254780331

254780331

50S ribosomal protein L9

GeneID in NCBI database:8209316Locus tag:CLIBASIA_01080
Protein GI in NCBI database:254780331Protein Accession:YP_003064744.1
Gene range:+(225696, 226235)Protein Length:179aa
Gene description:50S ribosomal protein L9
COG prediction:[J] Ribosomal protein L9
KEGG prediction:rplI; 50S ribosomal protein L9; K02939 large subunit ribosomal protein L9
SEED prediction:LSU ribosomal protein L9p
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome LSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18
MYDTQKNKKGKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHEEEILS
cccccccccccEEEEEEEEEEcccccccccEEEcccccEEEEEcccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccEEEEcccHHHHHHHHHHcccccccEEEEEcccHHccEEEEEEEEEcccEEEEEEEEEEEcccHHHHHHHHHHHHHHHcc
ccccccHHHcHHHHHHHHHHHHHHHcccccEEEcccccHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccEEccccHHHHHHHHHHcccEEEccEEEcccccHccccEEEEEEEcccEEEEEEEEEEccHHHHHHHHHHHHHHHcccc
mydtqknkkgkKIMEVILLQNvtnlgpmgevvkvkngyarnyllpkKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAgdtgylygsvssRDIADLLIEEgfdvnrgqinlkspiksvgiHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHEEEILS
mydtqknkkgkkiMEVILLqnvtnlgpmgevVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKqdilgeheeeils
MYDTQKNKKGKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHEEEILS
************IMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFE*********************KDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVAR********************
*********GKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHEEEILS
***TQKNKKGKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHE*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYDTQKNKKGKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHEEEILS
MYDTQKNKKGKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHEEEILS
MYDTQKNKKGKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHEEEILS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target179 50S ribosomal protein L9 [Candidatus Liberibacter asiat
315122244169 50S ribosomal protein L9 [Candidatus Liberibacter solan 1 5e-62
260466965194 ribosomal protein L9 [Mesorhizobium opportunistum WSM20 1 5e-46
319404040192 50S ribosomal protein L9 [Bartonella rochalimae ATCC BA 1 1e-45
227821457191 50S ribosomal protein L9 [Sinorhizobium fredii NGR234] 1 2e-45
319407052192 50S ribosomal protein L9 [Bartonella sp. 1-1C] Length = 1 8e-45
319784440194 ribosomal protein L9 [Mesorhizobium ciceri biovar biser 1 9e-45
13476508194 50S ribosomal protein L9 [Mesorhizobium loti MAFF303099 1 9e-45
312113719192 ribosomal protein L9 [Rhodomicrobium vannielii ATCC 171 1 9e-45
222085433193 ribosomal protein L9 [Agrobacterium radiobacter K84] Le 1 1e-44
15888431191 50S ribosomal protein L9 [Agrobacterium tumefaciens str 1 2e-44
>gi|315122244|ref|YP_004062733.1| 50S ribosomal protein L9 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 169 Back     alignment and organism information
 Score =  240 bits (613), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 143/164 (87%)

Query: 14  MEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLE 73
           MEVILLQN++NLGPMG+VVKVKNGYARNYLLP KKALR N +N+  FESQRSVL+  +LE
Sbjct: 1   MEVILLQNMSNLGPMGKVVKVKNGYARNYLLPSKKALRFNAKNEAFFESQRSVLQEKDLE 60

Query: 74  KKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSPI 133
           +K K+E ++K LA+  FS+IR+AGDTG+LYGSVSSRDIADLL+E+GF++NRG+INLK PI
Sbjct: 61  QKKKFEEMAKVLAEDVFSIIRSAGDTGHLYGSVSSRDIADLLLEKGFNINRGKINLKVPI 120

Query: 134 KSVGIHNIMISLHADVSTTITLNVARSTEEMVKQDILGEHEEEI 177
           K +G+HNI I LHADV+ TITLN+ARSTEEMVKQ+   + EEEI
Sbjct: 121 KLIGVHNIEILLHADVTATITLNIARSTEEMVKQEKTLKPEEEI 164


