254780332

254780332

replicative DNA helicase

GeneID in NCBI database:8209317Locus tag:CLIBASIA_01085
Protein GI in NCBI database:254780332Protein Accession:YP_003064745.1
Gene range:+(226455, 227969)Protein Length:504aa
Gene description:replicative DNA helicase
COG prediction:[L] Replicative DNA helicase
KEGG prediction:dnaB; replicative DNA helicase; K02314 replicative DNA helicase [EC:3.6.1.-]
SEED prediction:Replicative DNA helicase (EC 3.6.1.-)
Pathway involved in KEGG:DNA replication [PATH:las03030]
Subsystem involved in SEED:DNA-replication
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500----
MINTAQDIILSIPKEDSSQYRESPNNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLFHLAENGRYDGGFHTFSDAMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKRQRGLDLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSRQVENRDNKRPQLSDLRESGSIEQDADVVLFVIRDEYYIRNKEPTNKDDILAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAFQAEFTRFSALSDSSYQTGEHFDSA
cccccccccccccccccHHcccccccHHHHHHHHHHHHHcHHHHHHHHHHccHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEccccHHHHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHHHHccEEEEEcccccHHHHHHHHHHHHHHccccEEEEccEEEEEccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccHHHHcccccccccccEEEEEEccHHccccccccccccHHHHHHHHHHHHcccccEEEEEEEccccccEEEEEEEEccccccccccccccccccccccc
ccccHHccccccccccHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccEEEEHHHHccccccHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHcccccccccccEcccccEEEEEEccccHHHHHHHHHHHcccccHHHcccccccHHHHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHHHccccEEEEEHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccHEEHHHHHccHccccccccccHHHHccccHHHcccEEEEEEEHHcccccccccccccccccHHHHHHccHccccEEEEEEEccccccEEEEEEEEccccccccccccccccHHHcccc
MINTAQDIILsipkedssqyrespnnIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVhmgktanpvtvktflsdqdmlgeltVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEasldkspsiqIEEAERKLFHlaengrydggfhtfSDAMTVAIDMAGQafnrdgrlagvsTGIQTLDkqmgglqrsdliiiagrpgmgktslATNIAYNVADAYKAelqtdgsyktingGIVGFYSLEMSSEQLATRIISEqtevpsskirrgeltrpdyEKIVACSQVMqklplyidqtggisMSQLATRARRLKRQRGLDLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSrqvenrdnkrpqlsdlresgsieqdaDVVLFVIRDEyyirnkeptnkddILAYTKWQEDLKRVKGIADIIIAkqrhgptgtvTLAFQAEFTrfsalsdssyqtgehfdsa
mintaqdiilsipkedssqYRESPNNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLFHLAENGRYDGGFHTFSDAMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIiseqtevpsskirrgeltrpdYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKRQRGLDLLIVDYIQLMttskkieenrvLEITGITMALKALAKELNIPIIALsqlsrqvenrdnkrpqlsdlresgsieqdadvVLFVIRDEyyirnkeptnkddilaYTKWQEDLKRVKGIADIIIAkqrhgptgTVTLAFQAEFTRFsalsdssyqtgehfdsa
MINTAQDIILSIPKEDSSQYRESPNNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLFHLAENGRYDGGFHTFSDAMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKRQRGLDLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSRQVENRDNKRPQLSDLRESGSIEQDADVVLFVIRDEYYIRNKEPTNKDDILAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAFQAEFTRFSALSDSSYQTGEHFDSA
************************NNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLF****************DAMTVAIDMAGQAFN**GRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKRQRGLDLLIVDYIQ*****************GITMALKALAKELNIPIIALSQLSRQVENRDNKRPQLSDLRESGSIEQDADVVLFVIRDEYYIRNKE***********KWQEDLKRVKGIADIIIAKQRHGPTGTVTLAFQAEFTRFSAL**************
MINTAQDIILSIPK**********NNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLFHLAENGRYDGGFHTFSDAMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKRQRGLDLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSRQVENRDNKRPQLSDLRESGSIEQDADVVLFVIRDEYYIRNKEPTNKDDILAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAFQAEFTRFSALSD************
***********IPKEDSSQYRESPNNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLFHLAENGRYDGGFHTFSDAMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKRQRGLDLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSR*********PQL*D*RESGSIEQDADVVLFVIRDEYYIRNKE*TNKDDILAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAFQAEFTRFSALSDSS**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINTAQDIILSIPKEDSSQYRESPNNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLFHLAENGRYDGGFHTFSDAMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKRQRGLDLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSRQVENRDNKRPQLSDLRESGSIEQDADVVLFVIRDEYYIRNKEPTNKDDILAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAFQAEFTRFSALSDSSYQTGEHFDSA
MINTAQDIILSIPKEDSSQYRESPNNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLFHLAENGRYDGGFHTFSDAMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKRQRGLDLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSRQVENRDNKRPQLSDLRESGSIEQDADVVLFVIRDEYYIRNKEPTNKDDILAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAFQAEFTRFSALSDSSYQTGEHFDSA
MINTAQDIILSIPKEDSSQYRESPNNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQYLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLFHLAENGRYDGGFHTFSDAMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKRQRGLDLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSRQVENRDNKRPQLSDLRESGSIEQDADVVLFVIRDEYYIRNKEPTNKDDILAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAFQAEFTRFSALSDSSYQTGEHFDSA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target504 replicative DNA helicase [Candidatus Liberibacter asiat
254781149266 replicative DNA helicase [Candidatus Liberibacter 1e-15
254780334 479 DNA repair protein RadA [Candidatus Liberibacter a 0.022
>gi|254781149|ref|YP_003065562.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 266 Back     alignment
 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 79/163 (48%), Gaps = 21/163 (12%)

