254780328

254780328

UDP-glucose 4-epimerase

GeneID in NCBI database:8209313Locus tag:CLIBASIA_01065
Protein GI in NCBI database:254780328Protein Accession:YP_003064741.1
Gene range:+(223175, 224176)Protein Length:333aa
Gene description:UDP-glucose 4-epimerase
COG prediction:[M] UDP-glucose 4-epimerase
KEGG prediction:UDP-glucose 4-epimerase; K01784 UDP-glucose 4-epimerase [EC:5.1.3.2]
SEED prediction:UDP-glucose 4-epimerase (EC 5.1.3.2)
Pathway involved in KEGG:Galactose metabolism [PATH:las00052]
Amino sugar and nucleotide sugar metabolism [PATH:las00520]
Subsystem involved in SEED:Rhamnose containing glycans
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---
MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVLWGPLEQVDICDYTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIATAIESNVRRFIFSSTCATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIHVLDLANAHIMALEYLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYESRRIGDPPSLVADNKKAKKILGWNPKYKLRDIIESAWNWHLKYPRSLSNEHE
ccccEEEEEccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHccccEEEEEcccHHHHHHHHHHccccEEEcccccccccccHHcHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccHHHHHHHHHcccccEEcccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHHHcccccEEEcccccccccEEcccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccc
ccccEEEEEccccHHHHHHHHHHHHccccEEEEEccccccHHHHcccccEEcccccHHHHHHHHHHccEEEEEEccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEHHHHcccccccEcccccccccccccHcHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccccccccHHHHHHHHHHcccccEEEEcccccccccccEEcEEEHHHHHHHHHHHHHHHccccEEEEEEEcccccEEHHHHHHHHHHHHcccccEEEEccccccccEccEccHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccc
MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLdnlssghaefvlwgpleqvdicdytnLRAVFakyqpasvmHFAGLTNisesvknpslfyeINIKGSFNLIATAIESNVRRFIFSStcatygiphntiitendpqesitpygyTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDSIigewhnpethVIPLAIKTAMGYQnsfkvfgqdyatrdgtclrDYIHVLDLANAHIMALEYLINQGDsiainlgtgtgITVKEIISTIQSMYecafpityesrrigdppslvadnkkakkilgwnpkykLRDIIESAWNWhlkyprslsnehe
MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVLWGPLEQVDICDYTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIATAIESNVRRFIFSSTCATYGIPhntiitendpqesITPYGYTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIHVLDLANAHIMALEYLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYEsrrigdppslvadnkkakkilgwnpkyklRDIIESAWNWHLKyprslsnehe
MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVLWGPLEQVDICDYTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIATAIESNVRRFIFSSTCATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIHVLDLANAHIMALEYLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYESRRIGDPPSLVADNKKAKKILGWNPKYKLRDIIESAWNWHLKYPRSLSNEHE
**NKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVLWGPLEQVDICDYTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIATAIESNVRRFIFSSTCATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIHVLDLANAHIMALEYLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYESRRIGDPPSLVADNKKAKKILGWNPKYKLRDIIESAWNW*************
MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVLWGPLEQVDICDYTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIATAIESNVRRFIFSSTCATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIHVLDLANAHIMALEYLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYESRRIGDPPSLVADNKKAKKILGWNPKYKLRDIIESAWNWHLKYPRSLSNEHE
*ENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVLWGPLEQVDICDYTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIATAIESNVRRFIFSSTCATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIHVLDLANAHIMALEYLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYESRRIGDPPSLVADNKKAKKILGWNPKYKLRDIIESAWNWHLKYP********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVLWGPLEQVDICDYTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIATAIESNVRRFIFSSTCATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIHVLDLANAHIMALEYLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYESRRIGDPPSLVADNKKAKKILGWNPKYKLRDIIESAWNWHLKYPRSLSNEHE
MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVLWGPLEQVDICDYTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIATAIESNVRRFIFSSTCATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIHVLDLANAHIMALEYLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYESRRIGDPPSLVADNKKAKKILGWNPKYKLRDIIESAWNWHLKYPRSLSNEHE
MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVLWGPLEQVDICDYTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIATAIESNVRRFIFSSTCATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIHVLDLANAHIMALEYLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYESRRIGDPPSLVADNKKAKKILGWNPKYKLRDIIESAWNWHLKYPRSLSNEHE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target333 UDP-glucose 4-epimerase [Candidatus Liberibacter asiati
254780920358 dTDP-glucose 4,6-dehydratase [Candidatus Liberibac 3e-18
>gi|254780920|ref|YP_003065333.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 358 Back     alignment
 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 87/344 (25%), Positives = 155/344 (45%), Gaps = 48/344 (13%)

Query: 6   VLVVGGAGYIGAHTCRVLY-ERGFLPIVLDNLS-SGH-------AEFVLWGPLEQVDICD 56
           ++V GGAG+IG+  CR L  +     +V+D L+ +G+       ++  L+  L QVDICD
Sbjct: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFL-QVDICD 61