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|260466965|ref|ZP_05813147.1| ribosomal protein L9 [Mesorhizobium opportunistum WSM2075] Length = 194 Back     alignment and organism information
>gi|319404040|emb|CBI77628.1| 50S ribosomal protein L9 [Bartonella rochalimae ATCC BAA-1498] Length = 192 Back     alignment and organism information
>gi|227821457|ref|YP_002825427.1| 50S ribosomal protein L9 [Sinorhizobium fredii NGR234] Length = 191 Back     alignment and organism information
>gi|319407052|emb|CBI80689.1| 50S ribosomal protein L9 [Bartonella sp. 1-1C] Length = 192 Back     alignment and organism information
>gi|319784440|ref|YP_004143916.1| ribosomal protein L9 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 194 Back     alignment and organism information
>gi|13476508|ref|NP_108078.1| 50S ribosomal protein L9 [Mesorhizobium loti MAFF303099] Length = 194 Back     alignment and organism information
>gi|312113719|ref|YP_004011315.1| ribosomal protein L9 [Rhodomicrobium vannielii ATCC 17100] Length = 192 Back     alignment and organism information
>gi|222085433|ref|YP_002543963.1| ribosomal protein L9 [Agrobacterium radiobacter K84] Length = 193 Back     alignment and organism information
>gi|15888431|ref|NP_354112.1| 50S ribosomal protein L9 [Agrobacterium tumefaciens str. C58] Length = 191 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target179 50S ribosomal protein L9 [Candidatus Liberibacter asiat
PRK00137147 PRK00137, rplI, 50S ribosomal protein L9; Reviewed 7e-45
TIGR00158148 TIGR00158, L9, ribosomal protein L9 2e-25
PRK14538838 PRK14538, PRK14538, putative bifunctional signaling pro 8e-17
CHL00160153 CHL00160, rpl9, ribosomal protein L9; Provisional 7e-15
COG0359148 COG0359, RplI, Ribosomal protein L9 [Translation, ribos 2e-34
pfam0394886 pfam03948, Ribosomal_L9_C, Ribosomal protein L9, C-term 1e-18
pfam0128148 pfam01281, Ribosomal_L9_N, Ribosomal protein L9, N-term 8e-15
KOG4607222 KOG4607, KOG4607, KOG4607, Mitochondrial ribosomal prot 2e-08
>gnl|CDD|178893 PRK00137, rplI, 50S ribosomal protein L9; Reviewed Back     alignment and domain information
>gnl|CDD|129262 TIGR00158, L9, ribosomal protein L9 Back     alignment and domain information
>gnl|CDD|173004 PRK14538, PRK14538, putative bifunctional signaling protein/50S ribosomal protein L9; Provisional Back     alignment and domain information
>gnl|CDD|177073 CHL00160, rpl9, ribosomal protein L9; Provisional Back     alignment and domain information
>gnl|CDD|30708 COG0359, RplI, Ribosomal protein L9 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|146531 pfam03948, Ribosomal_L9_C, Ribosomal protein L9, C-terminal domain Back     alignment and domain information
>gnl|CDD|144760 pfam01281, Ribosomal_L9_N, Ribosomal protein L9, N-terminal domain Back     alignment and domain information
>gnl|CDD|39807 KOG4607, KOG4607, KOG4607, Mitochondrial ribosomal protein L9 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 179 50S ribosomal protein L9 [Candidatus Liberibacter asiat
PRK00137147 rplI 50S ribosomal protein L9; Reviewed 100.0
CHL00160154 rpl9 ribosomal protein L9; Provisional 100.0
COG0359148 RplI Ribosomal protein L9 [Translation, ribosomal struc 100.0
TIGR00158151 L9 ribosomal protein L9; InterPro: IPR000244 Ribosomes 99.92
KOG4607222 consensus 99.87
pfam0394886 Ribosomal_L9_C Ribosomal protein L9, C-terminal domain. 99.86
pfam0128148 Ribosomal_L9_N Ribosomal protein L9, N-terminal domain. 99.75
>PRK00137 rplI 50S ribosomal protein L9; Reviewed Back     alignment and domain information
>CHL00160 rpl9 ribosomal protein L9; Provisional Back     alignment and domain information
>COG0359 RplI Ribosomal protein L9 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00158 L9 ribosomal protein L9; InterPro: IPR000244 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG4607 consensus Back     alignment and domain information
>pfam03948 Ribosomal_L9_C Ribosomal protein L9, C-terminal domain Back     alignment and domain information
>pfam01281 Ribosomal_L9_N Ribosomal protein L9, N-terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target179 50S ribosomal protein L9 [Candidatus Liberibacter asiat
1p85_F149 Real Space Refined Coordinates Of The 50s Subunit F 5e-24
1vsa_G148 Crystal Structure Of A 70s Ribosome-Trna Complex Re 2e-23
2v47_I148 Structure Of The Ribosome Recycling Factor Bound To 3e-23
2hgj_K148 Crystal Structure Of The 70s Thermus Thermophilus R 3e-23
3bbo_J197 Homology Model For The Spinach Chloroplast 50s Subu 8e-23
3pyo_H145 Crystal Structure Of A Complex Containing Domain 3 8e-23
2j01_I146 Structure Of The Thermus Thermophilus 70s Ribosome 1e-22
1nkw_F146 Crystal Structure Of The Large Ribosomal Subunit Fr 4e-21
487d_K149 Seven Ribosomal Proteins Fitted To A Cryo-Electron 6e-20
3iy9_H60 Leishmania Tarentolae Mitochondrial Large Ribosomal 7e-11
1pnu_F52 Crystal Structure Of A Streptomycin Dependent Ribos 2e-10
2hba_A52 Crystal Structure Of N-Terminal Domain Of Ribosomal 3e-08
2hbb_A51 Crystal Structure Of The N-Terminal Domain Of Ribos 2e-04
1cqu_A56 Solution Structure Of The N-Terminal Domain Of Ribo 3e-04
2hvf_A52 Crystal Structure Of N-Terminal Domain Of Ribosomal 0.002
gi|33357907|pdb|1P85|F Chain F, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 149 Back     alignment and structure
 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 55/149 (36%), Positives = 87/149 (58%), Gaps = 2/149 (1%)

