254780327

254780327

preprotein translocase subunit SecA

GeneID in NCBI database:8209312Locus tag:CLIBASIA_01060
Protein GI in NCBI database:254780327Protein Accession:YP_003064740.1
Gene range:+(220345, 223017)Protein Length:890aa
Gene description:preprotein translocase subunit SecA
COG prediction:[U] Preprotein translocase subunit SecA (ATPase, RNA helicase)
KEGG prediction:secA; preprotein translocase subunit SecA; K03070 preprotein translocase subunit SecA
SEED prediction:Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)
Pathway involved in KEGG:Protein export [PATH:las03060]
Bacterial secretion system [PATH:las03070]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890
MLSHLAKLASKLLIPSNERRLRPYYAKVIAINELEKEISHLSDDSLANKTSEFKERINNGETLDDLLVPAFAVVREVARRTLGMRPFDVQLLGGMILHKGCVAEMKTGEGKTLAAVLPVYLNALSGKGVHVVTVNDYLARRDSNTMSAIYKFLGLSTGVVFHDLSDDKRRAAYACDITYITNNELGFDYLRDNMQYRRVDMVQRGHNFAIVDEVDSIFIDEARTPLIISGPVEDHSDLYRTIDSIIIQLHPSDYEIDEKQRTVHFSEKGTERIEELLHGENLLKSGGLYSFENVAIVHLINNALKSHTLFLRNRDYIVNRDEVVIIDEFTGRMMPGRRYSDGQHQALEAKERVKIQPENQTLSSITFQNYFLKYRKLSGMTGTASTEAEELANIYNLDVIEVPTNVPVIRIDEHDEIYRTSEEKYAAIIAEIIDSHKKGQPVLVGTPSIEKSEYLASQLRKHKFTKFQILNALYHEKEAYIISQAGIPGAVTIATNMAGRGTDIQLGGNVAMRIEHELANISDEEIRNKRIKMIQEEVQSLKEKAIVAGGLYVISTERHESRRIDNQLRGRSGRQGDPGRSKFYLSLQDDLMRIFGSPRMESFLRKIGLKEGEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLNEQRKIIFEQRLEIIDTENILEIIADMRHDTLHNIVEKCIPNNSYPEKWDIKKLETEIYEIFGIHFPVLEWRNDNGIDHTEMSKRIFAKADKIAEDQENSFGTEKMQALGRHILLHTLDSFWREHMARLEHSRSIIGFRGYAQRDPLQEYKSEAFGFFNTLLTHLRKDVVSQIARIEPNNINNQELNNSLPYIAENDHGPVIQKENELDTPNVCKTSKIKRNHPCPCGSGKKYKHCHGSYL
cHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHcccccccHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHccEEEEcccccHHHHHHHHHcccHHHcccccccEEEEEcHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHcccccEEEEEcccEEEEcHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEccEEEEEEcccccccccccccHHHHHHHHHHHcccccccccHHEHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccEEEEEcccccccccEEcccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHccccccccccccEEEEEEccHHHHHHHcHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHccHHHHHHHHHHHcccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHcccc
cHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccHEEcccHEEccccEEEEEcccccEEHEcHHHHHHHHccccEEEEEEcHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccEccccccccccHHHHHcccccHHHHHHccccEEEEccHHHHHHHcccccEEEcccccccHHHHHHHHHcccccccccEEEEccccEEEccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEccEEEEEEcccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccEEEEcccccccccccccEEEccHHHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHcccccccEEcHHHHHHHHHHHHHccccccEEEEEccccccccEEEcccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccEEEccccHHHHHHHcHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHccHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcccHHHHHHHHHHHHHHHHHHHHccccHccccccccccccccccccccccccccccccccccc
