and metabo 97.52
PRK11195415 major facilitator family transporter; Provisional 97.42
PRK11646400 multidrug resistance protein MdtH; Provisional 97.27
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transport a 97.0
PRK10133438 L-fucose transporter; Provisional 96.48
PRK10489416 enterobactin exporter EntS; Provisional 96.39
PRK11902402 ampG muropeptide transporter; Reviewed 96.29
PRK03545390 sugar efflux transporter; Provisional 95.3
KOG3098461 consensus 94.45
PRK03699394 hypothetical protein; Provisional 94.24
pfam00083449 Sugar_tr Sugar (and other) transporter. 98.58
TIGR00880148 2_A_01_02 Multidrug resistance protein; InterPro: IPR00 97.42
KOG0255521 consensus 91.85
PRK10504471 multidrug efflux system protein MdtE; Provisional 98.36
KOG2325488 consensus 97.03
PRK09584500 tppB putative tripeptide transporter permease; Reviewed 95.69
PRK12307426 putative sialic acid transporter; Provisional 98.14
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT; Pro 97.99
pfam07690345 MFS_1 Major Facilitator Superfamily. 97.67
PRK12382393 hypothetical protein; Provisional 95.54
PRK03633381 putative MFS family transporter protein; Provisional 94.45
PRK10429473 melibiose:sodium symporter; Provisional 97.78
PRK09848457 glucuronide transporter; Provisional 96.97
pfam06609598 TRI12 Fungal trichothecene efflux pump (TRI12). This fa 96.53
TIGR00881404 2A0104 phosphoglycerate transporter family protein; Int 97.33
COG2211467 MelB Na+/melibiose symporter and related transporters [ 97.33
PRK10642490 proline/glycine betaine transporter; Provisional 96.33
KOG3762618 consensus 96.72
pfam00083449 Sugar_tr Sugar (and other) transporter. 96.48
PRK09952438 shikimate transporter; Provisional 95.93
COG2270438 Permeases of the major facilitator superfamily [General 95.28
PRK05122395 major facilitator superfamily transporter; Provisional 96.35
pfam05631354 DUF791 Protein of unknown function (DUF791). This famil 96.19
PRK11010490 ampG muropeptide transporter; Validated 95.48
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisional 95.41
PRK10207490 inner membrane transporter YhiP; Provisional 93.33
PRK11462460 putative transporter; Provisional 95.35
TIGR00883413 2A0106 MFS transporter, metabolite:H+ symporter (MHS) f 95.33
PRK09584500 tppB putative tripeptide transporter permease; Reviewed 94.78
>pfam03219 TLC TLC ATP/ADP transporter Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>pfam01306 LacY_symp LacY proton/sugar symporter Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK03545 sugar efflux transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK12382 hypothetical protein; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK10054 putative MFS-type transporter YdeE; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter; InterPro: IPR001927 It has been shown that integral membrane proteins that mediate the intake of a wide variety of molecules with the concomitant uptake of sodium ions (sodium symporters) can be grouped, on the basis of sequence and functional similarities into a number of distinct families Back     alignment and domain information
>pfam07690 MFS_1 Major Facilitator Superfamily Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>pfam05977 DUF894 Bacterial protein of unknown function (DUF894) Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter; InterPro: IPR000576 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) Back     alignment and domain information
>KOG1330 consensus Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein; InterPro: IPR004751 Drug antiporters which use the proton motive force for the active efflux of the drug Back     alignment and domain information
>KOG2615 consensus Back     alignment and domain information
>KOG2816 consensus Back     alignment and domain information
>TIGR00895 2A0115 MFS transporter, aromatic acid:H+ symporter (AAHS) family; InterPro: IPR004746 Benzoate transport proteins belong to this group Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter; InterPro: IPR004750 This family of proteins is an efflux system for lactose, glucose, aromatic glucosides and galactosides, cellobiose, maltose, a-methyl glucoside and other sugar compounds Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>pfam03825 Nuc_H_symport Nucleoside H+ symporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter; InterPro: IPR004744 D-galactonate transporters and other proteins that belong to the phthalate permease family are members of this group Back     alignment and domain information
>pfam11700 ATG22 Vacuole effluxer Atg22 like Back     alignment and domain information
>TIGR00883 2A0106 MFS transporter, metabolite:H+ symporter (MHS) family protein; InterPro: IPR004736 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein; InterPro: IPR004749 Organic cation transport proteins belong to this group Back     alignment and domain information
>KOG2504 consensus Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily; InterPro: IPR004812 The drug resistance transporter Bcr/CflA proteins are predicted to have 12 membrane-spanning regions Back     alignment and domain information
>PRK11043 inner membrane transport protein YdhC; Provisional Back     alignment and domain information
>KOG2533 consensus Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>pfam03092 BT1 BT1 family Back     alignment and domain information
>pfam01306 LacY_symp LacY proton/sugar symporter Back     alignment and domain information
>KOG2532 consensus Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>pfam03137 OATP Organic Anion Transporter Polypeptide (OATP) family Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>KOG3626 consensus Back     alignment and domain information
>pfam11700 ATG22 Vacuole effluxer Atg22 like Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>pfam03209 PUCC PUCC protein Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family; InterPro: IPR014090 RhtX from Sinorhizobium meliloti 1021 and FptX from Pseudomonas aeruginosa appear to be single polypeptide transporters, from the major facilitator family for import of siderophores as a means to import iron Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK03699 hypothetical protein; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11195 major facilitator family transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK03545 sugar efflux transporter; Provisional Back     alignment and domain information
>KOG3098 consensus Back     alignment and domain information
>PRK03699 hypothetical protein; Provisional Back     alignment and domain information
>pfam00083 Sugar_tr Sugar (and other) transporter Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein; InterPro: IPR004734 Multidrug resistance proteins are molecular pumps that participate in a low energy shock adaptive response in some bacteria Back     alignment and domain information
>KOG0255 consensus Back     alignment and domain information
>PRK10504 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>KOG2325 consensus Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>pfam07690 MFS_1 Major Facilitator Superfamily Back     alignment and domain information
>PRK12382 hypothetical protein; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>pfam06609 TRI12 Fungal trichothecene efflux pump (TRI12) Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein; InterPro: IPR000849 Proteins in this group are involved in the transport system that mediates the uptake of a number of sugar phosphates as well as the regulatory components that are responsible for induction of this transport system by external glucose 6-phosphate Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>KOG3762 consensus Back     alignment and domain information
>pfam00083 Sugar_tr Sugar (and other) transporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>pfam05631 DUF791 Protein of unknown function (DUF791) Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10207 inner membrane transporter YhiP; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 MFS transporter, metabolite:H+ symporter (MHS) family protein; InterPro: IPR004736 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target491 ATP/ADP translocase [Candidatus Liberibacter asiaticus
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, inner 99.54
2cfq_A417 Lactose permease; transport, transport mechanism, lacto 99.13
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS memb 98.92
2gfp_A375 EMRD, multidrug resistance protein D; membrane protein, 98.73
2cfq_A417 Lactose permease; transport, transport mechanism, lacto 97.6
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, inner 97.41
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS memb 93.62
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=99.54  E-value=9e-09  Score=85.28  Aligned_cols=249  Identities=8%  Similarity=-0.046  Sum_probs=133.6