Query: 14  MEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLE 73
           M+VILL  V NLG +G+ V VK GYARN+L+P+ KA+ A K+N   FE++R+ LEA   E
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 74  KKAKYEGISKDLAKKNFSLI-RAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSP 132
             A     ++ +       I   AGD G L+GS+ +RDIAD +   G +V + ++ L + 
Sbjct: 61  VLAAANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 133 I-KSVGIHNIMISLHADVSTTITLNVARS 160
           + ++ G H +   +H++V   + +NV   
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNVVAE 149


gi|149240892|pdb|1VSA|G Chain G, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals Functional Interactions And Rearrangements. This File, 1vsa, Contains The 50s Ribosome Subunit. 30s Ribosome Subunit Is In The File 2ow8 Length = 148 Back     alignment and structure
gi|157836527|pdb|2V47|I Chain I, Structure Of The Ribosome Recycling Factor Bound To The Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And Trna-Fmet (Part 2 Of 4). This File Contains The 50s Subunit For Molecule 1. Length = 148 Back     alignment and structure
gi|119389741|pdb|2HGJ|K Chain K, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgj Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 2hgi. Length = 148 Back     alignment and structure
gi|189096132|pdb|3BBO|J Chain J, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 197 Back     alignment and structure
>gi|322812579|pdb|3PYO|H Chain H, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 145 Back     alignment and structure
>gi|116668240|pdb|2J01|I Chain I, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 146 Back     alignment and structure
gi|28948925|pdb|1NKW|F Chain F, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 146 Back     alignment and structure
gi|7767187|pdb|487D|K Chain K, Seven Ribosomal Proteins Fitted To A Cryo-Electron Microscopic Map Of The Large 50s Subunit At 7.5 Angstroms Resolution Length = 149 Back     alignment and structure
>gi|251837157|pdb|3IY9|H Chain H, Leishmania Tarentolae Mitochondrial Large Ribosomal Subunit Model Length = 60 Back     alignment and structure
>gi|34811559|pdb|1PNU|F Chain F, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 52 Back     alignment and structure
>gi|149241926|pdb|2HBA|A Chain A, Crystal Structure Of N-Terminal Domain Of Ribosomal Protein L9 (Ntl9) K12m Length = 52 Back     alignment and structure
>gi|149241930|pdb|2HBB|A Chain A, Crystal Structure Of The N-Terminal Domain Of Ribosomal Protein L9 (Ntl9) Length = 51 Back     alignment and structure
>gi|253722781|pdb|1CQU|A Chain A, Solution Structure Of The N-Terminal Domain Of Ribosomal Protein L9 Length = 56 Back     alignment and structure
>gi|149242102|pdb|2HVF|A Chain A, Crystal Structure Of N-Terminal Domain Of Ribosomal Protein L9 (Ntl9), G34da Length = 52 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target179 50S ribosomal protein L9 [Candidatus Liberibacter asiat
3bbo_J197 Ribosomal protein L9; large ribosomal subunit, spinach 4e-32
3ofq_H149 50S ribosomal protein L9; protein biosynthesis, ribosom 7e-32
1nkw_F146 50S ribosomal protein L9; ribosome, large subunit, X- R 1e-30
3i1n_H149 50S ribosomal protein L9; ribosome structure, protein-R 1e-28
1div_A149 Ribosomal protein L9; rRNA-binding; 2.60A {Bacillus ste 2e-28
2j01_I148 50S ribosomal protein L9; ribosome, tRNA, paromomycin, 2e-25
2hba_A52 BL17, 50S ribosomal protein L9; NTL9, K12M, RNA binding 5e-14
>3bbo_J Ribosomal protein L9; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} SCOP: i.1.1.1 Length = 197 Back     alignment and structure
 Score =  132 bits (333), Expect = 4e-32
 Identities = 43/161 (26%), Positives = 80/161 (49%), Gaps = 3/161 (1%)

Query: 2   YDTQKNKKGKKIMEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKEN-KILF 60
           ++    KK KK+ +VIL ++VT+LG  G+++ VK G+ RN+LLP  KA        K L 
Sbjct: 38  FEVVSQKKAKKLRKVILKEDVTDLGKQGQLLDVKAGFFRNFLLPTGKAQLMTPLLLKELK 97

Query: 61  ESQRSVLEAANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLL-IEEG 119
                +       K+   +          F + R  G    ++GSV+++D+ D++  +  
Sbjct: 98  MEDERIEAEKQRVKEEAQQLAMVFQTVGAFKVKRKGGKGKLIFGSVTAQDLVDIIKSQLQ 157

Query: 120 FDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARS 160
            D+++  ++L   I+  G +   + LH DV+  + +NV  +
Sbjct: 158 KDIDKRLVSLP-EIRETGEYIAELKLHPDVTARVKINVFAN 197


>3ofq_H 50S ribosomal protein L9; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_F 1p86_F 1vs8_H 1vs6_H 2aw4_H 2awb_H 2gya_F 2gyc_F 1vt2_H 2i2v_H 2j28_H 2i2t_H* 2qao_H* 2qba_H* 2qbc_H* 2qbe_H 2qbg_H 2qbi_H* 2qbk_H* 2qov_H ... Length = 149 Back     alignment and structure
>1nkw_F 50S ribosomal protein L9; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} SCOP: i.1.1.2 PDB: 1nwx_F* 1nwy_F* 1sm1_F* 1xbp_F* 1pnu_F 1pny_F 1vor_I 1vou_I 1vow_I 1voy_I 1vp0_I Length = 146 Back     alignment and structure
>3i1n_H 50S ribosomal protein L9; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_F 1p86_F 1vs8_H 2aw4_H 2awb_H 2gya_F 2gyc_F 1vs6_H 2i2v_H 2j28_H 2i2t_H* 2qao_H* 2qba_H* 2qbc_H* 2qbe_H 2qbg_H 2qbi_H* 2qbk_H* 2qov_H 2qox_H ... Length = 149 Back     alignment and structure
>1div_A Ribosomal protein L9; rRNA-binding; 2.60A {Bacillus stearothermophilus} SCOP: d.99.1.1 d.100.1.1 PDB: 1giy_K 1yl3_K 2b66_I 2b9n_I 2b9p_I 487d_K Length = 149 Back     alignment and structure
>2j01_I 50S ribosomal protein L9; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: d.99.1.1 d.100.1.1 PDB: 2j03_I 2jl6_I 2jl8_I 2v47_I 2v49_I 2wdi_I 2wdj_I 2wdl_I 2wdn_I 2wh2_I 3hux_I 3huz_I 3f1f_I 1vsp_G 1vsa_G 2wh4_I 3d5d_I 3d5b_I 3f1h_I 2hgu_K ... Length = 148 Back     alignment and structure
>2hba_A BL17, 50S ribosomal protein L9; NTL9, K12M, RNA binding protein; 1.25A {Geobacillus stearothermophilus} SCOP: d.100.1.1 PDB: 1cqu_A 2hbb_A 2hvf_A Length = 52 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target179 50S ribosomal protein L9 [Candidatus Liberibacter asiat
1div_A149 Ribosomal protein L9; rRNA-binding; 2.60A {Geobacillus 100.0
3bbo_J197 Ribosomal protein L9; large ribosomal subunit, spinach 100.0
1nkw_F146 50S ribosomal protein L9; ribosome, large subunit, X- R 100.0
2j01_I148 50S ribosomal protein L9; ribosome, tRNA, paromomycin, 100.0
3ofq_H149 50S ribosomal protein L9; protein biosynthesis, ribosom 100.0
2hba_A52 BL17, 50S ribosomal protein L9; NTL9, K12M, RNA binding 99.79
>1div_A Ribosomal protein L9; rRNA-binding; 2.60A {Geobacillus stearothermophilus} SCOP: d.99.1.1 d.100.1.1 PDB: 1giy_K 1yl3_K 2b66_I 2b9n_I 2b9p_I 487d_K Back     alignment and structure
Probab=100.00  E-value=0  Score=320.26  Aligned_cols=148  Identities=30%  Similarity=0.537  Sum_probs=144.3