Query: 164 HLAENGRYDGGFHTFSDAMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLII 223
           HL +N        + ++A T A+  A Q   ++G    +  G+Q++D  MGG+Q  +LI+
Sbjct: 88  HLTKNQCTGSSCISIANAATTAMKSAEQQ-KKEGENPDIKWGLQSVDHLMGGVQLRELIL 146

Query: 224 IAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIIS 283
           I  RP MGKT+ A + A ++A               ++G  V F+SLEM  E+L  R +S
Sbjct: 147 IGARPSMGKTTFALSTALHMA---------------MSGHGVAFFSLEMDREKLGARALS 191

Query: 284 E-----QTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYID 321
                  + +P   + RGE+ +  Y       + +Q  PL ID
Sbjct: 192 NLLYPSSSRIPYLNLIRGEINQEQYRISQGICEKLQDFPLIID 234

>gi|254780334|ref|YP_003064747.1| DNA repair protein RadA [Candidatus Liberibacter asiaticus str. psy62] Length = 479 Back     alignment
 Score = 32.0 bits (71), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 202 VSTGIQTLDKQMGG-LQRSDLIIIAGRPGMGKTSLATNIAYNVA 244
           + T I  LD+  GG   R  +I++ G PG+GK++L    A ++A
Sbjct: 72  IQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLA 115

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target504 replicative DNA helicase [Candidatus Liberibacter asiat
315122243502 replicative DNA helicase [Candidatus Liberibacter solan 1 0.0
227821456499 replicative DNA helicase [Sinorhizobium fredii NGR234] 1 0.0
150395958499 replicative DNA helicase [Sinorhizobium medicae WSM419] 1 0.0
15964884499 replicative DNA helicase [Sinorhizobium meliloti 1021] 1 0.0
15888427498 replicative DNA helicase [Agrobacterium tumefaciens str 1 0.0
325292463498 Replicative DNA helicase [Agrobacterium sp. H13-3] Leng 1 0.0
222085429498 replicative DNA helicase protein [Agrobacterium radioba 1 0.0
327187997500 DNA helicase protein [Rhizobium etli CNPAF512] Length = 1 0.0
190891118498 DNA helicase [Rhizobium etli CIAT 652] Length = 498 1 0.0
86357074498 replicative DNA helicase [Rhizobium etli CFN 42] Length 1 0.0
>gi|315122243|ref|YP_004062732.1| replicative DNA helicase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 502 Back     alignment and organism information
 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/502 (90%), Positives = 477/502 (95%), Gaps = 1/502 (0%)

Query: 1   MINTAQDIILSIPKEDSSQYRESPNNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAI 60
           MINT+QD+I SIPKEDS+ YRESPNNIEAEQALLGAILVNN+AFYRVSDFLKP HFFE I
Sbjct: 1   MINTSQDVI-SIPKEDSAHYRESPNNIEAEQALLGAILVNNDAFYRVSDFLKPSHFFEGI 59