MLSHLAKLASKllipsnerrlrpyyAKVIAINELEKEIshlsddslaNKTSEFKerinngetlddlLVPAFAVVREVARRtlgmrpfdvqLLGGMILHKGcvaemktgegktLAAVLPVYLNalsgkgvhVVTVNDYLARRDSNTMSAIYKFLGLStgvvfhdlsddkrrAAYACDITYITNNELGFDYLRDNMQYRRVDMVQrghnfaivdevdsifideartpliisgpvedhsdlYRTIDSIIiqlhpsdyeidekqrtvhfsEKGTERIEELLHgenllksgglysfeNVAIVHLINNALKSHtlflrnrdyivnrdevviideftgrmmpgrrysdgqHQALEAKErvkiqpenqtlssiTFQNYFLKYRKlsgmtgtasTEAEELANiynldvievptnvpviridehdeiyRTSEEKYAAIIAEIIDshkkgqpvlvgtpsieKSEYLASQLRKHKFTKFQILNALYHEKEAYIISQAGIPGAVTIATnmagrgtdiqlggNVAMRIEHELANISDEEIRNKRIKMIQEEVQSLKEKAIVAGGLYVISTerhesrridnqlrgrsgrqgdpgrskFYLSLQDDLMRIFGSPRMESFLRKIGLKEGEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLNEQRKIIFEQRLEIIDTENILEIIADMRHDTLHNIVekcipnnsypekwdiKKLETEIYEIFGIHfpvlewrndngidhtEMSKRIFAKADKIAEDQENSFGTEKMQALGRHILLHTLDSFWREHMARLEHSRSiigfrgyaqrdplqeyksEAFGFFNTLLTHLRKDVVSQIariepnninnqelnnslpyiaendhgpviqkeneldtpnvcktskikrnhpcpcgsgkkykhchgsyl
MLSHLAKLASkllipsnerrlrpYYAKVIAINELEKEISHLSDDSLANKTSEFKERinngetlddllvPAFAVVREVARRTLGMRPFDVQLLGGMILHKGCVAEMKTGEGKTLAAVLPVYLNALSGKGVHVVTVNDYLARRDSNTMSAIYKFLGLSTGVVFHDLSDDKRRAAYACDITYITNNELGFDYLRDNMQYRRVDMVQRGHNFAIVDEVDSIFIDEARTPliisgpvedhSDLYRTIDSIIIQlhpsdyeidekQRTVHFSEKGTERIEELLHGENLLKSGGLYSFENVAIVHLINNALKSHTlflrnrdyivnrDEVVIIdeftgrmmpgrrYSDGQHQALEAKErvkiqpenqtlssitfQNYFLKYRKLSGMTGTASTEAEELANiynldvievptnvpviridehdeiyRTSEEKYAAIIAEIidshkkgqpVLVGTPSIEKSEYLASQLRKHKFTKFQILNALYHEKEAYIISQAGIPGAVTIATNMAGRGTDIQLGGNVAMRIEHELanisdeeiRNKRIKMIQEEVQSLKEKAIVAGGLyvisterhesrridnqlrgrsgrqgdpgrSKFYLSLQDDLMRIFGSPRMESFLRKIGLKEGEAIIHPWINKAIERAQQKVEarnfetrknllkyddvlnEQRKIIFeqrleiidtENILEIIADMRHDTLHNIVekcipnnsypeKWDIKKLETEIYEIFGIHFPVLEWRNDNGIDHTEMSKRIFAKADKIAEDQENSFGTEKMQALGRHILLHTLDSFWREHMARLEHSRSIIGFRGYAQRDPLQEYKSEAFGFFNTLLTHLRKDVVSQIARiepnninnqelNNSLPYIAENDHGPVIQKENELDTPNVcktskikrnhpcpcgsgkkykhchgsyl
MlshlaklaskllIPSNERRLRPYYAKVIAINELEKEISHLSDDSLANKTSEFKERINNGETLDDLLVPAFAVVREVARRTLGMRPFDVQLLGGMILHKGCVAEMKTGEGKTLAAVLPVYLNALSGKGVHVVTVNDYLARRDSNTMSAIYKFLGLSTGVVFHDLSDDKRRAAYACDITYITNNELGFDYLRDNMQYRRVDMVQRGHNFAIVDEVDSIFIDEARTPLIISGPVEDHSDLYRTIDSIIIQLHPSDYEIDEKQRTVHFSEKGTERIEELLHGENLLKSGGLYSFENVAIVHLINNALKSHTLFLRNRDYIVNRDEVVIIDEFTGRMMPGRRYSDGQHQALEAKERVKIQPENQTLSSITFQNYFLKYRKLSGMTGTASTEAEELANIYNLDVIEVPTNVPVIRIDEHDEIYRTSeekyaaiiaeiiDSHKKGQPVLVGTPSIEKSEYLASQLRKHKFTKFQILNALYHEKEAYIISQAGIPGAVTIATNMAGRGTDIQLGGNVAMRIEHELANISDEEIRNKRIKMIQEEVQSLKEKAIVAGGLYVISTERHESRRIDNQLRGRSGRQGDPGRSKFYLSLQDDLMRIFGSPRMESFLRKIGLKEGEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLNEQRKIIFEQRLEIIDTENILEIIADMRHDTLHNIVEKCIPNNSYPEKWDIKKLETEIYEIFGIHFPVLEWRNDNGIDHTEMSKRIFAKADKIAEDQENSFGTEKMQALGRHILLHTLDSFWREHMARLEHSRSIIGFRGYAQRDPLQEYKSEAFGFFNTLLTHLRKDVVSQIARiepnninnqelnnslpYIAENDHGPVIQKENELDTPNVCKTSKIKRNHPCPCGSGKKYKHCHGSYL
*****AKLASKLLIPSNERRLRPYYAKVIAINELEKEISHLSDDSLANKTSEFKERINNGETLDDLLVPAFAVVREVARRTLGMRPFDVQLLGGMILHKGCVAEMKTGEGKTLAAVLPVYLNALSGKGVHVVTVNDYLARRDSNTMSAIYKFLGLSTGVVFHDLSDDKRRAAYACDITYITNNELGFDYLRDNMQYRRVDMVQRGHNFAIVDEVDSIFIDEARTPLIISGPVEDHSDLYRTIDSIIIQLHPSDYEIDEKQRTVHFSEKGTERIEELLHGENLLKSGGLYSFENVAIVHLINNALKSHTLFLRNRDYIVNRDEVVIIDEFTGRMMPGRRYSDGQHQALEAKERVKIQPENQTLSSITFQNYFLKYRKLSGMTGTASTEAEELANIYNLDVIEVPTNVPVIRIDEHDEIYRTSEEKYAAIIAEIIDSHKKGQPVLVGTPSIEKSEYLASQLRKHKFTKFQILNALYHEKEAYIISQAGIPGAVTIATNMAGRGTDIQLGGNVAMRIE***************IKMIQEEVQSLKEKAIVAGGLYVISTERHESRRIDNQLRGRSGRQGDPGRSKFYLSLQDDLMRIFGSPRMESFLRKIGLKEGEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLNEQRKIIFEQRLEIIDTENILEIIADMRHDTLHNIVEKCIPNNSYPEKWDIKKLETEIYEIFGIHFPVLEWRNDNGIDHTEMSKRIFAKADKIAEDQENSFGTEKMQALGRHILLHTLDSFWREHMARLEHSRSIIGFRGYAQRDPLQEYKSEAFGFFNTLLTHLRKDVVSQIAR************************************************PCPCGSGKKYKHCHGSYL