Query: 57  YTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIA---------TAI 107
              +R+   ++QP ++++FA  +++  S+     F   NI G+F L+          +  
Sbjct: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121

Query: 108 ESNVRRFIFSSTCATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVV 167
           + +  RF+  ST   YG     + +E+ P    +PY  TK   +  +L      G+  ++
Sbjct: 122 KKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181

Query: 168 LRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIH 227
                   +   +  G +H PE  +IPLAI   +   + F ++G      DG  +RD+++
Sbjct: 182 --------SNCSNNYGPYHFPEK-LIPLAITRMIEGSHVF-LYG------DGQNVRDWLY 225

Query: 228 VLDLANAHIMALEYLINQGD-SIAINLGTGTGITVKEIISTIQSMYECAFPITYES---- 282
           V D    H+ AL  ++ +G      N+G        +I+  I  + +   P +Y      
Sbjct: 226 VED----HVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELI 281

Query: 283 RRIGDPPS----LVADNKKAKKILGWNPKYKLRDIIESAWNWHL 322
           R I D P        D+ K K  +GW P+  +   +     W+L
Sbjct: 282 RFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYL 325

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target333 UDP-glucose 4-epimerase [Candidatus Liberibacter asiati
315122247351 UDP-glucose 4-epimerase [Candidatus Liberibacter solana 1 1e-162
159186050328 UDP-glucose 4-epimerase [Agrobacterium tumefaciens str. 1 1e-112
332716884327 UDP-glucose 4-epimerase [Agrobacterium sp. H13-3] Lengt 1 1e-111
222087790327 UDP-glucose 4-epimerase [Agrobacterium radiobacter K84] 1 1e-111
241206871327 UDP-glucose 4-epimerase [Rhizobium leguminosarum bv. tr 1 1e-109
86359564327 UDP-glucose 4-epimerase protein [Rhizobium etli CFN 42] 1 1e-109
116254383327 UDP-glucose 4-epimerase [Rhizobium leguminosarum bv. vi 1 1e-108
2494670327 RecName: Full=UDP-glucose 4-epimerase; AltName: Full=Ga 1 1e-108
209551430327 UDP-glucose 4-epimerase [Rhizobium leguminosarum bv. tr 1 1e-107
218511077342 UDP-glucose 4-epimerase protein [Rhizobium etli Brasil 1 1e-107
>gi|315122247|ref|YP_004062736.1| UDP-glucose 4-epimerase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 351 Back     alignment and organism information
 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 266/332 (80%), Positives = 301/332 (90%)

Query: 1   MENKNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFVLWGPLEQVDICDYTNL 60
           M+NK V VVGGAGYIGAHTCR+L ERGFLPIVLDNLSSGHAEFVLWGPLEQVDI D+TNL
Sbjct: 9   MDNKTVFVVGGAGYIGAHTCRLLSERGFLPIVLDNLSSGHAEFVLWGPLEQVDIRDHTNL 68

Query: 61  RAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIATAIESNVRRFIFSSTC 120
           R VFAKY P SVMHF+ LTN+ ESV+NPSLFYEIN+ GSFNLIA+AIE+NV+RFIFSSTC
Sbjct: 69  RMVFAKYNPISVMHFSALTNVRESVENPSLFYEINVTGSFNLIASAIEANVKRFIFSSTC 128

Query: 121 ATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVVLRYFNAAGATLDS 180
           ATYGIP N I+TENDPQ++ITPYGYTKYVVERELL HNKVNGLRSV LRYFNAAGAT D+
Sbjct: 129 ATYGIPKNAILTENDPQKAITPYGYTKYVVERELLNHNKVNGLRSVALRYFNAAGATFDN 188

Query: 181 IIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIHVLDLANAHIMALE 240
           +IGEWH+PETH+IPLAIKTA+GYQ+ F+VFGQDYAT DGTCLRDY+HVLDLANAH+MALE
Sbjct: 189 VIGEWHDPETHIIPLAIKTALGYQDRFEVFGQDYATIDGTCLRDYVHVLDLANAHVMALE 248

Query: 241 YLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFPITYESRRIGDPPSLVADNKKAKK 300
           YL+N GD+IAINLGTG G TVKEI+STI+ +Y C FPI+Y  RR+GDPP+LVADNKKAK 
Sbjct: 249 YLLNGGDNIAINLGTGNGSTVKEILSTIRRIYGCTFPISYAPRRVGDPPALVADNKKAKN 308

Query: 301 ILGWNPKYKLRDIIESAWNWHLKYPRSLSNEH 332
           +LGW+PKY L DII+SAWNWHLK P+SL  +H
Sbjct: 309 VLGWSPKYTLNDIIKSAWNWHLKNPKSLITKH 340