Query: 61  HQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQYLARLASEAVSIINTEDYGR 120
           HQKIFEI GKL++M KTANPVT+KTFLS QDMLG LT+PQYLARLASEAVSIIN EDYG+
Sbjct: 60  HQKIFEIAGKLIYMNKTANPVTIKTFLSTQDMLGGLTIPQYLARLASEAVSIINAEDYGK 119

Query: 121 IIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLFHLAENGRYDGGFHTFSD 180
            IYGL+LRR LI+IGEE VN AYEASL+ SPS QIEEAERKLF+LAENGRYDGGFH+FSD
Sbjct: 120 TIYGLSLRRALISIGEETVNTAYEASLEPSPSAQIEEAERKLFNLAENGRYDGGFHSFSD 179

Query: 181 AMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIA 240
           AMT AIDMAGQAFNRDGRLAG+STGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIA
Sbjct: 180 AMTTAIDMAGQAFNRDGRLAGISTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIA 239

Query: 241 YNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTR 300
           YNVADAYK+ELQ DGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELT+
Sbjct: 240 YNVADAYKSELQVDGSYKTINGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTQ 299

Query: 301 PDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKRQRGLDLLIVDYIQLMTTSKK 360
           PDYEKIV CSQVMQKLPLYIDQTGGIS+ QLA RARRLKRQRGLDLLIVDYIQLMT+SKK
Sbjct: 300 PDYEKIVGCSQVMQKLPLYIDQTGGISIGQLAARARRLKRQRGLDLLIVDYIQLMTSSKK 359

Query: 361 IEENRVLEITGITMALKALAKELNIPIIALSQLSRQVENRDNKRPQLSDLRESGSIEQDA 420
            EENRVLEIT ITMALKALAKELNIPIIALSQLSRQVENR+NKRPQLSDLRESGSIEQDA
Sbjct: 360 FEENRVLEITSITMALKALAKELNIPIIALSQLSRQVENRENKRPQLSDLRESGSIEQDA 419

Query: 421 DVVLFVIRDEYYIRNKEPTNKDDILAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAF 480
           DVVLFVIRDEYY++NKEPTNKDD+LAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAF
Sbjct: 420 DVVLFVIRDEYYVKNKEPTNKDDVLAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAF 479