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCHHHH
Q ss_conf             48544679999999999999999999999633899999999999999999999998421001465234555531010134
Q gi|254780323|r   58 MGAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYL  137 (491)
Q Consensus        58 ~g~e~lp~l~~~~~l~~s~~~~~~y~~l~~~~~~~~l~~~~~~~f~~~~~~f~~~l~p~~~~~~~~~~~~~~~~~~~~~~  137 (491)
                      .+.+.+.++.....+ ...+..+..+++.+|++||+.+.......++..+++++.-....                    
T Consensus        59 ~s~~~~g~i~s~~~~-~~~i~~~~~G~l~Dr~Grr~~l~~~~~~~~~~~~~~~~~~~~~~--------------------  117 (451)
T 1pw4_A           59 FSRGDLGFALSGISI-AYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATS--------------------  117 (451)
T ss_dssp             TCSSCHHHHHHHHHH-HHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHS--------------------
T ss_pred             CCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH--------------------
T ss_conf             499999999999999-99999999999999809799999999999999999999988888--------------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC--H
Q ss_conf             45787655579999999999999999999999999864098998999999998999999998899999963012322--4
Q gi|254780323|r  138 KWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELM--I  215 (491)
Q Consensus       138 ~~~~~~~~~w~~~~fYv~~e~~~~~vis~~FW~~~n~~f~~~qaKRlf~li~~g~~ig~i~gg~~~~~l~~~~~~~~--~  215 (491)
                             +.|..........+....... .--.++.|.+.++|-.+..++...+.++|..+++..........+...  .
T Consensus       118 -------~~~~~~~~~~~~g~~~~~~~~-~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~  189 (451)
T 1pw4_A          118 -------SIAVMFVLLFLCGWFQGMGWP-PCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAAL  189 (451)
T ss_dssp             -------SSSHHHHHHHHHHHHHHHTHH-HHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCT
T ss_pred             -------HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             -------999999999999885898889-999999997799982631021055642688999999999986655788988