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159186050|ref|NP_356484.2| UDP-glucose 4-epimerase [Agrobacterium tumefaciens str. C58] Length = 328 Back     alignment and organism information
>gi|332716884|ref|YP_004444350.1| UDP-glucose 4-epimerase [Agrobacterium sp. H13-3] Length = 327 Back     alignment and organism information
>gi|222087790|ref|YP_002546328.1| UDP-glucose 4-epimerase [Agrobacterium radiobacter K84] Length = 327 Back     alignment and organism information
>gi|241206871|ref|YP_002977967.1| UDP-glucose 4-epimerase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 327 Back     alignment and organism information
>gi|86359564|ref|YP_471456.1| UDP-glucose 4-epimerase protein [Rhizobium etli CFN 42] Length = 327 Back     alignment and organism information
>gi|116254383|ref|YP_770221.1| UDP-glucose 4-epimerase [Rhizobium leguminosarum bv. viciae 3841] Length = 327 Back     alignment and organism information
>gi|2494670|sp|Q59745|EXOB_RHILT RecName: Full=UDP-glucose 4-epimerase; AltName: Full=Galactowaldenase; AltName: Full=UDP-galactose 4-epimerase Length = 327 Back     alignment and organism information
>gi|209551430|ref|YP_002283347.1| UDP-glucose 4-epimerase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 327 Back     alignment and organism information
>gi|218511077|ref|ZP_03508955.1| UDP-glucose 4-epimerase protein [Rhizobium etli Brasil 5] Length = 342 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target333 UDP-glucose 4-epimerase [Candidatus Liberibacter asiati
TIGR01179328 TIGR01179, galE, UDP-glucose-4-epimerase 1e-104
KOG1371343 KOG1371, KOG1371, KOG1371, UDP-glucose 4-epimerase/UDP- 3e-71
PLN02240352 PLN02240, PLN02240, UDP-glucose 4-epimerase 2e-69
PRK10675338 PRK10675, PRK10675, UDP-galactose-4-epimerase; Provisio 1e-55
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases 2e-44
COG1088340 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell env 4e-29
TIGR01181317 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratas 3e-26
KOG1429350 KOG1429, KOG1429, KOG1429, dTDP-glucose 4-6-dehydratase 3e-22
PRK10217355 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; Provi 2e-21
KOG0747331 KOG0747, KOG0747, KOG0747, Putative NAD+-dependent epim 3e-21
PLN02725306 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5-epime 9e-21
KOG1430361 KOG1430, KOG1430, KOG1430, C-3 sterol dehydrogenase/3-b 7e-20
PRK10084352 PRK10084, PRK10084, dTDP-glucose 4,6 dehydratase; Provi 9e-18
KOG1431315 KOG1431, KOG1431, KOG1431, GDP-L-fucose synthetase [Car 1e-17
KOG1502327 KOG1502, KOG1502, KOG1502, Flavonol reductase/cinnamoyl 1e-17
PRK15181348 PRK15181, PRK15181, Vi polysaccharide biosynthesis prot 6e-14
COG1089345 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope 8e-14
PLN02166436 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase 7e-12
PLN02206442 PLN02206, PLN02206, UDP-glucuronate decarboxylase 8e-11
KOG2774366 KOG2774, KOG2774, KOG2774, NAD dependent epimerase [Gen 1e-08
PLN02695370 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase 4e-08
PLN02896353 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase 4e-04
COG1087329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope b 1e-114
pfam01370235 pfam01370, Epimerase, NAD dependent epimerase/dehydrata 2e-46
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimerase 1e-13
pfam01073280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogena 9e-11
PLN02260 668 PLN02260, PLN02260, probable rhamnose biosynthetic enzy 1e-08
PRK11150308 PRK11150, rfaD, ADP-L-glycero-D-mannoheptose-6-epimeras 2e-07
PLN02214342 PLN02214, PLN02214, cinnamoyl-CoA reductase 2e-04
TIGR02197314 TIGR02197, heptose_epim, ADP-L-glycero-D-manno-heptose- 5e-15
PLN02986322 PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase fami 0.003
COG1091281 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell e 5e-11
COG1086588 COG1086, COG1086, Predicted nucleoside-diphosphate suga 7e-10
pfam04321284 pfam04321, RmlD_sub_bind, RmlD substrate binding domain 7e-06
TIGR03589324 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratas 2e-04
TIGR01214287 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase 0.001
PRK11908347 PRK11908, PRK11908, NAD-dependent epimerase/dehydratase 0.002
KOG4288283 KOG4288, KOG4288, KOG4288, Predicted oxidoreductase [Ge 0.003
TIGR02622349 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase 1e-08
PLN02653340 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase 0.001
TIGR01472343 TIGR01472, gmd, GDP-mannose 4,6-dehydratase 0.002
pfam02719280 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis 4e-08
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 1e-05
PLN02572442 PLN02572, PLN02572, UDP-sulfoquinovose synthase 2e-05
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Provisio 8e-04
smart00822180 smart00822, PKS_KR, This enzymatic domain is part of ba 0.002
>gnl|CDD|130247 TIGR01179, galE, UDP-glucose-4-epimerase Back     alignment and domain information
>gnl|CDD|36585 KOG1371, KOG1371, KOG1371, UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|177883 PLN02240, PLN02240, UDP-glucose 4-epimerase Back     alignment and domain information
>gnl|CDD|182639 PRK10675, PRK10675, UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|30800 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|31285 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|36642 KOG1429, KOG1429, KOG1429, dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|182313 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|35966 KOG0747, KOG0747, KOG0747, Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178326 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>gnl|CDD|36643 KOG1430, KOG1430, KOG1430, C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism, Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182230 PRK10084, PRK10084, dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|36644 KOG1431, KOG1431, KOG1431, GDP-L-fucose synthetase [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|36715 KOG1502, KOG1502, KOG1502, Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|185103 PRK15181, PRK15181, Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>gnl|CDD|31286 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|165812 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|177856 PLN02206, PLN02206, UDP-glucuronate decarboxylase Back     alignment and domain information
