254780325

254780325

mutator MutT protein

GeneID in NCBI database:8209310Locus tag:CLIBASIA_01050
Protein GI in NCBI database:254780325Protein Accession:YP_003064738.1
Gene range:-(218229, 218654)Protein Length:141aa
Gene description:mutator MutT protein
COG prediction:[L] [R] NTP pyrophosphohydrolases including oxidative damage repair enzymes
KEGG prediction:mutT; mutator MutT protein; K03574 7,8-dihydro-8-oxoguanine triphosphatase [EC:3.6.1.-]
SEED prediction:5-methyl-dCTP pyrophosphohydrolase (EC 3.6.1.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Nudix proteins (nucleoside triphosphate hydrolases)
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MIDVNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNYSMLPADLSLISFLRKHALHM
cccccccccEEEEEEEEEccccEEEEEEEccccccccEEEccccEEcccccHHHHHHHHHHHHHccEEcccEEEEEEEEEcccccEEEEEEEEEEEEccccccccccccEEEEcHHHHHccccccccHHHHHHHHHHHccc
ccccccccEEEEEEEEEEcccccEEEEEccccccccccccccEEEccccccHHHHHHHHHHHHHcEEEEEcccccccEEcccccccEEEEEEEEEEccccccccccccccEEEcHHHHcccccccccHHHHHHHHcccccc
MIDVNLKKILLVVACAvfepggkvllscrpkdkshgefwefpggkiedgetpeEALTRELFEELAIVvkpfslvpltfishpyekfhllmpffvchcfegipqscegqqLQWVALDdlqnysmlpadLSLISFLRKHALHM
midvnlkkILLVVACAvfepggkvllscrpkdkshgefwefpggkiedgeTPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNYSMLPADLSLISFLRKHALHM
MIDVNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNYSMLPADLSLISFLRKHALHM
******K****VVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNYSMLPADLSLISFLRKHAL**
MIDVNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNYSMLPADLSLISFLRKHALHM
***VNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNYSMLPADLSLISFLRKH****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDVNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNYSMLPADLSLISFLRKHALHM
MIDVNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNYSMLPADLSLISFLRKHALHM
MIDVNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNYSMLPADLSLISFLRKHALHM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target141 mutator MutT protein [Candidatus Liberibacter asiaticus
254780557160 dinucleoside polyphosphate hydrolase [Candidatus L 0.002
>gi|254780557|ref|YP_003064970.1| dinucleoside polyphosphate hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Back     alignment
 Score = 33.1 bits (74), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 34/88 (38%), Gaps = 12/88 (13%)

Query: 28  CRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFH 87
           C   +  H   W+ P G I   E P +A  REL+EE  I  K  SL+        Y+   
Sbjct: 23  CFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI--KSISLLGQGDSYIQYD--- 77

Query: 88  LLMPFFVCHCFEGIPQSCEGQQLQWVAL 115
                F  HC +       GQ  +W A 
Sbjct: 78  -----FPAHCIQ--ENGYVGQMQKWFAF 98

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target141 mutator MutT protein [Candidatus Liberibacter asiaticus
315122250140 mutator MutT protein [Candidatus Liberibacter solanacea 1 3e-52
110635339137 mutator MutT protein [Mesorhizobium sp. BNC1] Length = 1 2e-36
209551112142 mutator MutT protein [Rhizobium leguminosarum bv. trifo 1 3e-36
327193398142 NTP pyrophosphohydrolase protein [Rhizobium etli CNPAF5 1 3e-36
222149926135 NTP pyrophosphohydrolase MutT family [Agrobacterium vit 1 9e-36
190893602142 NTP pyrophosphohydrolase [Rhizobium etli CIAT 652] Leng 1 1e-35
153008360138 mutator MutT protein [Ochrobactrum anthropi ATCC 49188] 1 2e-35
239832958138 mutator mutT protein [Ochrobactrum intermedium LMG 3301 1 2e-35
241206513137 mutator MutT protein [Rhizobium leguminosarum bv. trifo 1 2e-35
260428820133 CTP pyrophosphohydrolase [Citreicella sp. SE45] Length 1 3e-35
>gi|315122250|ref|YP_004062739.1| mutator MutT protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 140 Back     alignment and organism information
 Score =  207 bits (527), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 121/140 (86%)

Query: 2   IDVNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELF 61
           +++  KKILLVVACAVF    KVLLSCRPK+KS+  FWEFPGGKIEDGETPEEAL REL 
Sbjct: 1   MNIMPKKILLVVACAVFGSYEKVLLSCRPKNKSYAGFWEFPGGKIEDGETPEEALVRELS 60

Query: 62  EELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNY 121
           EEL+I+VKP  L+PLTF+SH Y+KFHLLMPFF CH FEG P+SCEGQ+++WV+LDD++N+
Sbjct: 61  EELSIIVKPVDLIPLTFVSHSYDKFHLLMPFFSCHHFEGSPRSCEGQEIKWVSLDDVKNH 120