MLSHLAKLASKLLIPSNERRLRPYYAKVIAINELEKEISHLSDDSLANKTSEFKERINNGETLDDLLVPAFAVVREVARRTLGMRPFDVQLLGGMILHKGCVAEMKTGEGKTLAAVLPVYLNALSGKGVHVVTVNDYLARRDSNTMSAIYKFLGLSTGVVFHDLSDDKRRAAYACDITYITNNELGFDYLRDNMQYRRVDMVQRGHNFAIVDEVDSIFIDEARTPLIISGPVEDHSDLYRTIDSIIIQLHPSDYEIDEKQRTVHFSEKGTERIEELLHGENLLKSGGLYSFENVAIVHLINNALKSHTLFLRNRDYIVNRDEVVIIDEFTGRMMPGRRYSDGQHQALEAKERVKIQPENQTLSSITFQNYFLKYRKLSGMTGTASTEAEELANIYNLDVIEVPTNVPVIRIDEHDEIYRTSEEKYAAIIAEIIDSHKKGQPVLVGTPSIEKSEYLASQLRKHKFTKFQILNALYHEKEAYIISQAGIPGAVTIATNMAGRGTDIQLGGNVAMRIEHELANISDEEIRNKRIKMIQEEVQSLKEKAIVAGGLYVISTERHESRRIDNQLRGRSGRQGDPGRSKFYLSLQDDLMRIFGSPRMESFLRKIGLKEGEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLNEQRKIIFEQRLEIIDTENILEIIADMRHDTLHNIVEKCIPNNSYPEKWDIKKLETEIYEIFGIHFPVLEWRNDNGIDHTEMSKRIFAKADKIAEDQENSFGTEKMQALGRHILLHTLDSFWREHMARLEHSRSIIGFRGYAQRDPLQEYKSEAFGFFNTLLTHLRKDVVSQIARIEPNNINNQELNNSLPYIAENDHGPVIQKENELDTPNVCKTSKIKRNHPCPCGSGKKYKHCHGSYL
*LSHLAKLASKLLIPSNERRLRPYYAKVIAINELEKEISHLSDDSLANKTSEFKERINNGETLDDLLVPAFAVVREVARRTLGMRPFDVQLLGGMILHKGCVAEMKTGEGKTLAAVLPVYLNALSGKGVHVVTVNDYLARRDSNTMSAIYKFLGLSTGVVFHDLSDDKRRAAYACDITYITNNELGFDYLRDNMQYRRVDMVQRGHNFAIVDEVDSIFIDEARTPLIISGPVEDHSDLYRTIDSIIIQLHPSDYEIDEKQRTVHFSEKGTERIEELLHGENLLKSGGLYSFENVAIVHLINNALKSHTLFLRNRDYIVNRDEVVIIDEFTGRMMPGRRYSDGQHQALEAKERVKIQPENQTLSSITFQNYFLKYRKLSGMTGTASTEAEELANIYNLDVIEVPTNVPVIRIDEHDEIYRTSEEKYAAIIAEIIDSHKKGQPVLVGTPSIEKSEYLASQLRKHKFTKFQILNALYHEKEAYIISQAGIPGAVTIATNMAGRGTDIQLGGNVAMRIEHELANISDEEIRNKRIKMIQEEVQSLKEKAIVAGGLYVISTERHESRRID**L********DPGRSKFYLSLQDDLMRIFGSPRMESFLRKIGLKEGEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLNEQRKIIFEQRLEIIDTENILEIIADMRHDTLHNIVEKCIPNNSYPEKWDIKKLETEIYEIFGIHFPVLEWRNDNGIDHTEMSKRIFAKADKIAEDQENSFGTEKMQALGRHILLHTLDSFWREHMARLEHSRSIIGFRGYAQRDPLQEYKSEAFGFFNTLLTHLRKDVVSQIARIEPNNINNQELN*********************************RNHPCPCGSGKK*KHC*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSHLAKLASKLLIPSNERRLRPYYAKVIAINELEKEISHLSDDSLANKTSEFKERINNGETLDDLLVPAFAVVREVARRTLGMRPFDVQLLGGMILHKGCVAEMKTGEGKTLAAVLPVYLNALSGKGVHVVTVNDYLARRDSNTMSAIYKFLGLSTGVVFHDLSDDKRRAAYACDITYITNNELGFDYLRDNMQYRRVDMVQRGHNFAIVDEVDSIFIDEARTPLIISGPVEDHSDLYRTIDSIIIQLHPSDYEIDEKQRTVHFSEKGTERIEELLHGENLLKSGGLYSFENVAIVHLINNALKSHTLFLRNRDYIVNRDEVVIIDEFTGRMMPGRRYSDGQHQALEAKERVKIQPENQTLSSITFQNYFLKYRKLSGMTGTASTEAEELANIYNLDVIEVPTNVPVIRIDEHDEIYRTSEEKYAAIIAEIIDSHKKGQPVLVGTPSIEKSEYLASQLRKHKFTKFQILNALYHEKEAYIISQAGIPGAVTIATNMAGRGTDIQLGGNVAMRIEHELANISDEEIRNKRIKMIQEEVQSLKEKAIVAGGLYVISTERHESRRIDNQLRGRSGRQGDPGRSKFYLSLQDDLMRIFGSPRMESFLRKIGLKEGEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLNEQRKIIFEQRLEIIDTENILEIIADMRHDTLHNIVEKCIPNNSYPEKWDIKKLETEIYEIFGIHFPVLEWRNDNGIDHTEMSKRIFAKADKIAEDQENSFGTEKMQALGRHILLHTLDSFWREHMARLEHSRSIIGFRGYAQRDPLQEYKSEAFGFFNTLLTHLRKDVVSQIARIEPNNINNQELNNSLPYIAENDHGPVIQKENELDTPNVCKTSKIKRNHPCPCGSGKKYKHCHGSYL