Q ss_pred             EEEEEEEECCCCCCCCCEEEECCCCEEEEECCCCCEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             33465201117587783888277632110143787301220146888778999998422346789999887654321000
Q gi|254780331|r   14 MEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLI   93 (179)
Q Consensus        14 mkVIL~~dv~~lG~~Gdiv~Vk~GyaRN~LiP~~~A~~aT~~n~~~~~~~~~~~~~~~~~~~~~a~~~~~~L~~~~l~i~   93 (179)
                      |||||++||++||+.||+|+|+||||||||||+|+|++||++|+++++.+++..+++..+..+.|+.++++|++..++|.
T Consensus         1 MkVIL~~dv~~lG~~GdvV~Vk~GyaRNyLiP~g~A~~aT~~n~~~~~~~~~~~~~~~~~~~~~a~~l~~~l~~~~i~i~   80 (149)
T 1div_A            1 MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQKEQRQAAEELANAKKLKEQLEKLTVTIP   80 (149)
T ss_dssp             CEEEECSBSSSBGGGTEEEECCTTHHHHTTTTTTSEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCEEEE
T ss_pred             CEEEEECCCCCCCCCCCEEEECCCCHHHHHCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             97999044114798899999877014566155682455588889999999999999888887778889999730557999


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHH-CCCCCCHHHHCCCCCCCCEEEEEEEEEECCCEEEEEEEEEEECH
Q ss_conf             255654310034107899999986-08876866630265643205499999963972999999997251
Q gi|254780331|r   94 RAAGDTGYLYGSVSSRDIADLLIE-EGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARST  161 (179)
Q Consensus        94 ~k~~e~gkLfGsVt~~dI~~~L~~-~gi~I~k~~I~l~~pIk~~G~y~V~I~L~~~V~a~i~V~V~~~~  161 (179)
                      +++|++|+||||||+.||+++|.+ .|++|++++|.|++|||++|+|+|+|+||++|+++|+|+|++++
T Consensus        81 ~k~~~~gklfGsVt~~~I~~~l~~~~gi~i~k~~i~l~~~Ik~~G~y~v~i~l~~~v~~~i~v~V~~ek  149 (149)
T 1div_A           81 AKAGEGGRLFGSITSKQIAESLQAQHGLKLDKRKIELADAIRALGYTNVPVKLHPEVTATLKVHVTEQK  149 (149)
T ss_dssp             ECBCGGGEEEEEECHHHHHHHHHHHHCCCCCGGGBCCCSCEEESEEEEEEEEEETTEEEEEEEEEEECC
T ss_pred             EEECCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHCCCCCCCCCEEEEEEEEECCCEEEEEEEEEEECC
T ss_conf             974699975022489999999998519821743422445752546689999953997999999999578



>3bbo_J Ribosomal protein L9; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} SCOP: i.1.1.1 Back     alignment and structure
>1nkw_F 50S ribosomal protein L9; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} SCOP: i.1.1.2 PDB: 1nwx_F* 1nwy_F* 1sm1_F* 1xbp_F* 1pnu_F 1pny_F 1vor_I 1vou_I 1vow_I 1voy_I 1vp0_I Back     alignment and structure
>2j01_I 50S ribosomal protein L9; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: d.99.1.1 d.100.1.1 PDB: 2j03_I 2jl6_I 2jl8_I 2v47_I 2v49_I 2wdi_I 2wdj_I 2wdl_I 2wdn_I 2wh2_I 2x9s_I 2x9u_I 2xg0_I 2xg2_I 3hux_I 3huz_I 3i8f_K 3i8i_K 3i9c_K 3i9e_K ... Back     alignment and structure
>3ofq_H 50S ribosomal protein L9; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 1p85_F 1p86_F 1vs8_H 1vs6_H 2aw4_H 2awb_H 2gya_F 2gyc_F 1vt2_H 2i2v_H 2j28_H 2i2t_H* 2qao_H* 2qba_H* 2qbc_H* 2qbe_H 2qbg_H 2qbi_H* 2qbk_H* 2qov_H ... Back     alignment and structure
>2hba_A BL17, 50S ribosomal protein L9; NTL9, K12M, RNA binding protein; 1.25A {Geobacillus stearothermophilus} SCOP: d.100.1.1 PDB: 1cqu_A 2hbb_A 2hvf_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 179 50S ribosomal protein L9 [Candidatus Liberibacter asiat
d2gycf258 d.100.1.1 (F:1-58) Ribosomal protein L9 N-domain {Esche 1e-15
d2j01i255 d.100.1.1 (I:1-55) Ribosomal protein L9 N-domain {Therm 1e-14
d2hbaa152 d.100.1.1 (A:1-52) Ribosomal protein L9 N-domain {Bacil 3e-14
d2gycf191 d.99.1.1 (F:59-149) Ribosomal protein L9 C-domain {Esch 5e-14
d1diva194 d.99.1.1 (A:56-149) Ribosomal protein L9 C-domain {Baci 6e-14
d2j01i191 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Ther 8e-13
>d2gycf2 d.100.1.1 (F:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]} Length = 58 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: MbtH/L9 domain-like
superfamily: L9 N-domain-like
family: Ribosomal protein L9 N-domain
domain: Ribosomal protein L9 N-domain
species: Escherichia coli [TaxId: 562]
 Score = 76.2 bits (188), Expect = 1e-15
 Identities = 31/56 (55%), Positives = 42/56 (75%)