Query: 122 SMLPADLSLISFLRKHALHM 141
           S+LPAD  LISFL++++ H+
Sbjct: 121 SILPADQPLISFLQRYSHHI 140


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110635339|ref|YP_675547.1| mutator MutT protein [Mesorhizobium sp. BNC1] Length = 137 Back     alignment and organism information
>gi|209551112|ref|YP_002283029.1| mutator MutT protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 142 Back     alignment and organism information
>gi|327193398|gb|EGE60298.1| NTP pyrophosphohydrolase protein [Rhizobium etli CNPAF512] Length = 142 Back     alignment and organism information
>gi|222149926|ref|YP_002550883.1| NTP pyrophosphohydrolase MutT family [Agrobacterium vitis S4] Length = 135 Back     alignment and organism information
>gi|190893602|ref|YP_001980144.1| NTP pyrophosphohydrolase [Rhizobium etli CIAT 652] Length = 142 Back     alignment and organism information
>gi|153008360|ref|YP_001369575.1| mutator MutT protein [Ochrobactrum anthropi ATCC 49188] Length = 138 Back     alignment and organism information
>gi|239832958|ref|ZP_04681287.1| mutator mutT protein [Ochrobactrum intermedium LMG 3301] Length = 138 Back     alignment and organism information
>gi|241206513|ref|YP_002977609.1| mutator MutT protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 137 Back     alignment and organism information
>gi|260428820|ref|ZP_05782797.1| CTP pyrophosphohydrolase [Citreicella sp. SE45] Length = 133 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target141 mutator MutT protein [Candidatus Liberibacter asiaticus
PRK08999 312 PRK08999, PRK08999, hypothetical protein; Provisional 3e-34
PRK10776129 PRK10776, PRK10776, nucleoside triphosphate pyrophospho 1e-22
pfam00293133 pfam00293, NUDIX, NUDIX domain 1e-21
cd02883123 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfam 5e-18
PRK10546135 PRK10546, PRK10546, pyrimidine (deoxy)nucleoside tripho 7e-18
cd04673122 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydro 6e-15
TIGR00586128 TIGR00586, mutt, mutator mutT protein 1e-14
cd03427137 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the 2e-14
cd04690118 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydro 2e-13
COG1051145 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotid 1e-12
cd04699129 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydro 2e-12
cd04682122 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydro 9e-12
cd04683120 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydro 2e-11
cd04676129 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydro 2e-11
cd04677132 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydro 3e-11
cd04684128 cd04684, Nudix_Hydrolase_25, Contains a crystal structu 2e-10
cd04678129 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydro 3e-10
cd04679125 cd04679, Nudix_Hydrolase_20, Members of the Nudix hydro 4e-10
COG0494161 COG0494, MutT, NTP pyrophosphohydrolases including oxid 4e-10
cd04687128 cd04687, Nudix_Hydrolase_28, Members of the Nudix hydro 9e-10
cd04669121 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydro 1e-09
cd04688126 cd04688, Nudix_Hydrolase_29, Members of the Nudix hydro 2e-09
cd04667112 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydro 8e-09
cd04696125 cd04696, Nudix_Hydrolase_37, Members of the Nudix hydro 1e-08
cd04680120 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydro 1e-08
cd04681130 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydro 3e-08
cd04691117 cd04691, Nudix_Hydrolase_32, Members of the Nudix hydro 4e-08
cd04672123 cd04672, Nudix_Hydrolase_14, Members of the Nudix hydro 7e-08
cd03671147 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraph 8e-08
cd04689125 cd04689, Nudix_Hydrolase_30, Members of the Nudix hydro 2e-07
PRK15472141 PRK15472, PRK15472, nucleoside triphosphatase NudI; Pro 5e-07
cd04664129 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrol 1e-06
cd03424137 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADP 3e-06
cd04695131 cd04695, Nudix_Hydrolase_36, Members of the Nudix hydro 7e-06
cd03426157 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a m 8e-06
cd03431118 cd03431, DNA_Glycosylase_C, DNA glycosylase (MutY in ba 8e-06
KOG0648295 KOG0648, KOG0648, KOG0648, Predicted NUDIX hydrolase FG 1e-05
cd04686131 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydro 1e-05
cd03674138 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrol 2e-05
KOG2839145 KOG2839, KOG2839, KOG2839, Diadenosine and diphosphoino 2e-05
cd04670127 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydro 3e-05
cd04693127 cd04693, Nudix_Hydrolase_34, Members of the Nudix hydro 2e-04
cd03429131 cd03429, NADH_pyrophosphatase, NADH pyrophosphatase, a 0.001
PRK03759184 PRK03759, PRK03759, isopentenyl-diphosphate delta-isome 0.002
KOG3069246 KOG3069, KOG3069, KOG3069, Peroxisomal NUDIX hydrolase 0.003
cd02885165 cd02885, IPP_Isomerase, Isopentenyl diphosphate (IPP) i 0.004
cd03425124 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosph 1e-35
cd04665118 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrol 9e-08
cd04685133 cd04685, Nudix_Hydrolase_26, Members of the Nudix hydro 2e-07
TIGR02705156 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD 3e-07
cd03673131 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6 4e-07
cd04671123 cd04671, Nudix_Hydrolase_13, Members of the Nudix hydro 6e-07
cd04511130 cd04511, Nudix_Hydrolase_4, Members of the Nudix hydrol 1e-06
cd03428130 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraph 6e-06
cd04700142 cd04700, DR1025_like, DR1025 from Deinococcus radiodura 1e-05
KOG3084345 KOG3084, KOG3084, KOG3084, NADH pyrophosphatase I of th 5e-05
cd03675134 cd03675, Nudix_Hydrolase_2, Contains a crystal structur 2e-04
cd03672145 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the ca 4e-04
cd03430144 cd03430, GDPMH, GDP-mannose glycosyl hydrolase (AKA GDP 5e-04
cd04692144 cd04692, Nudix_Hydrolase_33, Members of the Nudix hydro 7e-04
cd04666122 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrol 7e-04
KOG3041225 KOG3041, KOG3041, KOG3041, Nucleoside diphosphate-sugar 9e-04
COG2816279 COG2816, NPY1, NTP pyrophosphohydrolases containing a Z 0.003
PRK09438148 PRK09438, nudB, dihydroneopterin triphosphate pyrophosp 0.003
PRK00714156 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed 3e-07