>gnl|CDD|37985 KOG2774, KOG2774, KOG2774, NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>gnl|CDD|178298 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>gnl|CDD|178484 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|31284 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144821 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|144605 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>gnl|CDD|177902 PLN02260, PLN02260, probable rhamnose biosynthetic enzyme Back     alignment and domain information
>gnl|CDD|182998 PRK11150, rfaD, ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|177862 PLN02214, PLN02214, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|162758 TIGR02197, heptose_epim, ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>gnl|CDD|178567 PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|31288 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|31283 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|113104 pfam04321, RmlD_sub_bind, RmlD substrate binding domain Back     alignment and domain information
>gnl|CDD|132628 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|162255 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>gnl|CDD|183375 PRK11908, PRK11908, NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>gnl|CDD|39489 KOG4288, KOG4288, KOG4288, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|162953 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|178259 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|162378 TIGR01472, gmd, GDP-mannose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|145720 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein Back     alignment and domain information
>gnl|CDD|143883 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|178184 PLN02572, PLN02572, UDP-sulfoquinovose synthase Back     alignment and domain information
>gnl|CDD|180299 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|129055 smart00822, PKS_KR, This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 333 UDP-glucose 4-epimerase [Candidatus Liberibacter asiati
TIGR01179341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 100.0
TIGR01181340 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 100.0
PRK10675338 UDP-galactose-4-epimerase; Provisional 100.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 100.0
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biog 100.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 100.0
KOG1371343 consensus 100.0
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisio 100.0
TIGR02197353 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; 100.0
KOG1429350 consensus 100.0
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 100.0
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 100.0
KOG0747331 consensus 100.0
TIGR02622361 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: I 100.0
TIGR01472365 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 Th 100.0
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 100.0
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis 100.0
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 100.0
KOG1431315 consensus 100.0
KOG1372376 consensus 100.0
KOG1430361 consensus 100.0
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 100.0
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 100.0
KOG1502327 consensus 100.0
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 100.0
KOG2774366 consensus 99.97
CHL00194319 ycf39 Ycf39; Provisional 99.97
PRK07201 663 short chain dehydrogenase; Provisional 99.95
TIGR01777307 yfcH conserved hypothetical protein TIGR01777; InterPro 99.95
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [Gener 99.93
PRK05865 854 hypothetical protein; Provisional 99.78
PRK12320 699 hypothetical protein; Provisional 99.75
KOG2865391 consensus 99.68
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 99.67
KOG3019315 consensus 98.79
pfam02719280 Polysacc_synt_2 Polysaccharide biosynthesis protein. Th 100.0
pfam01073280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 100.0
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 100.0
COG1086588 Predicted nucleoside-diphosphate sugar epimerases [Cell 100.0
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase 99.94
TIGR01746405 Thioester-redct thioester reductase domain; InterPro: I 99.93
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 99.92
COG3320382 Putative dehydrogenase domain of multifunctional non-ri 99.88
KOG1221467 consensus 99.83
PRK05875277 short chain dehydrogenase; Provisional 99.59
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 99.52
KOG1203411 consensus 99.12
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 96.56
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 95.52
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 100.0
pfam07993245 NAD_binding_4 Male sterility protein. This family repre 99.96
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.71
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 99.7
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 99.67
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.67
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 99.66
PRK07577234 short chain dehydrogenase; Provisional 99.66
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.66
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.65
PRK07856254 short chain dehydrogenase; Provisional 99.65
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.65
PRK07479252 consensus 99.64
PRK07774250 short chain dehydrogenase; Provisional 99.63
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.62
PRK12939250 short chain dehydrogenase; Provisional 99.61
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.61
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 99.61
PRK12827251 short chain dehydrogenase; Provisional 99.6
PRK09186255 flagellin modification protein A; Provisional 99.6
PRK06398256 aldose dehydrogenase; Validated 99.6