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC---------CCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHH
Q ss_conf             8999999999999999999999840245223---------3200001123457888999999830967999999999999
Q gi|254780323|r  216 YYSMLTLILSSILLMAVYRWMNLYVLTDPQQ---------YSPKRGSVKKKLKLSVLESLRMALNSKYLGYLVLLVICYG  286 (491)
Q Consensus       216 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~~k~i~~s~yL~~l~~~v~~~~  286 (491)
                      ...........+...    ...+..+.+...         ...+..++++++........+.+.++|.+..++...++..
T Consensus       190 ~~~~~~~~~~~~~~~----~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  265 (451)
T 1pw4_A          190 YMPAFCAILVALFAF----AMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEQELTAKQIFMQYVLPNKLLWYIAIANVFVY  265 (451)
T ss_dssp             HHHHHHHHHHHHHHH----HHCCCSSTTTCCCSCTTTCCC-------------CCTHHHHHHTSSCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH----HHCCCCHHCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHHH
T ss_conf             898999999999999----9723450001320377887754323333332101113577888842318999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999983299899999999999999999999999978999973167
Q gi|254780323|r  287 TAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWF  342 (491)
Q Consensus       287 ~~~tl~e~~~k~~~~~~~~~~~~~~af~g~~~~~v~i~tii~qll~~~ll~r~G~~  342 (491)
                      ..........-....+....+.+......   ....+..++..++.+++.+|.+-.
T Consensus       266 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~g~~~~~~~~~  318 (451)
T 1pw4_A          266 LLRYGILDWSPTYLKEVKHFALDKSSWAY---FLYEYAGIPGTLLCGWMSDKVFRG  318 (451)
T ss_dssp             HHHHHHHHHHHHHBTTBSCCCHHHHHHHH---HHHHHHHHHHHHHHHHHHHHTSTT
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHH---HHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99998887788999871489700347999---998999999999989999997322



>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target491 ATP/ADP translocase [Candidatus Liberibacter asiaticus
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli [Tax 99.55
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.42
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 97.54
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli [Tax 96.93
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.55  E-value=4.3e-09  Score=85.90  Aligned_cols=378  Identities=7%  Similarity=-0.039  Sum_probs=176.3

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCHHHHH
Q ss_conf             85446799999999999999999999996338999999999999999999999984210014652345555310101344
Q gi|254780323|r   59 GAEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLK  138 (491)
Q Consensus        59 g~e~lp~l~~~~~l~~s~~~~~~y~~l~~~~~~~~l~~~~~~~f~~~~~~f~~~l~p~~~~~~~~~~~~~~~~~~~~~~~  138 (491)
                      +.+.+.++.....+ ...+..+..+++.+|++||+.+........+..+++++.-....                     
T Consensus        57 s~~~~g~~~s~~~~-~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~---------------------  114 (447)
T d1pw4a_          57 SRGDLGFALSGISI-AYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATS---------------------  114 (447)
T ss_dssp             CSSCHHHHHHHHHH-HHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHS---------------------
T ss_pred             CHHHHHHHHHHHHH-HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCHHHH---------------------
T ss_conf             99999999999999-99999999999999808659999999999999865045640333---------------------