PRK11762185 PRK11762, nudE, adenosine nucleotide hydrolase NudE; Pr 5e-04
PRK05379340 PRK05379, PRK05379, bifunctional nicotinamide mononucle 7e-04
>gnl|CDD|181607 PRK08999, PRK08999, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|182721 PRK10776, PRK10776, nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|144032 pfam00293, NUDIX, NUDIX domain Back     alignment and domain information
>gnl|CDD|72880 cd02883, Nudix_Hydrolase, Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|182536 PRK10546, PRK10546, pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|72909 cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|129674 TIGR00586, mutt, mutator mutT protein Back     alignment and domain information
>gnl|CDD|72885 cd03427, MTH1, MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|72925 cd04690, Nudix_Hydrolase_31, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|31251 COG1051, COG1051, ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|72933 cd04699, Nudix_Hydrolase_39, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72917 cd04682, Nudix_Hydrolase_23, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72918 cd04683, Nudix_Hydrolase_24, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72911 cd04676, Nudix_Hydrolase_17, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72912 cd04677, Nudix_Hydrolase_18, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72919 cd04684, Nudix_Hydrolase_25, Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>gnl|CDD|72913 cd04678, Nudix_Hydrolase_19, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72914 cd04679, Nudix_Hydrolase_20, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|30840 COG0494, MutT, NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>gnl|CDD|72922 cd04687, Nudix_Hydrolase_28, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72905 cd04669, Nudix_Hydrolase_11, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72923 cd04688, Nudix_Hydrolase_29, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72904 cd04667, Nudix_Hydrolase_10, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72931 cd04696, Nudix_Hydrolase_37, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72915 cd04680, Nudix_Hydrolase_21, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72916 cd04681, Nudix_Hydrolase_22, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72926 cd04691, Nudix_Hydrolase_32, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72908 cd04672, Nudix_Hydrolase_14, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72891 cd03671, Ap4A_hydrolase_plant_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|72924 cd04689, Nudix_Hydrolase_30, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|185369 PRK15472, PRK15472, nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>gnl|CDD|72901 cd04664, Nudix_Hydrolase_7, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72882 cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>gnl|CDD|72930 cd04695, Nudix_Hydrolase_36, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72884 cd03426, CoAse, Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>gnl|CDD|72889 cd03431, DNA_Glycosylase_C, DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>gnl|CDD|35867 KOG0648, KOG0648, KOG0648, Predicted NUDIX hydrolase FGF-2 and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|72921 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72894 cd03674, Nudix_Hydrolase_1, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|38050 KOG2839, KOG2839, KOG2839, Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|72906 cd04670, Nudix_Hydrolase_12, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72928 cd04693, Nudix_Hydrolase_34, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72887 cd03429, NADH_pyrophosphatase, NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>gnl|CDD|179643 PRK03759, PRK03759, isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>gnl|CDD|38279 KOG3069, KOG3069, KOG3069, Peroxisomal NUDIX hydrolase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|72881 cd02885, IPP_Isomerase, Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>gnl|CDD|72883 cd03425, MutT_pyrophosphohydrolase, The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>gnl|CDD|72902 cd04665, Nudix_Hydrolase_8, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72920 cd04685, Nudix_Hydrolase_26, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|131752 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD Back     alignment and domain information
>gnl|CDD|72893 cd03673, Ap6A_hydrolase, Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|72907 cd04671, Nudix_Hydrolase_13, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72897 cd04511, Nudix_Hydrolase_4, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72886 cd03428, Ap4A_hydrolase_human_like, Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|72934 cd04700, DR1025_like, DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>gnl|CDD|38294 KOG3084, KOG3084, KOG3084, NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|72895 cd03675, Nudix_Hydrolase_2, Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>gnl|CDD|72892 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>gnl|CDD|72888 cd03430, GDPMH, GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>gnl|CDD|72927 cd04692, Nudix_Hydrolase_33, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|72903 cd04666, Nudix_Hydrolase_9, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>gnl|CDD|38251 KOG3041, KOG3041, KOG3041, Nucleoside diphosphate-sugar hydrolase of the MutT (NUDIX) family [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|32645 COG2816, NPY1, NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|181858 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|179094 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>gnl|CDD|183303 PRK11762, nudE, adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>gnl|CDD|180046 PRK05379, PRK05379, bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 141 mutator MutT protein [Candidatus Liberibacter asiaticus
PRK08999 312 hypothetical protein; Provisional 100.0
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Provision 100.0
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohy 100.0
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase 100.0