PRK05717255 oxidoreductase; Validated 99.6
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.6
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 99.59
PRK07890258 short chain dehydrogenase; Provisional 99.59
PRK08339263 short chain dehydrogenase; Provisional 99.59
PRK07831261 short chain dehydrogenase; Provisional 99.59
PRK07067256 sorbitol dehydrogenase; Provisional 99.58
PRK12828239 short chain dehydrogenase; Provisional 99.58
PRK08265261 short chain dehydrogenase; Provisional 99.58
PRK06138252 short chain dehydrogenase; Provisional 99.58
PRK07677254 short chain dehydrogenase; Provisional 99.58
PRK07060245 short chain dehydrogenase; Provisional 99.58
PRK06523260 short chain dehydrogenase; Provisional 99.58
PRK09135249 pteridine reductase; Provisional 99.58
PRK06841255 short chain dehydrogenase; Provisional 99.58
PRK05872296 short chain dehydrogenase; Provisional 99.57
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.57
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.57
PRK07062265 short chain dehydrogenase; Provisional 99.57
PRK08628258 short chain dehydrogenase; Provisional 99.57
PRK08277278 D-mannonate oxidoreductase; Provisional 99.57
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 99.57
PRK07035252 short chain dehydrogenase; Provisional 99.57
PRK09242258 tropinone reductase; Provisional 99.57
PRK07776252 consensus 99.57
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.56
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.56
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.56
PRK07326235 short chain dehydrogenase; Provisional 99.56
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.56
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.55
PRK06124259 gluconate 5-dehydrogenase; Provisional 99.55
PRK06057255 short chain dehydrogenase; Provisional 99.55
PRK07063259 short chain dehydrogenase; Provisional 99.55
PRK07523251 gluconate 5-dehydrogenase; Provisional 99.55
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 99.55
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 99.55
PRK12829264 short chain dehydrogenase; Provisional 99.54
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.54
PRK07478254 short chain dehydrogenase; Provisional 99.54
PRK06500249 short chain dehydrogenase; Provisional 99.54
PRK07825273 short chain dehydrogenase; Provisional 99.54
PRK06346251 consensus 99.54
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.54
PRK06227256 consensus 99.53
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.53
PRK08226263 short chain dehydrogenase; Provisional 99.53
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 99.53
PRK06172253 short chain dehydrogenase; Provisional 99.53
PRK07814263 short chain dehydrogenase; Provisional 99.53
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.53
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 99.53
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.53
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 99.52
PRK07576260 short chain dehydrogenase; Provisional 99.52
PRK06198268 short chain dehydrogenase; Provisional 99.52
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.52
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 99.51
PRK06125259 short chain dehydrogenase; Provisional 99.51
PRK08589272 short chain dehydrogenase; Validated 99.51
PRK08219226 short chain dehydrogenase; Provisional 99.51
PRK06701289 short chain dehydrogenase; Provisional 99.51
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 99.51
PRK07454241 short chain dehydrogenase; Provisional 99.51
PRK07041240 short chain dehydrogenase; Provisional 99.51
PRK06123249 short chain dehydrogenase; Provisional 99.5
PRK08340259 glucose-1-dehydrogenase; Provisional 99.5
PRK12937245 short chain dehydrogenase; Provisional 99.5
PRK06949258 short chain dehydrogenase; Provisional 99.5
PRK08936261 glucose-1-dehydrogenase; Provisional 99.5
PRK06114262 short chain dehydrogenase; Provisional 99.5
PRK09134256 short chain dehydrogenase; Provisional 99.5
PRK07985294 oxidoreductase; Provisional 99.5
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.5
PRK08278273 short chain dehydrogenase; Provisional 99.49
PRK06947252 glucose-1-dehydrogenase; Provisional 99.49
PRK07074256 short chain dehydrogenase; Provisional 99.49
PRK07707239 consensus 99.49
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.48
PRK06484 530 short chain dehydrogenase; Validated 99.48
PRK12744257 short chain dehydrogenase; Provisional 99.48
PRK12747252 short chain dehydrogenase; Provisional 99.48
PRK12742237 oxidoreductase; Provisional 99.47
PRK07775275 short chain dehydrogenase; Provisional 99.47
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.46
PRK08324676 short chain dehydrogenase; Validated 99.46
PRK05867253 short chain dehydrogenase; Provisional 99.45
PRK08643256 acetoin reductase; Validated 99.45
PRK06484530 short chain dehydrogenase; Validated 99.45
PRK09009235 C factor cell-cell signaling protein; Provisional 99.45
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.45
PRK12743253 acetoin dehydrogenase; Provisional 99.45
PRK06139324 short chain dehydrogenase; Provisional 99.44
PRK06128300 oxidoreductase; Provisional 99.44
PRK12746254 short chain dehydrogenase; Provisional 99.43
PRK07578199 short chain dehydrogenase; Provisional 99.42
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 99.41
PRK08177225 short chain dehydrogenase; Provisional 99.41
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 99.41
TIGR01830238 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta 99.41
PRK06483236 short chain dehydrogenase; Provisional 99.41
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 99.4
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.4
PRK07109338 short chain dehydrogenase; Provisional 99.4
PRK07806248 short chain dehydrogenase; Provisional 99.39
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.39
PRK07069251 short chain dehydrogenase; Validated 99.39
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 99.37
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 99.37
PRK07791285 short chain dehydrogenase; Provisional 99.37
PRK06953222 short chain dehydrogenase; Provisional 99.36