MLSHLAKLASKLLIPSNERRLRPYYAKVIAINELEKEISHLSDDSLANKTSEFKERINNGETLDDLLVPAFAVVREVARRTLGMRPFDVQLLGGMILHKGCVAEMKTGEGKTLAAVLPVYLNALSGKGVHVVTVNDYLARRDSNTMSAIYKFLGLSTGVVFHDLSDDKRRAAYACDITYITNNELGFDYLRDNMQYRRVDMVQRGHNFAIVDEVDSIFIDEARTPLIISGPVEDHSDLYRTIDSIIIQLHPSDYEIDEKQRTVHFSEKGTERIEELLHGENLLKSGGLYSFENVAIVHLINNALKSHTLFLRNRDYIVNRDEVVIIDEFTGRMMPGRRYSDGQHQALEAKERVKIQPENQTLSSITFQNYFLKYRKLSGMTGTASTEAEELANIYNLDVIEVPTNVPVIRIDEHDEIYRTSEEKYAAIIAEIIDSHKKGQPVLVGTPSIEKSEYLASQLRKHKFTKFQILNALYHEKEAYIISQAGIPGAVTIATNMAGRGTDIQLGGNVAMRIEHELANISDEEIRNKRIKMIQEEVQSLKEKAIVAGGLYVISTERHESRRIDNQLRGRSGRQGDPGRSKFYLSLQDDLMRIFGSPRMESFLRKIGLKEGEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLNEQRKIIFEQRLEIIDTENILEIIADMRHDTLHNIVEKCIPNNSYPEKWDIKKLETEIYEIFGIHFPVLEWRNDNGIDHTEMSKRIFAKADKIAEDQENSFGTEKMQALGRHILLHTLDSFWREHMARLEHSRSIIGFRGYAQRDPLQEYKSEAFGFFNTLLTHLRKDVVSQIARIEPNNINNQELNNSLPYIAENDHGPVIQKENELDTPNVCKTSKIKRNHPCPCGSGKKYKHCHGSYL
MLSHLAKLASKLLIPSNERRLRPYYAKVIAINELEKEISHLSDDSLANKTSEFKERINNGETLDDLLVPAFAVVREVARRTLGMRPFDVQLLGGMILHKGCVAEMKTGEGKTLAAVLPVYLNALSGKGVHVVTVNDYLARRDSNTMSAIYKFLGLSTGVVFHDLSDDKRRAAYACDITYITNNELGFDYLRDNMQYRRVDMVQRGHNFAIVDEVDSIFIDEARTPLIISGPVEDHSDLYRTIDSIIIQLHPSDYEIDEKQRTVHFSEKGTERIEELLHGENLLKSGGLYSFENVAIVHLINNALKSHTLFLRNRDYIVNRDEVVIIDEFTGRMMPGRRYSDGQHQALEAKERVKIQPENQTLSSITFQNYFLKYRKLSGMTGTASTEAEELANIYNLDVIEVPTNVPVIRIDEHDEIYRTSEEKYAAIIAEIIDSHKKGQPVLVGTPSIEKSEYLASQLRKHKFTKFQILNALYHEKEAYIISQAGIPGAVTIATNMAGRGTDIQLGGNVAMRIEHELANISDEEIRNKRIKMIQEEVQSLKEKAIVAGGLYVISTERHESRRIDNQLRGRSGRQGDPGRSKFYLSLQDDLMRIFGSPRMESFLRKIGLKEGEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLNEQRKIIFEQRLEIIDTENILEIIADMRHDTLHNIVEKCIPNNSYPEKWDIKKLETEIYEIFGIHFPVLEWRNDNGIDHTEMSKRIFAKADKIAEDQENSFGTEKMQALGRHILLHTLDSFWREHMARLEHSRSIIGFRGYAQRDPLQEYKSEAFGFFNTLLTHLRKDVVSQIARIEPNNINNQELNNSLPYIAENDHGPVIQKENELDTPNVCKTSKIKRNHPCPCGSGKKYKHCHGSYL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target890 preprotein translocase subunit SecA [Candidatus Liberib
315122248894 preprotein translocase subunit SecA [Candidatus Liberib 1 0.0
332716318902 protein translocase subunit secA [Agrobacterium sp. H13 1 0.0
159185781902 preprotein translocase subunit SecA [Agrobacterium tume 1 0.0
86359354904 preprotein translocase subunit SecA [Rhizobium etli CFN 1 0.0
327193394904 protein-export translocase protein [Rhizobium etli CNPA 1 0.0
209551116905 preprotein translocase subunit SecA [Rhizobium legumino 1 0.0
190893606904 protein-export translocase [Rhizobium etli CIAT 652] Le 1 0.0
116254034905 preprotein translocase subunit SecA [Rhizobium legumino 1 0.0
15966380903 preprotein translocase subunit SecA [Sinorhizobium meli 1 0.0
241206517905 preprotein translocase subunit SecA [Rhizobium legumino 1 0.0
>gi|315122248|ref|YP_004062737.1| preprotein translocase subunit SecA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 894 Back     alignment and organism information
 Score = 1510 bits (3910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/890 (80%), Positives = 806/890 (90%), Gaps = 5/890 (0%)