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hyd 99.97
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase super 99.96
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase super 99.95
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase super 99.95
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase super 99.95
TIGR00586150 mutt mutator mutT protein; InterPro: IPR003561 MutT is 99.94
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase super 99.94
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase super 99.94
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase super 99.94
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase super 99.94
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase super 99.93
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase super 99.93
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase super 99.93
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase superf 99.93
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of the 99.92
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase super 99.92
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase super 99.91
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase super 99.91
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase super 99.91
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a memb 99.91
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose m 99.9
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase super 99.9
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase super 99.9
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of the N 99.9
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase super 99.9
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase super 99.9
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase superf 99.89
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily of enz 99.89
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase super 99.89
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrola 99.89
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase superf 99.89
PRK09438148 ntpA dATP pyrophosphohydrolase; Provisional 99.89
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase super 99.88
pfam00293133 NUDIX NUDIX domain. 99.87
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase super 99.85
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport and me 99.85
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase super 99.85
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (A 99.84
PRK05379340 bifunctional nicotinamide mononucleotide adenylyltransf 99.83
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase super 99.83
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a member of 99.83
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase super 99.83
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (A 99.79
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase super 99.78
PRK00714156 dinucleoside polyphosphate hydrolase; Reviewed 99.78
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase super 99.76
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase super 99.76
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase super 99.75
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, 99.74
COG2816279 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, 99.69
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provisional 99.69
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic su 99.69
PRK00241257 nudC NADH pyrophosphatase; Reviewed 99.68
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member of t 99.66
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase superf 99.65
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) cata 99.63
PRK10707190 hypothetical protein; Provisional 99.61
PRK11762185 nudE ADP-ribose diphosphatase NudE; Provisional 99.59
cd03431118 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and 99.57
KOG3084345 consensus 99.5
COG0494161 MutT NTP pyrophosphohydrolases including oxidative dama 99.45
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 99.43
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase superf 99.42
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase superf 99.24
KOG2839145 consensus 99.23
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase superf 99.21
PRK10880350 adenine DNA glycosylase; Provisional 99.19
KOG0648295 consensus 99.08
COG1443185 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] 99.05
KOG3069246 consensus 99.05
PRK13910290 DNA glycosylase MutY; Provisional 98.91
KOG3041225 consensus 98.88
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) cata 98.54
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) i 98.49
COG4119161 Predicted NTP pyrophosphohydrolase [DNA replication, re 98.48
KOG0142225 consensus 98.24
KOG4195275 consensus 98.1
COG1194342 MutY A/G-specific DNA glycosylase [DNA replication, rec 98.08
TIGR02150190 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, typ 97.99
KOG2937 348 consensus 97.67
COG4112203 Predicted phosphoesterase (MutT family) [General functi 97.58
KOG4313306 consensus 96.96
KOG4548263 consensus 95.51
TIGR02705158 nudix_YtkD nucleoside triphosphatase YtkD; InterPro: IP 99.52
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase superf 99.21
TIGR00052199 TIGR00052 conserved hypothetical protein TIGR00052; Int 97.74
KOG4432 405 consensus 96.63
KOG4432405 consensus 95.07
KOG1689221 consensus 96.55
TIGR01084297 mutY A/G-specific adenine glycosylase; InterPro: IPR005 93.71
TIGR00586150 mutt mutator mutT protein; InterPro: IPR003561 MutT is 91.24
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein; InterPro: IPR003561 MutT is a small bacterial protein (~12-15kDa) involved in the GO system responsible for removing an oxidatively damaged form of guanine (8-hydroxy- guanine or 7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK09438 ntpA dATP pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>pfam00293 NUDIX NUDIX domain Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00714 dinucleoside polyphosphate hydrolase; Reviewed Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>PRK10707 hypothetical protein; Provisional Back     alignment and domain information
>PRK11762 nudE ADP-ribose diphosphatase NudE; Provisional Back     alignment and domain information
>cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone Back     alignment and domain information
>KOG3084 consensus Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>KOG2839 consensus Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>KOG0648 consensus Back     alignment and domain information
>COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] Back     alignment and domain information
>KOG3069 consensus Back     alignment and domain information
>PRK13910 DNA glycosylase MutY; Provisional Back     alignment and domain information
>KOG3041 consensus Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>KOG0142 consensus Back     alignment and domain information
>KOG4195 consensus Back     alignment and domain information
>COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1; InterPro: IPR011876 This entry represents type 1 of two non-homologous families of the enzyme isopentenyl-diphosphate delta-isomerase (IPP isomerase) Back     alignment and domain information
>KOG2937 consensus Back     alignment and domain information
>COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] Back     alignment and domain information
>KOG4313 consensus Back     alignment and domain information
>KOG4548 consensus Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD; InterPro: IPR014078 The proteins in this entry belong to the nudix family and share some sequence identity with Escherichia coli MutT but appear not to be functionally interchangeable with it Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00052 TIGR00052 conserved hypothetical protein TIGR00052; InterPro: IPR004385 This entry describes a family of proteins which appear to catalyse the hydrolysis of phosphorus-containing acid anhydrides such as nucleoside diphosphate, for example ADP-mannose and UDP-glucose Back     alignment and domain information
>KOG4432 consensus Back     alignment and domain information
>KOG4432 consensus Back     alignment and domain information
>KOG1689 consensus Back     alignment and domain information
>TIGR01084 mutY A/G-specific adenine glycosylase; InterPro: IPR005760 The DNA repair enzyme MutY plays an important role in the prevention of DNA mutations resulting from the presence of the oxidatively damaged lesion 7,8-dihydro-8-oxo-2'-deoxyguanosine (8-OxoG) Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein; InterPro: IPR003561 MutT is a small bacterial protein (~12-15kDa) involved in the GO system responsible for removing an oxidatively damaged form of guanine (8-hydroxy- guanine or 7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target141 mutator MutT protein [Candidatus Liberibacter asiaticus
3hhj_A158 Crystal Structure Of Mutator Mutt From Bartonella H 3e-27
3r03_A144 The Crystal Structure Of Nudix Hydrolase From Rhodo 7e-27
1ppx_A129 Solution Structure Of The Mutt Pyrophosphohydrolase 6e-19
3ees_A153 Structure Of The Rna Pyrophosphohydrolase Bdrpph Le 2e-17
3gwy_A140 Crystal Structure Of Putative Ctp Pyrophosphohydrol 1e-13
3grn_A153 Crystal Structure Of Mutt Protein From Methanosarci 4e-10
2pbt_B134 Crystal Structure Of Ap4a Hydrolase (Aq_158) From A 5e-10
1iry_A156 Solution Structure Of The Hmth1, A Nucleotide Pool 8e-10
3q93_A176 Crystal Structure Of Human 8-Oxo-Dgtpase (Mth1) Len 8e-10
3oga_A165 1.75 Angstrom Resolution Crystal Structure Of A Put 1e-09
3eds_A153 Crystal Structure Of A MutNUDIX FAMILY PROTEIN FROM 2e-08
3n77_A144 Crystal Structure Of Idp01880, Putative Ntp Pyropho 2e-08
2b06_A155 Crystal Structure Of The MuttNUDIX FAMILY PROTEIN F 4e-08
3fk9_A188 Crystal Structure Of Mmutator Mutt Protein From Bac 5e-08
1vc8_A126 Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydr 4e-07
2i8t_A167 Gdp-Mannose Mannosyl Hydrolase-Calcium-Gdp-Mannose 7e-07
1vc9_A126 Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydr 8e-07
1rya_A160 Crystal Structure Of The E. Coli Gdp-Mannose Mannos 4e-06
3gg6_A156 Crystal Structure Of The Nudix Domain Of Human Nudt 5e-06
2gt4_A160 Crystal Structure Of The Y103f Mutant Of The Gdp-Ma 5e-06
3dku_A153 Crystal Structure Of Nudix Hydrolase Orf153, Ymfb, 6e-06
2qjt_B352 Crystal Structure Of A Bifunctional Nmn Adenylyltra 7e-06
3gz5_A240 Crystal Structure Of Shewanella Oneidensis Nrtr Len 7e-06
2gb5_A269 Crystal Structure Of Nadh Pyrophosphatase (Ec 3.6.1 1e-05
1vk6_A269 Crystal Structure Of Nadh Pyrophosphatase (1790429) 1e-05
3gz8_A162 Cocrystal Structure Of Nudix Domain Of Shewanella O 2e-05
2b0v_A153 Nudix Hydrolase From Nitrosomonas Europaea Length = 2e-05
1i9a_A182 Structural Studies Of Cholesterol Biosynthesis: Mev 3e-05
3o8s_A206 Crystal Structure Of An Adp-Ribose Pyrophosphatase 4e-05
1q54_A183 Structure And Mechanism Of Action Of Isopentenylpyr 7e-05
1hx3_A190 Crystal Structure Of E.Coli Isopentenyl Diphosphate 8e-05
1x84_A189 Ipp Isomerase (Wt) Reacted With (S)-Bromohydrine Of 9e-05
1nfs_A183 Structure And Mechanism Of Action Of Isopentenylpyr 9e-05
1hzt_A190 Crystal Structure Of Metal-Free Isopentenyl Diphosp 9e-05
2g73_A183 Y104f Mutant Type 1 Ipp Isomerase Complex With Eipp 1e-04
1x83_A189 Y104f Ipp Isomerase Reacted With (S)-Bromohydrine O 1e-04
1r67_A190 Y104a Mutant Of E.Coli Ipp Isomerase Length = 190 2e-04
3hyq_A184 Crystal Structure Of Isopentenyl-Diphosphate Delta- 2e-04
1rrs_A369 Muty Adenine Glycosylase In Complex With Dna Contai 4e-04
1rrq_A369 Muty Adenine Glycosylase In Complex With Dna Contai 4e-04
3fsp_A369 Muty Adenine Glycosylase Bound To A Transition Stat 4e-04
3g0q_A352 Crystal Structure Of Muty Bound To Its Inhibitor Dn 4e-04
2jvb_A146 Solution Structure Of Catalytic Domain Of Ydcp2 Len 5e-04
3cng_A189 Crystal Structure Of Nudix Hydrolase From Nitrosomo 9e-04
1v8i_A170 Crystal Structure Analysis Of The Adp-Ribose Pyroph 0.001
1jrk_A156 Crystal Structure Of A Nudix Protein From Pyrobacul 0.001
2fml_A273 Crystal Structure Of MuttNUDIX FAMILY PROTEIN FROM 0.002
1v8v_A170 Crystal Structure Analysis Of The Adp-Ribose Pyroph 0.002
1v8u_A170 Crystal Structure Analysis Of The Adp-Ribose Pyroph 0.003
3i9x_A187 Crystal Structure Of A MuttNUDIX FAMILY PROTEIN FRO 0.003
>gi|238538034|pdb|3HHJ|A Chain A, Crystal Structure Of Mutator Mutt From Bartonella Henselae Length = 158 Back     alignment and structure
 Score =  125 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 65/131 (49%), Positives = 88/131 (67%)