PRK09730247 hypothetical protein; Provisional 99.36
PRK08261447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.35
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 99.35
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.34
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 99.32
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 99.3
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisional 99.3
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 99.27
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisional 99.24
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 99.24
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 99.23
TIGR01963258 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR01 99.07
PRK06940277 short chain dehydrogenase; Provisional 99.0
COG2910211 Putative NADH-flavin reductase [General function predic 98.9
PRK06300298 enoyl-(acyl carrier protein) reductase; Provisional 98.75
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 98.68
KOG1200256 consensus 98.57
KOG1207245 consensus 98.56
KOG1611249 consensus 98.54
TIGR01832249 kduD 2-deoxy-D-gluconate 3-dehydrogenase; InterPro: IPR 97.73
COG0623259 FabI Enoyl-[acyl-carrier-protein] 97.0
PRK06182273 short chain dehydrogenase; Validated 99.6
PRK06179270 short chain dehydrogenase; Provisional 99.56
PRK08263275 short chain dehydrogenase; Provisional 99.56
PRK06180277 short chain dehydrogenase; Provisional 99.54
PRK08264235 short chain dehydrogenase; Validated 99.54
PRK08945245 short chain dehydrogenase; Provisional 99.52
PRK05993277 short chain dehydrogenase; Provisional 99.51
PRK06482276 short chain dehydrogenase; Provisional 99.49
PRK06914280 short chain dehydrogenase; Provisional 99.49
PRK09072262 short chain dehydrogenase; Provisional 99.48
PRK08017256 short chain dehydrogenase; Provisional 99.48
pfam08659181 KR KR domain. This enzymatic domain is part of bacteria 99.48
PRK07201663 short chain dehydrogenase; Provisional 99.48
PRK07024256 short chain dehydrogenase; Provisional 99.47
PRK08703239 short chain dehydrogenase; Provisional 99.46
pfam00106167 adh_short short chain dehydrogenase. This family contai 99.46
PRK08251248 short chain dehydrogenase; Provisional 99.45
smart00822180 PKS_KR This enzymatic domain is part of bacterial polyk 99.44
PRK06196316 oxidoreductase; Provisional 99.44
PRK08267258 short chain dehydrogenase; Provisional 99.43
PRK05866290 short chain dehydrogenase; Provisional 99.43
PRK09291257 short chain dehydrogenase; Provisional 99.42
PRK05693274 short chain dehydrogenase; Provisional 99.41
PRK07832272 short chain dehydrogenase; Provisional 99.4
PRK05650270 short chain dehydrogenase; Provisional 99.39
PRK07102243 short chain dehydrogenase; Provisional 99.39
PRK06181263 short chain dehydrogenase; Provisional 99.38
PRK06924251 short chain dehydrogenase; Provisional 99.37
PRK06194301 hypothetical protein; Provisional 99.37
PRK05876275 short chain dehydrogenase; Provisional 99.37
PRK06101241 short chain dehydrogenase; Provisional 99.36
PRK05854314 short chain dehydrogenase; Provisional 99.35
PRK07023243 short chain dehydrogenase; Provisional 99.33
PRK05855582 short chain dehydrogenase; Validated 99.33
PRK06197306 short chain dehydrogenase; Provisional 99.3
KOG1205282 consensus 99.25
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 99.25
TIGR01829244 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR 99.24
PRK07904253 short chain dehydrogenase; Provisional 99.22
COG1028251 FabG Dehydrogenases with different specificities (relat 99.2
KOG1208314 consensus 99.17
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.17
PRK05599246 hypothetical protein; Provisional 99.13
KOG1201300 consensus 99.08
PRK08303305 short chain dehydrogenase; Provisional 99.07
PRK08862227 short chain dehydrogenase; Provisional 99.07
KOG1209289 consensus 99.01
KOG0725270 consensus 98.94
KOG4169261 consensus 98.9
PRK05884223 short chain dehydrogenase; Provisional 98.86
KOG4039238 consensus 98.86
PRK12367250 short chain dehydrogenase; Provisional 98.73
TIGR02415258 23BDH acetoin reductases; InterPro: IPR014007 One membe 98.68
COG3967245 DltE Short-chain dehydrogenase involved in D-alanine es 98.63
KOG1210331 consensus 98.61
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 98.61
KOG1610322 consensus 98.52
KOG1014312 consensus 98.25
KOG1199260 consensus 98.19
KOG1478341 consensus 98.01
pfam08643296 DUF1776 Fungal family of unknown function (DUF1776). Th 97.72
PRK05442325 malate dehydrogenase; Provisional 96.83
KOG1204253 consensus 96.74
KOG1202 2376 consensus 96.7
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 96.45
KOG4022236 consensus 96.4
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 96.29
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Mal 96.26
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehydroge 96.07
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 96.06
COG4982 866 3-oxoacyl-[acyl-carrier protein] 95.7
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is 95.45
TIGR01289321 LPOR light-dependent protochlorophyllide reductase; Int 95.28
TIGR00036281 dapB dihydrodipicolinate reductase; InterPro: IPR011770 94.61
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 93.24
cd04510334 consensus 92.01
PRK06720169 hypothetical protein; Provisional 98.91
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 97.07
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 96.96
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 96.94
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-li 96.81
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 96.7
pfam02571246 CbiJ Precorrin-6x reductase CbiJ/CobK. This family cons 96.67
PRK08762379 molybdopterin biosynthesis protein MoeB; Validated 96.52
PRK07411390 hypothetical protein; Validated 96.51
PRK08328230 hypothetical protein; Provisional 96.45
PRK05086312 malate dehydrogenase; Provisional 96.44
PTZ00325313 malate dehydrogenase; Provisional 96.4
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 96.26
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 96.26
KOG2018430 consensus 96.23
pfam00899134 ThiF ThiF family. This family contains a repeated domai 96.06