Query: 5   LAKLASKLLIPSNERRLRPYYAKVIAINELEKEISHLSDDSLANKTSEFKERINNGETLD 64
           L KLASKL  PS ERRLRPYY ++ AIN LE+E+S LS+D L+NKT EFK  I++G++LD
Sbjct: 4   LIKLASKLFAPSKERRLRPYYKQISAINGLEEEMSRLSNDELSNKTLEFKRHISDGKSLD 63

Query: 65  DLLVPAFAVVREVARRTLGMRPFDVQLLGGMILHKGCVAEMKTGEGKTLAAVLPVYLNAL 124
           DLLVPAFAVVRE A R L MRPFDVQL+GGMILHKGC+AEMKTGEGKTLAAVLPVYLNAL
Sbjct: 64  DLLVPAFAVVRETAHRILKMRPFDVQLVGGMILHKGCIAEMKTGEGKTLAAVLPVYLNAL 123

Query: 125 SGKGVHVVTVNDYLARRDSNTMSAIYKFLGLSTGVVFHDLSDDKRRAAYACDITYITNNE 184
           SGKGVHVVTVNDYLARRDS++MS IY+FLGLSTGVV H+LSDD+RRAAYACDITYITNNE
Sbjct: 124 SGKGVHVVTVNDYLARRDSSSMSPIYEFLGLSTGVVTHNLSDDERRAAYACDITYITNNE 183

Query: 185 LGFDYLRDNMQYRRVDMVQRGHNFAIVDEVDSIFIDEARTPLIISGPVEDHSDLYRTIDS 244
           LGFDYLRDNMQY+R DMVQRGHNFAI+DEVDSI IDEARTPLIISGPVED SDLY+TIDS
Sbjct: 184 LGFDYLRDNMQYKRADMVQRGHNFAIIDEVDSILIDEARTPLIISGPVEDQSDLYKTIDS 243

Query: 245 IIIQLHPSDYEIDEKQRTVHFSEKGTERIEELLHGENLLKSGGLYSFENVAIVHLINNAL 304
           II +L PSDYEIDEKQRTVHFSEKGTER+EELL  ENL+KSGG+Y FENVAIVHL+NNAL
Sbjct: 244 IITRLQPSDYEIDEKQRTVHFSEKGTERVEELLFSENLIKSGGMYDFENVAIVHLVNNAL 303

Query: 305 KSHTLFLRNRDYIVNRDEVVIIDEFTGRMMPGRRYSDGQHQALEAKERVKIQPENQTLSS 364
           KSHTLF R+RDYIVN +EVVIIDEFTGRMMPGRRY+DGQHQALEAKERVKIQPENQTLSS
Sbjct: 304 KSHTLFFRDRDYIVNHNEVVIIDEFTGRMMPGRRYADGQHQALEAKERVKIQPENQTLSS 363

Query: 365 ITFQNYFLKYRKLSGMTGTASTEAEELANIYNLDVIEVPTNVPVIRIDEHDEIYRTSEEK 424
           ITFQNYFLKY+KLSGMTGTASTEAEEL+NIYNLDV E+PTN+PVIRIDEHDE+Y+TSEEK
Sbjct: 364 ITFQNYFLKYKKLSGMTGTASTEAEELSNIYNLDVFEIPTNLPVIRIDEHDEVYQTSEEK 423

Query: 425 YAAIIAEIIDSHKKGQPVLVGTPSIEKSEYLASQLRKHKFTKFQILNALYHEKEAYIISQ 484
           YAAIIAEIIDSHKKGQPVLVGT SIEKSEYLA+QLRKHKFT F+ILNALYHE+EAYIISQ
Sbjct: 424 YAAIIAEIIDSHKKGQPVLVGTSSIEKSEYLANQLRKHKFTNFKILNALYHEQEAYIISQ 483

Query: 485 AGIPGAVTIATNMAGRGTDIQLGGNVAMRIEHELANISDEEIRNKRIKMIQEEVQSLKEK 544
           AGIPGA+TIATNMAGRGTDIQLGGNV MRIEHEL NIS+EE RN+RI+ I EE+QSLK K
Sbjct: 484 AGIPGAITIATNMAGRGTDIQLGGNVKMRIEHELLNISNEEKRNQRIQQINEEIQSLKSK 543

Query: 545 AIVAGGLYVISTERHESRRIDNQLRGRSGRQGDPGRSKFYLSLQDDLMRIFGSPRMESFL 604
           AI AGGLYVI+TERHESRRIDNQLRGRSGRQGDPGRSKFYLSLQDDLMRIFGSPRMESFL
Sbjct: 544 AIAAGGLYVIATERHESRRIDNQLRGRSGRQGDPGRSKFYLSLQDDLMRIFGSPRMESFL 603

Query: 605 RKIGLKEGEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLNEQRKIIFEQRLEII 664
           +KIGL++GEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLN QRKIIFEQRLEII
Sbjct: 604 QKIGLEKGEAIIHPWINKAIERAQQKVEARNFETRKNLLKYDDVLNAQRKIIFEQRLEII 663