Query: 481 QAEFTRFSALSDSSYQTGEHFD 502
           QAEFTRFSAL+DSSYQ  E F+
Sbjct: 480 QAEFTRFSALADSSYQQNEQFN 501


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821456|ref|YP_002825426.1| replicative DNA helicase [Sinorhizobium fredii NGR234] Length = 499 Back     alignment and organism information
>gi|150395958|ref|YP_001326425.1| replicative DNA helicase [Sinorhizobium medicae WSM419] Length = 499 Back     alignment and organism information
>gi|15964884|ref|NP_385237.1| replicative DNA helicase [Sinorhizobium meliloti 1021] Length = 499 Back     alignment and organism information
>gi|15888427|ref|NP_354108.1| replicative DNA helicase [Agrobacterium tumefaciens str. C58] Length = 498 Back     alignment and organism information
>gi|325292463|ref|YP_004278327.1| Replicative DNA helicase [Agrobacterium sp. H13-3] Length = 498 Back     alignment and organism information
>gi|222085429|ref|YP_002543959.1| replicative DNA helicase protein [Agrobacterium radiobacter K84] Length = 498 Back     alignment and organism information
>gi|327187997|gb|EGE55227.1| DNA helicase protein [Rhizobium etli CNPAF512] Length = 500 Back     alignment and organism information
>gi|190891118|ref|YP_001977660.1| DNA helicase [Rhizobium etli CIAT 652] Length = 498 Back     alignment and organism information
>gi|86357074|ref|YP_468966.1| replicative DNA helicase [Rhizobium etli CFN 42] Length = 498 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target504 replicative DNA helicase [Candidatus Liberibacter asiat
PRK09165497 PRK09165, PRK09165, replicative DNA helicase; Provision 0.0
TIGR00665434 TIGR00665, DnaB, replicative DNA helicase 1e-173
PRK05748448 PRK05748, PRK05748, replicative DNA helicase; Provision 1e-117
TIGR03600421 TIGR03600, phage_DnaB, phage replicative helicase, DnaB 1e-100
PRK07004460 PRK07004, PRK07004, replicative DNA helicase; Provision 1e-88
PRK08760476 PRK08760, PRK08760, replicative DNA helicase; Provision 5e-87
PRK08506472 PRK08506, PRK08506, replicative DNA helicase; Provision 2e-85
PRK05595444 PRK05595, PRK05595, replicative DNA helicase; Provision 2e-83
PRK08006471 PRK08006, PRK08006, replicative DNA helicase; Provision 2e-79
PRK06904472 PRK06904, PRK06904, replicative DNA helicase; Validated 5e-78
PRK08840464 PRK08840, PRK08840, replicative DNA helicase; Provision 4e-77
PRK06321472 PRK06321, PRK06321, replicative DNA helicase; Provision 5e-76
PRK05636505 PRK05636, PRK05636, replicative DNA helicase; Provision 3e-75
PRK06749428 PRK06749, PRK06749, replicative DNA helicase; Provision 7e-62
COG0305435 COG0305, DnaB, Replicative DNA helicase [DNA replicatio 1e-129
PRK07773 886 PRK07773, PRK07773, replicative DNA helicase; Validated 7e-89
cd00984242 cd00984, DnaB_C, DnaB helicase C terminal domain 2e-82
COG1066 456 COG1066, Sms, Predicted ATP-dependent serine protease [ 3e-05
cd01121372 cd01121, Sms, Sms (bacterial radA) DNA repair protein 5e-04
pfam03796186 pfam03796, DnaB_C, DnaB-like helicase C terminal domain 1e-68
cd01122271 cd01122, GP4d_helicase, GP4d_helicase is a homohexameri 1e-14
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 3e-08
PRK05973237 PRK05973, PRK05973, replicative DNA helicase; Provision 1e-04
cd01393226 cd01393, recA_like, RecA is a bacterial enzyme which ha 3e-04
PRK11823 446 PRK11823, PRK11823, DNA repair protein RadA; Provisiona 0.004
pfam00772103 pfam00772, DnaB, DnaB-like helicase N terminal domain 2e-26
PRK07773886 PRK07773, PRK07773, replicative DNA helicase; Validated 1e-15
PHA02542473 PHA02542, 41, 41 helicase; Provisional 1e-08
COG0467260 COG0467, RAD55, RecA-superfamily ATPases implicated in 3e-04
PRK09302509 PRK09302, PRK09302, circadian clock protein KaiC; Revie 3e-04
>gnl|CDD|181676 PRK09165, PRK09165, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|161985 TIGR00665, DnaB, replicative DNA helicase Back     alignment and domain information
>gnl|CDD|180232 PRK05748, PRK05748, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|132639 TIGR03600, phage_DnaB, phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>gnl|CDD|180791 PRK07004, PRK07004, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|181547 PRK08760, PRK08760, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|181451 PRK08506, PRK08506, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|180157 PRK05595, PRK05595, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|181193 PRK08006, PRK08006, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|136106 PRK06904, PRK06904, replicative DNA helicase; Validated Back     alignment and domain information
>gnl|CDD|181562 PRK08840, PRK08840, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|180528 PRK06321, PRK06321, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|180177 PRK05636, PRK05636, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|168658 PRK06749, PRK06749, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|30653 COG0305, DnaB, Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|181111 PRK07773, PRK07773, replicative DNA helicase; Validated Back     alignment and domain information
>gnl|CDD|29985 cd00984, DnaB_C, DnaB helicase C terminal domain Back     alignment and domain information
>gnl|CDD|31265 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|29987 cd01121, Sms, Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>gnl|CDD|146436 pfam03796, DnaB_C, DnaB-like helicase C terminal domain Back     alignment and domain information
>gnl|CDD|29988 cd01122, GP4d_helicase, GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|168322 PRK05973, PRK05973, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|30003 cd01393, recA_like, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>gnl|CDD|183326 PRK11823, PRK11823, DNA repair protein RadA; Provisional Back     alignment and domain information
>gnl|CDD|144390 pfam00772, DnaB, DnaB-like helicase N terminal domain Back     alignment and domain information
>gnl|CDD|181111 PRK07773, PRK07773, replicative DNA helicase; Validated Back     alignment and domain information
>gnl|CDD|177377 PHA02542, 41, 41 helicase; Provisional Back     alignment and domain information
>gnl|CDD|30815 COG0467, RAD55, RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|181771 PRK09302, PRK09302, circadian clock protein KaiC; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 504 replicative DNA helicase [Candidatus Liberibacter asiat
PRK09165484 replicative DNA helicase; Provisional 100.0
PRK08760476 replicative DNA helicase; Provisional 100.0
PRK05636507 replicative DNA helicase; Provisional 100.0
PRK08840464 replicative DNA helicase; Provisional 100.0
PRK07004460 replicative DNA helicase; Provisional 100.0
PRK08082453 consensus 100.0
PRK05595444 replicative DNA helicase; Provisional 100.0
PRK06321472 replicative DNA helicase; Provisional 100.0
PRK07263453 consensus 100.0