Query: 14 MEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEA 69
          M+VILL  V NLG +G+ V VK GYARN+L+P+ KA+ A K+N   FE++R+ LEA
Sbjct: 1  MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEA 56


>d2j01i2 d.100.1.1 (I:1-55) Ribosomal protein L9 N-domain {Thermus thermophilus [TaxId: 274]} Length = 55 Back     information, alignment and structure
>d2hbaa1 d.100.1.1 (A:1-52) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 52 Back     information, alignment and structure
>d2gycf1 d.99.1.1 (F:59-149) Ribosomal protein L9 C-domain {Escherichia coli [TaxId: 562]} Length = 91 Back     information, alignment and structure
>d1diva1 d.99.1.1 (A:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 94 Back     information, alignment and structure
>d2j01i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]} Length = 91 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target179 50S ribosomal protein L9 [Candidatus Liberibacter asiat
d1diva194 Ribosomal protein L9 C-domain {Bacillus stearothermophi 99.88
d2gycf191 Ribosomal protein L9 C-domain {Escherichia coli [TaxId: 99.86
d2j01i191 Ribosomal protein L9 C-domain {Thermus thermophilus [Ta 99.83
d2gycf258 Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 99.83
d2j01i255 Ribosomal protein L9 N-domain {Thermus thermophilus [Ta 99.81
d2hbaa152 Ribosomal protein L9 N-domain {Bacillus stearothermophi 99.79
>d1diva1 d.99.1.1 (A:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein L9 C-domain
superfamily: Ribosomal protein L9 C-domain
family: Ribosomal protein L9 C-domain
domain: Ribosomal protein L9 C-domain
species: Bacillus stearothermophilus [TaxId: 1422]
Probab=99.88  E-value=6e-23  Score=162.42  Aligned_cols=92  Identities=27%  Similarity=0.533  Sum_probs=86.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHH-CCCCCCHHHHCCCCCCCCEEEEEEEEEECCC
Q ss_conf             422346789999887654321000255654310034107899999986-0887686663026564320549999996397
Q gi|254780331|r   70 ANLEKKAKYEGISKDLAKKNFSLIRAAGDTGYLYGSVSSRDIADLLIE-EGFDVNRGQINLKSPIKSVGIHNIMISLHAD  148 (179)
Q Consensus        70 ~~~~~~~~a~~~~~~L~~~~l~i~~k~~e~gkLfGsVt~~dI~~~L~~-~gi~I~k~~I~l~~pIk~~G~y~V~I~L~~~  148 (179)
                      +.++.++.|+.++++|+++.|+|.+++|++|+||||||+.||+++|.+ .|++||+++|.|++|||++|+|.|+|+||++
T Consensus         2 k~~~~~~~A~~la~~L~~~~i~i~~k~ge~GkLfGSVt~~dI~~~l~~~~g~~idk~~I~l~~~IK~~G~y~v~i~Lh~~   81 (94)
T d1diva1           2 QAAEELANAKKLKEQLEKLTVTIPAKAGEGGRLFGSITSKQIAESLQAQHGLKLDKRKIELADAIRALGYTNVPVKLHPE   81 (94)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCEEEEECBCGGGEEEEEECHHHHHHHHHHHHCCCCCGGGBCCCSCEEESEEEEEEEEEETT
T ss_pred             HHHHHHHHHHHHHHHHHCCEEEEEEEECCCCEEEECCCHHHHHHHHHHCCCCEECHHHHHCCCCHHHCEEEEEEEEECCC
T ss_conf             67999999999999862988999999889981674035889999998746955558883056763326758999996598