Query: 665 DTENILEIIADMRHDTLHNIVEKCIPNNSYPEKWDIKKLETEIYEIFGIHFPVLEWRNDN 724
           DTENILEII DMR++T H+I++K IP NSYPEKWD+++LE+E+ E+FG HFP++EWRN++
Sbjct: 664 DTENILEIIGDMRYETAHSIIKKYIPTNSYPEKWDVEQLESELNEVFGAHFPIIEWRNED 723

Query: 725 GIDHTEMSKRIFAKADKIAEDQENSFGTEKMQALGRHILLHTLDSFWREHMARLEHSRSI 784
           GIDH E+SKRI  K DKIA DQ+ SFG EK+Q +GR+I+LHTLD FWREH+  LEHSRS+
Sbjct: 724 GIDHNEISKRIMDKIDKIAADQQKSFGVEKIQEIGRYIILHTLDYFWREHITMLEHSRSV 783

Query: 785 IGFRGYAQRDPLQEYKSEAFGFFNTLLTHLRKDVVSQIARIEPNNINNQELNN---SLPY 841
           IGFRGYAQRDPLQEYKSEAFGFFNTLLT LR+DVVSQ+  I+ + INN   ++   S+ +
Sbjct: 784 IGFRGYAQRDPLQEYKSEAFGFFNTLLTSLRRDVVSQLTHIDSSYINNVPEDSPAVSITH 843

Query: 842 IAENDHGPVI--QKENELDTPNVCKTSKIKRNHPCPCGSGKKYKHCHGSY 889
             + D+G ++    +  ++ P++ +   IKRN PCPCG+GKKYKHCHGSY
Sbjct: 844 CVKKDNGHLVVAHTKEAINIPDISEKKHIKRNDPCPCGNGKKYKHCHGSY 893