PRK08506473 replicative DNA helicase; Provisional 100.0
PRK05748448 replicative DNA helicase; Provisional 100.0
PRK08694468 consensus 100.0
PRK08006471 replicative DNA helicase; Provisional 100.0
PRK06904472 replicative DNA helicase; Validated 100.0
COG0305435 DnaB Replicative DNA helicase [DNA replication, recombi 100.0
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 100.0
PRK06749428 replicative DNA helicase; Provisional 100.0
TIGR00665465 DnaB replicative DNA helicase; InterPro: IPR007692 This 100.0
PRK07773 868 replicative DNA helicase; Validated 100.0
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 100.0
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 100.0
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 99.85
PRK11823 454 DNA repair protein RadA; Provisional 99.83
cd01394218 radB RadB. The archaeal protein radB shares similarity 99.83
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 99.83
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 99.77
COG1066 456 Sms Predicted ATP-dependent serine protease [Posttransl 99.77
pfam06745231 KaiC KaiC. This family represents a conserved region wi 99.72
TIGR00416 481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 99.69
PRK04328250 hypothetical protein; Provisional 99.68
PRK09302501 circadian clock protein KaiC; Reviewed 99.67
PRK09302 501 circadian clock protein KaiC; Reviewed 99.66
PRK06067241 flagellar accessory protein FlaH; Validated 99.56
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 99.56
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 99.5
cd01124187 KaiC KaiC is a circadian clock protein primarily found 99.38
PRK04301318 radA DNA repair and recombination protein RadA; Validat 99.37
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 99.37
PRK08533230 flagellar accessory protein FlaH; Reviewed 99.36
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 99.35
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 99.33
PRK09354350 recA recombinase A; Provisional 99.25
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 99.22
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 99.12
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 98.7
TIGR02012322 tigrfam_recA protein RecA; InterPro: IPR001553 The recA 97.8
TIGR02238314 recomb_DMC1 meiotic recombinase Dmc1; InterPro: IPR0119 97.46
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 96.78
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 100.0
KOG1564351 consensus 98.82
PRK09519 790 recA recombinase A; Reviewed 98.8
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 98.71
TIGR02236333 recomb_radA DNA repair and recombination protein RadA; 98.4
KOG1433326 consensus 98.19
KOG1434335 consensus 98.01
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t 97.67
smart00382148 AAA ATPases associated with a variety of cellular activ 97.64
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 97.53
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 97.49
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.42
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 97.39
TIGR00959439 ffh signal recognition particle protein; InterPro: IPR0 97.37
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 97.36
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 97.22
PRK13409590 putative ATPase RIL; Provisional 97.16
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 97.12
smart00487201 DEXDc DEAD-like helicases superfamily. 97.1
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 97.09
PRK00771433 signal recognition particle protein Srp54; Provisional 97.09
pfam05621302 TniB Bacterial TniB protein. This family consists of se 97.05
TIGR02239317 recomb_RAD51 DNA repair protein RAD51; InterPro: IPR011 97.04
COG4604252 CeuD ABC-type enterochelin transport system, ATPase com 96.98
PRK13849231 putative crown gall tumor protein VirC1; Provisional 96.97
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 96.96
COG1198 730 PriA Primosomal protein N' (replication factor Y) - sup 96.89
PRK10867453 signal recognition particle protein; Provisional 96.88
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 96.8
TIGR01011227 rpsB_bact ribosomal protein S2; InterPro: IPR005706 Rib 96.79
PRK09694 878 hypothetical protein; Provisional 96.76
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 96.7
PRK08939306 primosomal protein DnaI; Reviewed 96.66
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 96.58
COG1205 851 Distinct helicase family with a unique C-terminal domai 96.53
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 96.49
PRK13889 992 conjugal transfer relaxase TraA; Provisional 96.46
PRK00090223 bioD dithiobiotin synthetase; Reviewed 96.44
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 96.4
KOG0061 613 consensus 96.31
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 96.22
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 96.16
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 96.1
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 96.07
PRK13542224 consensus 96.03
PRK13768253 GTPase; Provisional 96.02
PRK05580 699 primosome assembly protein PriA; Validated 96.01
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 95.98
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 95.97
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 95.96
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IISP) Fa 95.94
COG1435201 Tdk Thymidine kinase [Nucleotide transport and metaboli 95.93
TIGR01587 424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 95.89
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanisms] 95.76
PRK13235274 nifH nitrogenase reductase; Reviewed 95.76
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 95.66
KOG0739439 consensus 95.64
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 95.58
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 95.43
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 95.23
COG4525259 TauB ABC-type taurine transport system, ATPase componen 95.21
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intracell 95.11
COG4172534 ABC-type uncharacterized transport system, duplicated A 94.99
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 94.61
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 94.61
COG0052252 RpsB Ribosomal protein S2 [Translation, ribosomal struc 94.56
pfam03266168 DUF265 Protein of unknown function, DUF265. 94.44
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/C 94.26
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 94.25
TIGR00614 497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 94.08
COG1674858 FtsK DNA segregation ATPase FtsK/SpoIIIE and related pr 94.05
PRK13695174 putative NTPase; Provisional 93.96
PRK05986190 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 93.95
TIGR01618229 phage_P_loop phage nucleotide-binding protein; InterPro 93.58