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             57876555799999999999999999999999998640989989999999989999999988999999630123224899
Q gi|254780323|r  139 WFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYS  218 (491)
Q Consensus       139 ~~~~~~~~w~~~~fYv~~e~~~~~vis~~FW~~~n~~f~~~qaKRlf~li~~g~~ig~i~gg~~~~~l~~~~~~~~~~~~  218 (491)
                            +.|.....-....+....... .-.++..|.++++|-.+..++.+.+.++|.++++..........+.....+.
T Consensus       115 ------~~~~~~~~~~~~g~~~~~~~~-~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~  187 (447)
T d1pw4a_         115 ------SIAVMFVLLFLCGWFQGMGWP-PCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALY  187 (447)
T ss_dssp             ------SSSHHHHHHHHHHHHHHHTHH-HHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTH
T ss_pred             ------HHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCH
T ss_conf             ------078999999999875444555-7888999999862012333333234422456530024667654211221100


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCC----------CCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999998402452233----------20000112345788899999983096799999999999999
Q gi|254780323|r  219 MLTLILSSILLMAVYRWMNLYVLTDPQQY----------SPKRGSVKKKLKLSVLESLRMALNSKYLGYLVLLVICYGTA  288 (491)
Q Consensus       219 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~k~i~~s~yL~~l~~~v~~~~~~  288 (491)
                      ..........+...   ......+++...          .....++++++........+.+.++|.+..+....++....
T Consensus       188 ~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  264 (447)
T d1pw4a_         188 MPAFCAILVALFAF---AMMRDTPQSCGLPPIEEYKNDYPDDYNEKAEQELTAKQIFMQYVLPNKLLWYIAIANVFVYLL  264 (447)
T ss_dssp             HHHHHHHHHHHHHH---HHCCCSSTTTCCCSCTTTCCC-------------CCTHHHHHHTSSCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH---HHCCCCHHHCCCCHHHHHHHHCCCCHHHCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             11245899999999---863345000133214666640011000000011221467899997172377888776554321


Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999998329989999999999999999999999997899997316789999999999999999999841012
Q gi|254780323|r  289 INLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDA  368 (491)
Q Consensus       289 ~tl~e~~~k~~~~~~~~~~~~~~af~g~~~~~v~i~tii~qll~~~ll~r~G~~~~l~i~Pi~~li~~~~ff~~~~~~~~  368 (491)
                      ........-....+....+.+.....   ....++..++..++.+++.+|++-+......-...................
T Consensus       265 ~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  341 (447)
T d1pw4a_         265 RYGILDWSPTYLKEVKHFALDKSSWA---YFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVYWMNPAG  341 (447)
T ss_dssp             HHHHHHHHHHHBTTBSCCCHHHHHHH---HHHHHHHHHHHHHHHHHHHHHTSTTCHHHHHHHHHHHHHHHHHHTTSCCTT
T ss_pred             HHCCHHHHHHHCCCCCCCCCCHHHHH---HHCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             00100233210122322222202454---310112455554443111000123343332101577888899998750345


Q ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             34666787300207999999999999999876344646687775226976736577767888764667779999999999
Q gi|254780323|r  369 LLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDVIGGRMAKSGGAVIQSFIFM  448 (491)
Q Consensus       369 ~~~~~~~~~~~~~l~~~v~~~~i~~~~~k~~kYsl~~p~~E~l~~pl~~~~R~k~K~~iD~~~~r~Gk~~gs~~~~~l~~  448 (491)
                                 .+..  .....+   ..-........+.....-.-.|++.|..+.++...+.+-.|-..+..+...+..
T Consensus       342 -----------~~~~--~~~~~~---~~g~~~~~~~~~~~~~~~~~~p~~~~g~~~g~~~~~~~~~g~~~~~~~~g~~~~  405 (447)
T d1pw4a_         342 -----------NPTV--DMICMI---VIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVD  405 (447)
T ss_dssp             -----------CHHH--HHHHHH---HHHHHHTHHHHHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             -----------CHHH--HHHHHH---HHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             -----------2899--999999---999999999999999999876997999999999999999999999999999998