Q ss_pred             EEEEEEEEEEECH
Q ss_conf             2999999997251
Q gi|254780331|r  149 VSTTITLNVARST  161 (179)
Q Consensus       149 V~a~i~V~V~~~~  161 (179)
                      |+++++|+|++++
T Consensus        82 V~a~i~v~V~~ee   94 (94)
T d1diva1          82 VTATLKVHVTEQK   94 (94)
T ss_dssp             EEEEEEEEEEECC
T ss_pred             EEEEEEEEEEECC
T ss_conf             2999999999578



>d2gycf1 d.99.1.1 (F:59-149) Ribosomal protein L9 C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j01i1 d.99.1.1 (I:56-146) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gycf2 d.100.1.1 (F:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j01i2 d.100.1.1 (I:1-55) Ribosomal protein L9 N-domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hbaa1 d.100.1.1 (A:1-52) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 179 50S ribosomal protein L9 [Candidatus Liberibacter
3i1n_H_149 (H:) 50S ribosomal protein L9; ribosome structure, 4e-32
1nkw_F_146 (F:) 50S ribosomal protein L9; ribosome, large sub 2e-31
1div_A_40-149110 (A:40-149) Ribosomal protein L9; rRNA-binding; 2.6 7e-19
2j01_I_41-148106 (I:41-148) 50S ribosomal protein L9; ribosome, tRN 2e-17
3bbo_J_122-19776 (J:122-197) Ribosomal protein L9; large ribosomal 2e-13
2j01_I_1-4040 (I:1-40) 50S ribosomal protein L9; ribosome, tRNA, 1e-12
2hba_A_1-3939 (A:1-39) BL17, 50S ribosomal protein L9; NTL9, K12 1e-12
1div_A_1-3939 (A:1-39) Ribosomal protein L9; rRNA-binding; 2.60A 1e-12
>3i1n_H (H:) 50S ribosomal protein L9; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_F 1p86_F 1vs8_H 2aw4_H 2awb_H 2gya_F 2gyc_F 1vs6_H 2i2v_H 2j28_H 2i2t_H* 2qao_H* 2qba_H* 2qbc_H* 2qbe_H 2qbg_H 2qbi_H* 2qbk_H* 2qov_H 2qox_H ...Length = 149 Back     alignment and structure
 Score =  131 bits (332), Expect = 4e-32
 Identities = 55/146 (37%), Positives = 87/146 (59%), Gaps = 2/146 (1%)

Query: 14  MEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLE 73
           M+VILL  V NLG +G+ V VK GYARN+L+P+ KA+ A K+N   FE++R+ LEA   E
Sbjct: 1   MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNIEFFEARRAELEAKLAE 60

Query: 74  KKAKYEGISKDLAKKNFSLIRA-AGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINL-KS 131
             A     ++ +       I + AGD G L+GS+ +RDIAD +   G +V + ++ L   
Sbjct: 61  VLAAANARAEKINALETVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNG 120

Query: 132 PIKSVGIHNIMISLHADVSTTITLNV 157
            +++ G H +   +H++V   + +NV
Sbjct: 121 VLRTTGEHEVSFQVHSEVFAKVIVNV 146


>1nkw_F (F:) 50S ribosomal protein L9; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans}Length = 146 Back     alignment and structure
>1div_A (A:40-149) Ribosomal protein L9; rRNA-binding; 2.60A {Bacillus stearothermophilus}Length = 110 Back     alignment and structure
>2j01_I (I:41-148) 50S ribosomal protein L9; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus}Length = 106 Back     alignment and structure
>3bbo_J (J:122-197) Ribosomal protein L9; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana}Length = 76 Back     alignment and structure
>2j01_I (I:1-40) 50S ribosomal protein L9; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus}Length = 40 Back     alignment and structure
>2hba_A (A:1-39) BL17, 50S ribosomal protein L9; NTL9, K12M, RNA binding protein; 1.25A {Geobacillus stearothermophilus}Length = 39 Back     alignment and structure
>1div_A (A:1-39) Ribosomal protein L9; rRNA-binding; 2.60A {Bacillus stearothermophilus}Length = 39 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target179 50S ribosomal protein L9 [Candidatus Liberibacter asiat
1nkw_F_146 50S ribosomal protein L9; ribosome, large subunit, 100.0
3i1n_H_149 50S ribosomal protein L9; ribosome structure, prot 100.0
1div_A_40-149110 Ribosomal protein L9; rRNA-binding; 2.60A {Bacillu 99.93
2j01_I_41-148106 50S ribosomal protein L9; ribosome, tRNA, paromomy 99.88
3bbo_J_122-19776 Ribosomal protein L9; large ribosomal subunit, spi 99.67
2j01_I_1-4040 50S ribosomal protein L9; ribosome, tRNA, paromomy 99.63
1div_A_1-3939 Ribosomal protein L9; rRNA-binding; 2.60A {Bacillu 99.62
2hba_A_1-3939 BL17, 50S ribosomal protein L9; NTL9, K12M, RNA bi 99.61
>1nkw_F (F:) 50S ribosomal protein L9; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} Back     alignment and structure
Probab=100.00  E-value=9.8e-45  Score=302.16  Aligned_cols=145  Identities=37%  Similarity=0.579  Sum_probs=141.1