Query: 9   ILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVV 68
           +L+VVACA+ +   +VLL+ RP+ KS    WEFPGGK+E GETPE +L REL EEL + V
Sbjct: 28  LLIVVACALLDQDNRVLLTQRPEGKSLAGLWEFPGGKVEQGETPEASLIRELEEELGVHV 87

Query: 69  KPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNYSMLPADL 128
           +  +L PLTF SH YE FHLLMP + C  ++G+ Q  EGQ L+W+ ++DL  Y M  AD 
Sbjct: 88  QADNLFPLTFASHGYETFHLLMPLYFCSHYKGVAQGREGQNLKWIFINDLDKYPMPEADK 147

Query: 129 SLISFLRKHAL 139
            L+  L+   +
Sbjct: 148 PLVQVLKNFFI 158


>gi|332639860|pdb|3R03|A Chain A, The Crystal Structure Of Nudix Hydrolase From Rhodospirillum Rubrum Length = 144 Back     alignment and structure
gi|34810351|pdb|1PPX|A Chain A, Solution Structure Of The Mutt Pyrophosphohydrolase Complexed With Mg(2+) And 8-Oxo-Dgmp, A Tightly-Bound Product Length = 129 Back     alignment and structure
gi|225734088|pdb|3EES|A Chain A, Structure Of The Rna Pyrophosphohydrolase Bdrpph Length = 153 Back     alignment and structure
>gi|226887984|pdb|3GWY|A Chain A, Crystal Structure Of Putative Ctp Pyrophosphohydrolase From Bacteroides Fragilis Length = 140 Back     alignment and structure
>gi|226438383|pdb|3GRN|A Chain A, Crystal Structure Of Mutt Protein From Methanosarcina Mazei Go1 Length = 153 Back     alignment and structure
gi|40889038|pdb|1IRY|A Chain A, Solution Structure Of The Hmth1, A Nucleotide Pool Sanitization Enzyme Length = 156 Back     alignment and structure
>gi|325054041|pdb|3Q93|A Chain A, Crystal Structure Of Human 8-Oxo-Dgtpase (Mth1) Length = 176 Back     alignment and structure
>gi|308198656|pdb|3OGA|A Chain A, 1.75 Angstrom Resolution Crystal Structure Of A Putative Ntp Pyrophosphohydrolase (Yfao) From Salmonella Typhimurium Lt2 Length = 165 Back     alignment and structure
>gi|206582106|pdb|3EDS|A Chain A, Crystal Structure Of A MutNUDIX FAMILY PROTEIN FROM Bacillus Thuringiensis Length = 153 Back     alignment and structure
>gi|303325082|pdb|3N77|A Chain A, Crystal Structure Of Idp01880, Putative Ntp Pyrophosphohydrolase Of Salmonella Typhimurium Lt2 Length = 144 Back     alignment and structure
gi|88192190|pdb|2B06|A Chain A, Crystal Structure Of The MuttNUDIX FAMILY PROTEIN FROM Streptococcus Pneumoniae Length = 155 Back     alignment and structure
>gi|220702553|pdb|3FK9|A Chain A, Crystal Structure Of Mmutator Mutt Protein From Bacillus Halodurans Length = 188 Back     alignment and structure
gi|66360267|pdb|1VC8|A Chain A, Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydrolase Ndx1-Ap6a Complex Length = 126 Back     alignment and structure
>gi|150261293|pdb|2I8T|A Chain A, Gdp-Mannose Mannosyl Hydrolase-Calcium-Gdp-Mannose Complex Length = 167 Back     alignment and structure
>gi|66360269|pdb|1VC9|A Chain A, Crystal Structure Of A T.Thermophilus Hb8 Ap6a Hydrolase E50q Mutant-Mg2+-Atp Complex Length = 126 Back     alignment and structure
>gi|50513417|pdb|1RYA|A Chain A, Crystal Structure Of The E. Coli Gdp-Mannose Mannosyl Hydrolase In Complex With Gdp And Mg Length = 160 Back     alignment and structure
>gi|224983726|pdb|3GG6|A Chain A, Crystal Structure Of The Nudix Domain Of Human Nudt18 Length = 156 Back     alignment and structure
>gi|122920347|pdb|2GT4|A Chain A, Crystal Structure Of The Y103f Mutant Of The Gdp-Mannose Mannosyl Hydrolase In Complex With Gdp-Mannose And Mg+2 Length = 160 Back     alignment and structure
gi|242556351|pdb|3DKU|A Chain A, Crystal Structure Of Nudix Hydrolase Orf153, Ymfb, From Escherichia Coli K-1 Length = 153 Back     alignment and structure
>gi|169404580|pdb|2QJT|B Chain B, Crystal Structure Of A Bifunctional Nmn AdenylyltransferaseADP RIBOSE PYROPHOSPHATASE COMPLEXED With Amp And Mn Ion From Francisella Tularensis Length = 352 Back     alignment and structure
>gi|239782033|pdb|3GZ5|A Chain A, Crystal Structure Of Shewanella Oneidensis Nrtr Length = 240 Back     alignment and structure
>gi|93279961|pdb|2GB5|A Chain A, Crystal Structure Of Nadh Pyrophosphatase (Ec 3.6.1.22) (1790429) From Escherichia Coli K12 At 2.30 A Resolution Length = 269 Back     alignment and structure
>gi|49259564|pdb|1VK6|A Chain A, Crystal Structure Of Nadh Pyrophosphatase (1790429) From Escherichia Coli K12 At 2.20 A Resolution Length = 269 Back     alignment and structure
>gi|239782039|pdb|3GZ8|A Chain A, Cocrystal Structure Of Nudix Domain Of Shewanella Oneidensis Nrtr Complexed With Adp Ribose Length = 162 Back     alignment and structure
>gi|78101529|pdb|2B0V|A Chain A, Nudix Hydrolase From Nitrosomonas Europaea Length = 153 Back     alignment and structure
>gi|13786885|pdb|1I9A|A Chain A, Structural Studies Of Cholesterol Biosynthesis: Mevalonate 5-Diphosphate Decarboxylase And Isopentenyl Diphosphate Isomerase Length = 182 Back     alignment and structure