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             830000233379999999999999999999970899998534
Q gi|254780323|r  449 LFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEYTQLISK  490 (491)
Q Consensus       449 ~~~~~~~~~~~~~~~~~~i~i~~~Wi~~~~~L~~~y~~~i~~  490 (491)
                      .+   +............+..+..+......-.|+.++..+|
T Consensus       406 ~~---g~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~e  444 (447)
T d1pw4a_         406 FF---GWDGGFMVMIGGSILAVILLIVVMIGEKRRHEQLLQE  444 (447)
T ss_dssp             SS---CSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGGG
T ss_pred             HH---CHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
T ss_conf             75---8699999999999999999999998213647878873



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target491 ATP/ADP translocase [Candidatus Liberibacter asiaticus
2cfq_A_417 Lactose permease; transport, transport mechanism, 99.27
2gfp_A_375 EMRD, multidrug resistance protein D; membrane pro 98.76
1pw4_A_230-451222 Glycerol-3-phosphate transporter; transmembrane, i 98.49
1pw4_A_1-229229 Glycerol-3-phosphate transporter; transmembrane, i 98.41
1pw4_A_230-451222 Glycerol-3-phosphate transporter; transmembrane, i 98.31
2cfq_A_417 Lactose permease; transport, transport mechanism, 98.07
1pw4_A_1-229229 Glycerol-3-phosphate transporter; transmembrane, i 93.68
>2cfq_A (A:) Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} Back     alignment and structure
Probab=99.27  E-value=7.2e-09  Score=87.24  Aligned_cols=371  Identities=11%  Similarity=0.114  Sum_probs=196.5

Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHH
Q ss_conf             81123279999999999999999999987788651248--5446799999999999999999999996338999999999
Q gi|254780323|r   22 KMSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVVPHMG--AEIISFVKLWCVFPSAILFTILYMKLSNILETEKLFYVVV   99 (491)
Q Consensus        22 ~~~E~~~~~~~~~~~F~i~~~y~~lr~~rd~l~~~~~g--~e~lp~l~~~~~l~~s~~~~~~y~~l~~~~~~~~l~~~~~   99 (491)
                      ++-+.|.+..+.+..|+..+++...-|.--....+..|  +..+-.+.....+ ...+..+..+++.||++||+.+....
T Consensus         2 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~l~~~~g~s~~~~g~~~s~~~l-~~~i~~~~~G~l~Dr~grr~~l~~~~   80 (417)
T 2cfq_A            2 YYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDTGIIFAAISL-FSLLFQPLFGLLSDKLGLRKYLLWII   80 (417)
T ss_dssp             TTTSCHHHHHHHHHHHHHHHHHHHHTTTHHHHHHTTTCCCTTTSHHHHHHHHH-HHHHHHHHHHHHHTTSTTCCHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             97647069999999999999999999999999998029999999999999999-99999999999999817439999999


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC--
Q ss_conf             999999999999984210014652345555310101344578765557999999999999999999999999986409--
Q gi|254780323|r  100 SFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLKWFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITK--  177 (491)
Q Consensus       100 ~~f~~~~~~f~~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~fYv~~e~~~~~vis~~FW~~~n~~f~--  177 (491)
                      .........+..........                           |......+........... .......+...  
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~---------------------------~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~  132 (417)
T 2cfq_A           81 TGMLVMFAPFFIFIFGPLLQ---------------------------YNILVGSIVGGIYLGFCFN-AGAPAVEAFIEKV  132 (417)
T ss_dssp             HHTTSCHHHHHHHTHHHHHH---------------------------TTCCHHHHGGGSSTTHHHH-TTHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCHHHH---------------------------HHHHHHHHHHHCCCCCCCH-HHHHHHHHCCCCH
T ss_conf             99999877655311213678---------------------------8899888776302223312-4555432203312