Q ss_pred             EEEEEEEECCCCCCCCCEEEECCCCEEEEECCCCCEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             33465201117587783888277632110143787301220146888778999998422346789999887654321000
Q gi|254780331|r   14 MEVILLQNVTNLGPMGEVVKVKNGYARNYLLPKKKALRANKENKILFESQRSVLEAANLEKKAKYEGISKDLAKKNFSLI   93 (179)
Q Consensus        14 mkVIL~~dv~~lG~~Gdiv~Vk~GyaRN~LiP~~~A~~aT~~n~~~~~~~~~~~~~~~~~~~~~a~~~~~~L~~~~l~i~   93 (179)
                      |+|||++|+ +||++||+|+|++|||||||||+|+|+|||++|+++++..++..+++..+..+.|+.++.+|++..+++.
T Consensus         1 M~viL~~~~-~lG~~Gdiv~Vk~GyaRN~LiP~~~A~~at~~nl~~~~~~~~~~~~~~~~~~~~a~~~~~~l~~~~~~~~   79 (146)
T 1nkw_F            1 MQVILLEPS-RLGKTGEVVSVKDGYARNWLIPQGLAVSATRTNMKTLEAQLRSIEKRQAQEKAVAEDLASRLNGVAVELS   79 (146)
T ss_pred             CEEEEEECC-CCCCCCCEEEECCHHHHHHCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             979997447-7898899899876103354065681566699999999999999999999989999999998530244332


Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHCCCCCCHHHHCCCCCCCCEEEEEEEEEECCCEEEEEEEEEEEC
Q ss_conf             2556543100341078999999860887686663026564320549999996397299999999725
Q gi|254780331|r   94 RAAGDTGYLYGSVSSRDIADLLIEEGFDVNRGQINLKSPIKSVGIHNIMISLHADVSTTITLNVARS  160 (179)
Q Consensus        94 ~k~~e~gkLfGsVt~~dI~~~L~~~gi~I~k~~I~l~~pIk~~G~y~V~I~L~~~V~a~i~V~V~~~  160 (179)
                      ++++ +|+||||||+.||+++|.+.|++|++++|.||+||+++|+|+|+|+||++|+++++|+|+++
T Consensus        80 ~~~~-~g~lfGsVt~~~I~~~l~~~gi~I~k~~I~l~~~Ik~~G~~~V~i~l~~~V~~~i~i~V~a~  145 (146)
T 1nkw_F           80 VRAG-EGKIYGAVTHQDVANSLDQLGFDVDRRKIDMPKTVKEVGEYDIAYRAHPEVTIPMKLVVHAA  145 (146)
T ss_pred             HCCC-CCCCCCCCCHHHHHHHHHHCCCCCCHHHEECCCHHHCCEEEEEEEEECCCEEEEEEEEEEEC
T ss_conf             0145-78655767889999999985994477566078702223888999994298799999999978



>3i1n_H (H:) 50S ribosomal protein L9; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_F 1p86_F 1vs8_H 2aw4_H 2awb_H 2gya_F 2gyc_F 1vs6_H 2i2v_H 2j28_H 2i2t_H* 2qao_H* 2qba_H* 2qbc_H* 2qbe_H 2qbg_H 2qbi_H* 2qbk_H* 2qov_H 2qox_H ... Back     alignment and structure
>1div_A (A:40-149) Ribosomal protein L9; rRNA-binding; 2.60A {Bacillus stearothermophilus} Back     alignment and structure
>2j01_I (I:41-148) 50S ribosomal protein L9; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
>3bbo_J (J:122-197) Ribosomal protein L9; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Arabidopsis thaliana} Back     alignment and structure
>2j01_I (I:1-40) 50S ribosomal protein L9; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
>1div_A (A:1-39) Ribosomal protein L9; rRNA-binding; 2.60A {Bacillus stearothermophilus} Back     alignment and structure
>2hba_A (A:1-39) BL17, 50S ribosomal protein L9; NTL9, K12M, RNA binding protein; 1.25A {Geobacillus stearothermophilus} Back     alignment and structure