>gi|304446067|pdb|3O8S|A Chain A, Crystal Structure Of An Adp-Ribose Pyrophosphatase (Ssu98_1448) From Streptococcus Suis 89-1591 At 2.27 A Resolution Length = 206 Back     alignment and structure
>gi|34810373|pdb|1Q54|A Chain A, Structure And Mechanism Of Action Of Isopentenylpyrophosphate-Dimethylallylpyrophosphate Isomerase: Complex With The Bromohydrine Of Ipp Length = 183 Back     alignment and structure
>gi|15826360|pdb|1HX3|A Chain A, Crystal Structure Of E.Coli Isopentenyl Diphosphate:dimethylallyl Diphosphate Isomerase Length = 190 Back     alignment and structure
>gi|60593972|pdb|1X84|A Chain A, Ipp Isomerase (Wt) Reacted With (S)-Bromohydrine Of Ipp Length = 189 Back     alignment and structure
>gi|33357450|pdb|1NFS|A Chain A, Structure And Mechanism Of Action Of Isopentenylpyrophosphate-Dimethylallylpyrophosphate Isomerase: Complex With Nipp Length = 183 Back     alignment and structure
>gi|15826050|pdb|1HZT|A Chain A, Crystal Structure Of Metal-Free Isopentenyl Diphosphate:dimethylallyl Diphosphate Isomerase Length = 190 Back     alignment and structure
>gi|99032399|pdb|2G73|A Chain A, Y104f Mutant Type 1 Ipp Isomerase Complex With Eipp Length = 183 Back     alignment and structure
>gi|60593970|pdb|1X83|A Chain A, Y104f Ipp Isomerase Reacted With (S)-Bromohydrine Of Ipp Length = 189 Back     alignment and structure
>gi|38493022|pdb|1R67|A Chain A, Y104a Mutant Of E.Coli Ipp Isomerase Length = 190 Back     alignment and structure
>gi|242556819|pdb|3HYQ|A Chain A, Crystal Structure Of Isopentenyl-Diphosphate Delta-Isomerase From Salmonella Entericase Length = 184 Back     alignment and structure
>gi|46015547|pdb|1RRS|A Chain A, Muty Adenine Glycosylase In Complex With Dna Containing An Abasic Site Length = 369 Back     alignment and structure
>gi|46015544|pdb|1RRQ|A Chain A, Muty Adenine Glycosylase In Complex With Dna Containing An A:oxog Pair Length = 369 Back     alignment and structure
>gi|284055514|pdb|3FSP|A Chain A, Muty Adenine Glycosylase Bound To A Transition State Analog (1n) Paired With Dg In Duplexed Dna Length = 369 Back     alignment and structure
>gi|268612274|pdb|3G0Q|A Chain A, Crystal Structure Of Muty Bound To Its Inhibitor Dna Length = 352 Back     alignment and structure
>gi|169404537|pdb|2JVB|A Chain A, Solution Structure Of Catalytic Domain Of Ydcp2 Length = 146 Back     alignment and structure
>gi|178847595|pdb|3CNG|A Chain A, Crystal Structure Of Nudix Hydrolase From Nitrosomonas Europaea Length = 189 Back     alignment and structure
gi|56554259|pdb|1V8I|A Chain A, Crystal Structure Analysis Of The Adp-Ribose Pyrophosphatase Length = 170 Back     alignment and structure
>gi|20150517|pdb|1JRK|A Chain A, Crystal Structure Of A Nudix Protein From Pyrobaculum Aerophilum Reveals A Dimer With Intertwined Beta Sheets Length = 156 Back     alignment and structure
>gi|90109533|pdb|2FML|A Chain A, Crystal Structure Of MuttNUDIX FAMILY PROTEIN FROM Enterococcus Faecalis Length = 273 Back     alignment and structure
>gi|56554266|pdb|1V8V|A Chain A, Crystal Structure Analysis Of The Adp-Ribose Pyrophosphatase Of E86q Mutant, Complexed With Adp-Ribose And Mg Length = 170 Back     alignment and structure
>gi|56554265|pdb|1V8U|A Chain A, Crystal Structure Analysis Of The Adp-Ribose Pyrophosphatase Of E82q Mutant With So4 And Mg Length = 170 Back     alignment and structure
>gi|254839671|pdb|3I9X|A Chain A, Crystal Structure Of A MuttNUDIX FAMILY PROTEIN FROM Listeria Innocua Length = 187 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target141 mutator MutT protein [Candidatus Liberibacter asiaticus
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA 4e-30
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enterica sub 4e-27
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, 7e-25
1iry_A156 HMTH1; nudix motif(G37-L59), hydrolase; NMR {Homo sapie 2e-23
2b06_A155 MUTT/nudix family protein; structural genomics, PSI, pr 7e-23
3gwy_A140 Putative CTP pyrophosphohydrolase; structural genomics, 2e-22
3fk9_A188 Mutator MUTT protein; structural genomics, hydrolase, P 2e-22
3id9_A171 MUTT/nudix family protein; hydrolase, protein structure 6e-21
3exq_A161 Nudix family hydrolase; protein structure initiative II 8e-20
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NUDT6, 7e-19
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, 1e-18
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophosphohy 1e-17
2pqv_A154 MUTT/nudix family protein; structural genomics, PSI-2, 1e-17
3f13_A163 Putative nudix hydrolase family member; structural geno 3e-17