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332716318|ref|YP_004443784.1| protein translocase subunit secA [Agrobacterium sp. H13-3] Length = 902 Back     alignment and organism information
>gi|159185781|ref|NP_357091.2| preprotein translocase subunit SecA [Agrobacterium tumefaciens str. C58] Length = 902 Back     alignment and organism information
>gi|86359354|ref|YP_471246.1| preprotein translocase subunit SecA [Rhizobium etli CFN 42] Length = 904 Back     alignment and organism information
>gi|327193394|gb|EGE60294.1| protein-export translocase protein [Rhizobium etli CNPAF512] Length = 904 Back     alignment and organism information
>gi|209551116|ref|YP_002283033.1| preprotein translocase subunit SecA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 905 Back     alignment and organism information
>gi|190893606|ref|YP_001980148.1| protein-export translocase [Rhizobium etli CIAT 652] Length = 904 Back     alignment and organism information
>gi|116254034|ref|YP_769872.1| preprotein translocase subunit SecA [Rhizobium leguminosarum bv. viciae 3841] Length = 905 Back     alignment and organism information
>gi|15966380|ref|NP_386733.1| preprotein translocase subunit SecA [Sinorhizobium meliloti 1021] Length = 903 Back     alignment and organism information
>gi|241206517|ref|YP_002977613.1| preprotein translocase subunit SecA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 905 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target890 preprotein translocase subunit SecA [Candidatus Liberib
CHL00122870 CHL00122, secA, preprotein translocase subunit SecA; Va 0.0
TIGR00963745 TIGR00963, secA, preprotein translocase, SecA subunit 0.0
PRK12906796 PRK12906, secA, preprotein translocase subunit SecA; Re 0.0
PRK09200790 PRK09200, PRK09200, preprotein translocase subunit SecA 0.0
PRK12903925 PRK12903, secA, preprotein translocase subunit SecA; Re 0.0
TIGR03714762 TIGR03714, secA2, accessory Sec system translocase SecA 0.0
PRK12326764 PRK12326, PRK12326, preprotein translocase subunit SecA 1e-162
PRK12904830 PRK12904, PRK12904, preprotein translocase subunit SecA 0.0
PRK13107908 PRK13107, PRK13107, preprotein translocase subunit SecA 0.0
PRK13103913 PRK13103, secA, preprotein translocase subunit SecA; Re 0.0
PRK13104896 PRK13104, secA, preprotein translocase subunit SecA; Re 0.0
COG0653822 COG0653, SecA, Preprotein translocase subunit SecA (ATP 0.0
PRK12898656 PRK12898, secA, preprotein translocase subunit SecA; Re 0.0
PRK12902939 PRK12902, secA, preprotein translocase subunit SecA; Re 0.0
pfam07517381 pfam07517, SecA_DEAD, SecA DEAD-like domain 1e-180
PRK129011112 PRK12901, secA, preprotein translocase subunit SecA; Re 1e-156
PRK129001025 PRK12900, secA, preprotein translocase subunit SecA; Re 1e-146
PRK12899970 PRK12899, secA, preprotein translocase subunit SecA; Re 1e-130
PRK12901 1112 PRK12901, secA, preprotein translocase subunit SecA; Re 6e-74
PRK12899970 PRK12899, secA, preprotein translocase subunit SecA; Re 6e-73
PRK129001025 PRK12900, secA, preprotein translocase subunit SecA; Re 6e-68
pfam07516211 pfam07516, SecA_SW, SecA Wing and Scaffold domain 8e-67
PRK12902939 PRK12902, secA, preprotein translocase subunit SecA; Re 9e-56
pfam01043113 pfam01043, SecA_PP_bind, SecA preprotein cross-linking 1e-42
pfam0281019 pfam02810, SEC-C, SEC-C motif 3e-09
PRK05590166 PRK05590, PRK05590, hypothetical protein; Provisional 3e-08
PRK01617154 PRK01617, PRK01617, hypothetical protein; Provisional 2e-05
PRK00183157 PRK00183, PRK00183, hypothetical protein; Provisional 1e-04
PRK10396221 PRK10396, PRK10396, hypothetical protein; Provisional 1e-04
PRK01752156 PRK01752, PRK01752, hypothetical protein; Provisional 2e-04
PRK12318 291 PRK12318, PRK12318, methionine aminopeptidase; Provisio 2e-04
PRK02250166 PRK02250, PRK02250, hypothetical protein; Provisional 7e-04
COG3012151 COG3012, COG3012, Uncharacterized protein conserved in 0.002
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-04
pfam00270167 pfam00270, DEAD, DEAD/DEAH box helicase 4e-04
cd00268203 cd00268, DEADc, DEAD-box helicases 0.002
>gnl|CDD|177045 CHL00122, secA, preprotein translocase subunit SecA; Validated Back     alignment and domain information
>gnl|CDD|162135 TIGR00963, secA, preprotein translocase, SecA subunit Back     alignment and domain information
>gnl|CDD|183827 PRK12906, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|181694 PRK09200, PRK09200, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|183825 PRK12903, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|163426 TIGR03714, secA2, accessory Sec system translocase SecA2 Back     alignment and domain information
>gnl|CDD|183441 PRK12326, PRK12326, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|183826 PRK12904, PRK12904, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|183863 PRK13107, PRK13107, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|183859 PRK13103, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|183860 PRK13104, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|30998 COG0653, SecA, Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|183820 PRK12898, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|183824 PRK12902, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|148880 pfam07517, SecA_DEAD, SecA DEAD-like domain Back     alignment and domain information
>gnl|CDD|183823 PRK12901, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|183822 PRK12900, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|183821 PRK12899, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|183823 PRK12901, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|183821 PRK12899, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|183822 PRK12900, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|148879 pfam07516, SecA_SW, SecA Wing and Scaffold domain Back     alignment and domain information
>gnl|CDD|183824 PRK12902, secA, preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>gnl|CDD|144583 pfam01043, SecA_PP_bind, SecA preprotein cross-linking domain Back     alignment and domain information
>gnl|CDD|145784 pfam02810, SEC-C, SEC-C motif Back     alignment and domain information
>gnl|CDD|180153 PRK05590, PRK05590, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|179309 PRK01617, PRK01617, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|166842 PRK00183, PRK00183, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|182427 PRK10396, PRK10396, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|179332 PRK01752, PRK01752, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|183434 PRK12318, PRK12318, methionine aminopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|179393 PRK02250, PRK02250, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|32829 COG3012, COG3012, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|144015 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|28928 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 890 preprotein translocase subunit SecA [Candidatus Liberib
TIGR00963904 secA preprotein translocase, SecA subunit; InterPro: IP 100.0
PRK12902946 secA preprotein translocase subunit SecA; Reviewed 100.0
CHL00122891 secA preprotein translocase subunit SecA; Validated 100.0
PRK12903885 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK09200799 preprotein translocase subunit SecA; Reviewed 100.0
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK13107908 preprotein translocase subunit SecA; Reviewed 100.0
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK12900983 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK12904833 preprotein translocase subunit SecA; Reviewed 100.0
PRK129011111 secA preprotein translocase subunit SecA; Reviewed 100.0
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, RNA h 100.0
PRK12906823 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK12899969 secA preprotein translocase subunit SecA; Reviewed 100.0
PRK12326775 preprotein translocase subunit SecA; Reviewed 100.0
PRK12898673 secA preprotein translocase subunit SecA; Reviewed 100.0
pfam07517381 SecA_DEAD SecA DEAD-like domain. SecA protein binds to 100.0
pfam07516211 SecA_SW SecA Wing and Scaffold domain. SecA protein bin 100.0
pfam01043113 SecA_PP_bind SecA preprotein cross-linking domain. The 99.97
PRK10396221 hypothetical protein; Provisional 99.64
PRK05590165 hypothetical protein; Provisional 99.55
PRK02250166 hypothetical protein; Provisional 99.39
PRK00183157 hypothetical protein; Provisional 99.35
