254780324

254780324

hypothetical protein CLIBASIA_01045

GeneID in NCBI database:8209309Locus tag:CLIBASIA_01045
Protein GI in NCBI database:254780324Protein Accession:YP_003064737.1
Gene range:-(217926, 218111)Protein Length:61aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60-
MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYRR
cccccccEEEEEcccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccHHHEEccccEEEEEEHHHHHHHHHcEEEEEEEEEccccEEEcccccccccccccc
MGNSVNSTILKAegsivnikwrdaNVWLLFGVVMVYFSISFSSRivdyvdqkhdlyhdyrr
MGNSVNSTILKaegsivnikWRDANVWLLFGVVMVYFSISFssrivdyvdqkhdlyhdyrr
MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYRR
******S***KAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYR*
MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYRR
****VNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLY*****
oooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooo
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYRR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target61 hypothetical protein CLIBASIA_01045 [Candidatus Liberib
31512225166 hypothetical protein CKC_02515 [Candidatus Liberibacter 1 7e-14
>gi|315122251|ref|YP_004062740.1| hypothetical protein CKC_02515 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 66 Back     alignment and organism information
 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 1/61 (1%)

Query: 1  MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYR 60
          +G+SVNS   K + S   +KWRD N+WLLFG+V+VYFSISFSSR+VDYVD+ H  Y+DY+
Sbjct: 2  IGDSVNSIDFKEKSSSDGVKWRDGNIWLLFGIVVVYFSISFSSRVVDYVDENH-FYYDYK 60

Query: 61 R 61
          R
Sbjct: 61 R 61


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00