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             89989999999989999999988999999630123224899999999999999999999984024522332000011234
Q gi|254780323|r  178 TEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIYYSMLTLILSSILLMAVYRWMNLYVLTDPQQYSPKRGSVKKK  257 (491)
Q Consensus       178 ~~qaKRlf~li~~g~~ig~i~gg~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~  257 (491)
                      .++..|.++....++++|..+|+.....+....+...................       ......+++....+.+++++
T Consensus       133 ~~~~~~~~~~~~~~~~~g~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~  205 (417)
T 2cfq_A          133 SRRSNFEFGRARMFGCVGWALGASIVGIMFTINNQFVFWLGSGCALILAVLLF-------FAKTDAPSSATVANAVGANH  205 (417)
T ss_dssp             HHHHTCCHHHHSSSTTTHHHHHHHHHHHHHHHCSHHHHTTTTTTTTTHHHHSC-------SSCCCCSCSSCSSSSSSSCC
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHH-------EECCCCCHHHHHHCCCCCCC
T ss_conf             45556666666665213334454323433234664211267777777654421-------01036730233210000113


Q ss_pred             CCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             57888999999830967999999999999999999999999999832998999999999999999999999999789999
Q gi|254780323|r  258 LKLSVLESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNSYAQFMGQFIQWTGIVTIVFMILGSNILK  337 (491)
Q Consensus       258 ~~~~~~~~~k~i~~s~yL~~l~~~v~~~~~~~tl~e~~~k~~~~~~~~~~~~~~af~g~~~~~v~i~tii~qll~~~ll~  337 (491)
                      .+ ...+..+...+..................................+...-....+.......+..++..++.+++.+
T Consensus       206 ~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  284 (417)
T 2cfq_A          206 SA-FSLKLALELFRQPKLWFLSLYVIGVSCTYDVFDQQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPLIIN  284 (417)
T ss_dssp             CC-CCHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSSHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CC-CCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCC
T ss_conf             33-33322211222221036788899987653222332101110001222222222222221000111112201222222


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHEECC
Q ss_conf             7316789999999999999999999841012346667873002079999999999999998763446-466877752269
Q gi|254780323|r  338 SFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMF-DSTKEMAFIPLD  416 (491)
Q Consensus       338 r~G~~~~l~i~Pi~~li~~~~ff~~~~~~~~~~~~~~~~~~~~~l~~~v~~~~i~~~~~k~~kYsl~-~p~~E~l~~pl~  416 (491)
                      |+|-+..+.+.-+...+....   ..... ..             . ......+   + -..-++.. -+.....-.-.|
T Consensus       285 r~g~~~~~~~~~~~~~~~~~~---~~~~~-~~-------------~-~~~~~~~---l-~g~~~~~~~~~~~~~~~~~~~  342 (417)
T 2cfq_A          285 RIGGKNALLLAGTIMSVRIIG---SSFAT-SA-------------L-EVVILKT---L-HMFEVPFLLVGCFKYITSQFE  342 (417)
T ss_dssp             HHCHHHHHHHHHHHHHHHHHH---HTTCC-SH-------------H-HHHHHTT---H-HHHHHHHHHHHHHHHHHHHSC
T ss_pred             CCCCCCCHHHHHHHHHHHHHH---HCCCC-CH-------------H-HHHHHHH---H-HHHHHHHHHHHHHHHHHHHCC
T ss_conf             222211104667899988640---00111-11-------------7-8899999---9-999999999999999999879


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             76736577767888764667779999999999830
Q gi|254780323|r  417 DEFRTKGKAVVDVIGGRMAKSGGAVIQSFIFMLFP  451 (491)
Q Consensus       417 ~~~R~k~K~~iD~~~~r~Gk~~gs~~~~~l~~~~~  451 (491)
                      ++.|.++.+....+...+|...|..+...+...++
T Consensus       343 ~~~~g~~~~~~~~~~~~lg~~~g~~~~g~l~~~~g  377 (417)
T 2cfq_A          343 VRFSATIYLVCFCFFKQLAMIFMSVLAGNMYESIG  377 (417)
T ss_dssp             HHHHHHHHHHHHTTTHHHHHHHHTHHHHTHHHHSH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             73899999999999999999999999999999979



>2gfp_A (A:) EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>1pw4_A (A:230-451) Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} Back     alignment and structure
>1pw4_A (A:1-229) Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} Back     alignment and structure
>1pw4_A (A:230-451) Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} Back     alignment and structure
>2cfq_A (A:) Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} Back     alignment and structure
>1pw4_A (A:1-229) Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} Back     alignment and structure