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, protein s 5e-17
3dku_A153 Putative phosphohydrolase; nudix hydrolase, ORF153, YMF 5e-17
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moiety X 9e-17
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polyphosphat 1e-16
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; structural 1e-16
3grn_A153 MUTT related protein; structural genomics, hydrolase, P 2e-16
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrolase; t 3e-16
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP6A, h 7e-16
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein stru 1e-15
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1; nud 1e-15
1q27_A171 Putative nudix hydrolase DR0079; radiation resistance; 2e-15
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, 8e-15
3i9x_A187 MUTT/nudix family protein; structural genomics, hydrola 1e-14
2fml_A273 MUTT/nudix family protein; structural genomics, PSI, pr 2e-14
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain, DNA 2e-14
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family protein 3e-14
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two indivi 7e-14
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nud 2e-13
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mR 2e-13
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyro 2e-13
1xsa_A153 BIS(5'-nucleosyl)-tetraphosphatase; nudix enzyme, human 2e-13
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcus fae 3e-13
3fcm_A197 Hydrolase, nudix family; protein structure initiative I 3e-13
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydr 6e-13
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta-alpha 6e-13
3e57_A211 Uncharacterized protein TM1382; structural genomics, nu 7e-13
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethylallyl, 8e-13
3cou_A217 Nudix motif 16, nucleoside diphosphate-linked moiety X 2e-12
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, magne 2e-12
2fb1_A226 Conserved hypothetical protein; structural genomics, PS 3e-12
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enz 6e-12
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure initia 2e-11
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nudix d 4e-11
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydrolase 5e-11
3f6a_A159 Hydrolase, nudix family; protein structure initiative I 6e-11
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics, JCS 7e-10
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, mang 1e-09
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D.radi 4e-09
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA complex, 4e-09
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, adenosi 6e-08
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, MAD, s 6e-08
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-helix-loo 2e-07
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphatase, 2e-07
3dup_A300 MUTT/nudix family protein; nudix superfamily hydrolase, 6e-07
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergenic re 8e-07
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribo 3e-06
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI-2, p 4e-06
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, ADP-rib 5e-06
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; HET: 5e-06
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/beta p 6e-06
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; carotenoid b 2e-04
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold 4e-08
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Length = 129 Back     alignment and structure
 Score =  125 bits (315), Expect = 4e-30
 Identities = 42/129 (32%), Positives = 68/129 (52%), Gaps = 2/129 (1%)

Query: 8   KILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIV 67
           K L +    +     ++ ++ R  D       EFPGGKIE GETPE+A+ REL EE+ I 
Sbjct: 2   KKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGIT 61

Query: 68  VKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQNYSMLPAD 127
            + FSL     + + +   H+ + F++   +EG P   EGQ  +W++L  L      PA+
Sbjct: 62  PQHFSL--FEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPAN 119

Query: 128 LSLISFLRK 136
             +I+ L++
Sbjct: 120 EPVIAKLKR 128


>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Length = 165 Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrolase, structural genomics; 2.10A {Bartonella henselae str} Length = 158 Back     alignment and structure
>1iry_A HMTH1; nudix motif(G37-L59), hydrolase; NMR {Homo sapiens} SCOP: d.113.1.1 Length = 156 Back     alignment and structure