PRK05600370 thiamine biosynthesis protein ThiF; Validated 96.03
PTZ00082322 L-lactate dehydrogenase; Provisional 95.99
COG1179263 Dinucleotide-utilizing enzymes involved in molybdopteri 95.99
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 95.98
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Validated 95.98
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 95.85
PRK12446352 N-acetylglucosaminyl transferase; Reviewed 95.74
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 95.72
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 95.7
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily of act 95.64
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 95.52
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 95.48
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APP 95.34
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.32
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 95.22
PRK08057241 cobalt-precorrin-6x reductase; Reviewed 95.19
TIGR01759329 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 95.12
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, pu 94.98
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 94.89
cd00755231 YgdL_like Family of activating enzymes (E1) of ubiquiti 94.86
PTZ00117313 malate dehydrogenase; Provisional 94.8
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 94.75
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-li 94.69
PRK06223312 malate dehydrogenase; Reviewed 94.62
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 94.36
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 94.33
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 94.13
PRK07502307 cyclohexadienyl dehydrogenase; Validated 92.9
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF; InterPro: 91.09
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine tr 91.01
PRK13302271 putative L-aspartate dehydrogenase; Provisional 90.78
KOG4288283 consensus 98.87
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.44
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 97.86
PRK09620229 hypothetical protein; Provisional 97.76
pfam04127197 DFP DNA / pantothenate metabolism flavoprotein. The DNA 97.75
TIGR02114253 coaB_strep phosphopantothenate--cysteine ligase; InterP 97.53
PRK09496 455 trkA potassium transporter peripheral membrane componen 97.48
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 97.47
PRK06732228 phosphopantothenate--cysteine ligase; Validated 97.37
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 97.34
PRK06849387 hypothetical protein; Provisional 97.17
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 97.12
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 97.02
COG0027394 PurT Formate-dependent phosphoribosylglycinamide formyl 96.97
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 96.96
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketide syn 96.82
KOG1198347 consensus 96.68
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 96.59
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 96.38
PRK08309182 short chain dehydrogenase; Provisional 96.34
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 96.28
COG0604326 Qor NADPH:quinone reductase and related Zn-dependent ox 96.26
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 96.07
KOG2733423 consensus 95.87
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 95.83
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain o 95.71
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 95.63
KOG0023360 consensus 95.54
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 95.52
PRK05447379 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 95.5
PRK13940414 glutamyl-tRNA reductase; Provisional 95.37
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 95.3
PRK00726359 murG N-acetylglucosaminyl transferase; Provisional 94.9
pfam02882159 THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro 94.81
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 94.5
cd04962371 GT1_like_5 This family is most closely related to the G 94.39
PRK09496455 trkA potassium transporter peripheral membrane componen 94.37
COG3268382 Uncharacterized conserved protein [Function unknown] 94.33
PRK00421 459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 94.22
PRK07417280 arogenate dehydrogenase; Reviewed 94.22
PRK00048265 dihydrodipicolinate reductase; Provisional 93.9
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 93.43
PRK00885424 phosphoribosylamine--glycine ligase; Provisional 92.7
pfam02670129 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoi 92.41
PRK06395 435 phosphoribosylamine--glycine ligase; Provisional 92.35
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferase, th 91.7
pfam0284499 GARS_N Phosphoribosylglycinamide synthetase, N domain. 91.42
PRK07206415 hypothetical protein; Provisional 91.37
KOG0172 445 consensus 91.32
TIGR00421181 ubiX_pad polyprenyl P-hydroxybenzoate and phenylacrylic 90.67
pfam03447116 NAD_binding_3 Homoserine dehydrogenase, NAD binding dom 90.63
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 90.63
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene-tetra 90.37
COG0458400 CarB Carbamoylphosphate synthase large subunit (split g 90.33
pfam03033136 Glyco_transf_28 Glycosyltransferase family 28 N-termina 90.21
PRK05579392 bifunctional phosphopantothenoylcysteine decarboxylase/ 97.7
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 96.92
PRK08655 441 prephenate dehydrogenase; Provisional 96.83
PRK13982476 bifunctional SbtC-like/phosphopantothenoylcysteine deca 96.8
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 96.65
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 96.57
PRK13771332 putative alcohol dehydrogenase; Provisional 96.52
TIGR02823330 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP f 96.29
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 96.28
PRK08223287 hypothetical protein; Validated 95.98
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 95.98
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 95.97
PRK08040337 putative semialdehyde dehydrogenase; Provisional 95.86
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 95.65