PRK01617151 hypothetical protein; Provisional 99.31
PRK01752157 hypothetical protein; Provisional 99.16
COG3318216 Predicted metal-binding protein related to the C-termin 99.07
COG3012151 Uncharacterized protein conserved in bacteria [Function 98.78
pfam0281026 SEC-C SEC-C motif. The SEC-C motif found in the C-termi 98.53
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 99.6
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 99.58
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 99.57
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.56
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 99.56
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 99.46
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 99.36
KOG0331519 consensus 99.07
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 99.03
PRK13766764 Hef nuclease; Provisional 99.03
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 99.0
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 98.9
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recombinati 98.81
KOG0347731 consensus 98.41
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, reco 98.35
COG1205 851 Distinct helicase family with a unique C-terminal domai 98.16
KOG0350620 consensus 98.04
KOG0335482 consensus 97.84
KOG0334997 consensus 97.24
KOG0389941 consensus 94.25
KOG0387923 consensus 93.98
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 99.58
KOG0330476 consensus 98.91
TIGR01389607 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR0062 92.91
PTZ00110602 helicase; Provisional 99.44
KOG0336629 consensus 98.0
KOG0333673 consensus 99.07
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 97.3
PRK106891148 transcription-repair coupling factor; Provisional 96.81
KOG0351941 consensus 95.96
COG11971139 Mfd Transcription-repair coupling factor (superfamily I 95.59
KOG09241042 consensus 95.39
KOG0923902 consensus 94.91
KOG0332477 consensus 94.53
PRK01172674 ski2-like helicase; Provisional 99.02
COG1201814 Lhr Lhr-like helicases [General function prediction onl 98.57
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 98.42
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 98.27
KOG0340442 consensus 97.94
PRK09401 1176 reverse gyrase; Reviewed 97.8
smart00487201 DEXDc DEAD-like helicases superfamily. 97.76
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 97.58
PRK02362736 ski2-like helicase; Provisional 97.58
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 97.45
PRK00254717 ski2-like helicase; Provisional 97.37
KOG0345567 consensus 97.31
KOG0343758 consensus 97.3
KOG0338691 consensus 97.13
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 97.12
KOG0342543 consensus 96.97
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 96.88
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 96.38
KOG0952 1230 consensus 95.6
KOG0337529 consensus 95.47
KOG0348708 consensus 95.26
PRK05580699 primosome assembly protein PriA; Validated 94.99
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 92.91
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 92.32
PRK10536262 hypothetical protein; Provisional 91.23
KOG0922674 consensus 90.26
KOG0328400 consensus 90.01
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 98.93
KOG0344593 consensus 97.9
KOG0339731 consensus 97.21
PRK114481126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 95.39
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 94.28
KOG0341610 consensus 92.79
KOG0352641 consensus 90.31
PRK13767 878 ATP-dependent helicase; Provisional 98.9
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 97.6
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 97.83
COG1200677 RecG RecG-like helicase [DNA replication, recombination 97.8
COG1204766 Superfamily II helicase [General function prediction on 97.51
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 97.46
PRK00254717 ski2-like helicase; Provisional 97.07
PRK02362736 ski2-like helicase; Provisional 96.97
PRK08074932 bifunctional ATP-dependent DNA helicase/DNA polymerase 97.05
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 95.77
smart0049082 HELICc helicase superfamily c-terminal domain. 96.74
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 95.98
COG1202830 Superfamily II helicase, archaea-specific [General func 96.44
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polymerase 96.29
pfam04851103 ResIII Type III restriction enzyme, res subunit. 96.18
smart00488289 DEXDc2 DEAD-like helicases superfamily. 90.98
smart00489289 DEXDc3 DEAD-like helicases superfamily. 90.98
COG1200677 RecG RecG-like helicase [DNA replication, recombination 96.13
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 95.18
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 93.28
TIGR00580997 mfd transcription-repair coupling factor; InterPro: IPR 92.14
PRK00339249 minC septum formation inhibitor; Reviewed 96.1
PRK04804220 minC septum formation inhibitor; Reviewed 96.06
PRK01973266 septum formation inhibitor; Reviewed 93.42
PRK04596248 minC septum formation inhibitor; Reviewed 92.8
PRK04516235 minC septum formation inhibitor; Reviewed 91.71
PRK00030292 minC septum formation inhibitor; Provisional 91.6
PRK05177234 minC septum formation inhibitor; Reviewed 90.83
PRK03511235 minC septum formation inhibitor; Reviewed 95.99
PRK09694878 hypothetical protein; Provisional 95.54
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 95.06
KOG0326459 consensus 94.64
KOG0346569 consensus 94.49
COG1199654 DinG Rad3-related DNA helicases [Transcription / DNA re 94.26
>TIGR00963 secA preprotein translocase, SecA subunit; InterPro: IPR000185 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>pfam07517 SecA_DEAD SecA DEAD-like domain Back     alignment and domain information
>pfam07516 SecA_SW SecA Wing and Scaffold domain Back     alignment and domain information
>pfam01043 SecA_PP_bind SecA preprotein cross-linking domain Back     alignment and domain information
>PRK10396 hypothetical protein; Provisional Back     alignment and domain information
>PRK05590 hypothetical protein; Provisional Back     alignment and domain information
>PRK02250 hypothetical protein; Provisional Back     alignment and domain information
>PRK00183 hypothetical protein; Provisional Back     alignment and domain information
>PRK01617 hypothetical protein; Provisional Back     alignment and domain information
>PRK01752 hypothetical protein; Provisional Back     alignment and domain information
>COG3318 Predicted metal-binding protein related to the C-terminal domain of SecA [General function prediction only] Back     alignment and domain information
>COG3012 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam02810 SEC-C SEC-C motif Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0331 consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0347 consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0350 consensus Back     alignment and domain information
>KOG0335 consensus Back     alignment and domain information
>KOG0334 consensus Back     alignment and domain information
>KOG0389 consensus Back     alignment and domain information
>KOG0387 consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0330 consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR006293 The ATP-dependent DNA helicase RecQ (3 Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0336 consensus Back     alignment and domain information
>KOG0333 consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0351 consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0924 consensus Back     alignment and domain information
>KOG0923 consensus Back     alignment and domain information
>KOG0332 consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>pfam00270 DEAD DEAD/DEAH box helicase Back     alignment and domain information
>KOG0340 consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0345 consensus Back     alignment and domain information
>KOG0343 consensus Back     alignment and domain information
>KOG0338 consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0952 consensus Back     alignment and domain information
>KOG0337 consensus Back     alignment and domain information
>KOG0348 consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0922 consensus Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0344 consensus Back     alignment and domain information
>KOG0339 consensus Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information