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 95.64
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.47
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.4
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 95.37
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.35
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 95.31
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 95.29
TIGR01758325 MDH_euk_cyt malate dehydrogenase, NAD-dependent; InterP 95.18
PRK07660283 consensus 95.09
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.07
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.05
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 95.02
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 95.02
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 94.98
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 94.97
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.8
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.62
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 94.59
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 94.52
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.28
PRK11863314 N-acetyl-gamma-glutamyl-phosphate reductase; Provisiona 94.27
pfam00208237 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 94.16
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.11
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.03
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 93.99
COG2130340 Putative NADP-dependent oxidoreductases [General functi 93.9
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 93.85
PRK07208 474 hypothetical protein; Provisional 93.81
PRK06847375 hypothetical protein; Provisional 93.76
PRK04965378 nitric oxide reductase; Provisional 93.74
PRK01390 457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.52
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methy 93.47
PRK06901323 aspartate-semialdehyde dehydrogenase; Provisional 93.4
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.29
COG2085211 Predicted dinucleotide-binding enzymes [General functio 93.04
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 92.97
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.87
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.46
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 92.42
PRK06444197 prephenate dehydrogenase; Provisional 92.37
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 92.36
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3. 92.34
PRK00141 476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.33
PRK06567 1048 putative bifunctional glutamate synthase subunit beta/2 92.13
PRK09117282 consensus 92.08
TIGR02685283 pter_reduc_Leis pteridine reductase; InterPro: IPR01405 92.05
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 91.9
PRK08229341 2-dehydropantoate 2-reductase; Provisional 91.88
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 91.82
KOG2013 603 consensus 91.48
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 91.43
KOG1196343 consensus 91.26
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 91.16
PRK05708305 2-dehydropantoate 2-reductase; Provisional 91.11
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 90.92
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.86
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 90.79
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 90.72
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 90.48
PRK08306296 dipicolinate synthase subunit A; Reviewed 90.18
KOG4288283 consensus 90.11
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 95.52
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 94.88
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 94.57
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 94.12
PRK12548289 shikimate 5-dehydrogenase; Provisional 92.92
PRK10792288 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 92.64
PRK12549284 shikimate 5-dehydrogenase; Reviewed 92.1
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 91.11
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/shikima 90.57
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 90.47
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 94.14
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 93.81
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Meth 93.49
cd01976421 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitro 90.74
TIGR01296350 asd_B aspartate-semialdehyde dehydrogenase; InterPro: I 91.93
KOG1257582 consensus 90.52
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5 Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: IPR005888 The conversion of dTDP-glucose into dTDP-4-keto-6-deoxyglucose by Escherichia coli dTDP-glucose 4,6-dehydratase) takes place in the active site in three steps: dehydrogenation to dTDP-4-ketoglucose, dehydration to dTDP-4-ketoglucose-5,6-ene, and rereduction of C6 to the methyl group Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>KOG1371 consensus Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; InterPro: IPR011912 Lipopolysaccharides (LPS) are glycolipids that consitutes the outer monolayer of the outer membranes of most Gram-negative bacteria Back     alignment and domain information
>KOG1429 consensus Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>pfam04321 RmlD_sub_bind RmlD substrate binding domain Back     alignment and domain information
>KOG0747 consensus Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: IPR013445 This entry contains CDP-glucose 4,6-dehydratases from a variety of Gram-negative and Gram-positive bacteria Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 This family represent GDP-mannose 4,6-dehydratase, also known as GDP-D-mannose dehydratase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1431 consensus Back     alignment and domain information
>KOG1372 consensus Back     alignment and domain information
>KOG1430 consensus Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>KOG1502 consensus Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2774 consensus Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information