pfam00004131 AAA ATPase family associated with various cellular acti 93.58
PRK05973237 replicative DNA helicase; Provisional 100.0
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 99.43
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 99.39
PTZ00035350 Rad51; Provisional 99.17
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.62
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 97.48
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.43
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.43
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 97.42
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 97.38
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.37
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 97.36
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 97.36
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 97.34
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 97.33
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 97.33
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 97.32
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 97.31
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 97.29
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 97.27
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 97.26
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 97.24
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.23
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 97.21
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.21
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 97.2
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.2
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.17
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 97.12
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 97.1
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.1
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 97.09
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 97.07
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.06
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 97.04
PRK09984262 phosphonate/organophosphate ester transporter subunit; 97.03
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.03
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.02
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 97.02
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 97.01
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 97.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 97.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 96.99
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 96.98
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 96.98
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.97
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 96.96
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 96.94
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.93
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 96.93
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 96.92
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 96.92
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 96.91
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 96.9
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.89
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 96.87
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 96.85
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 96.85
PRK10762501 D-ribose transporter ATP binding protein; Provisional 96.84
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 96.83
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 96.83
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 96.82
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 96.8
PRK10908222 cell division protein FtsE; Provisional 96.79
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 96.78
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 96.76
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 96.76
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 96.75
PRK09700510 D-allose transporter ATP-binding protein; Provisional 96.75
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 96.75
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 96.74
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 96.73
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.73
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 96.73
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 96.7
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 96.69
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 96.68
COG4988559 CydD ABC-type transport system involved in cytochrome b 96.67
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 96.66
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 96.66
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 96.61
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 96.61
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 96.6
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 96.56
cd03234226 ABCG_White The White subfamily represents ABC transport 96.56
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 96.55
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 96.55
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.54
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 96.53
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.51
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 96.47
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 96.45
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 96.45
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 96.43
COG1123539 ATPase components of various ABC-type transport systems 96.43
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 96.42
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 96.38
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 96.38
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.37
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 96.37
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 96.31
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 96.29
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 96.26
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 96.25
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 96.24
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 96.24
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 96.21
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 96.2
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 96.17
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 96.17
PRK10789569 putative multidrug transporter membrane\ATP-binding com 96.16
PRK10522547 multidrug transporter membrane component/ATP-binding co 96.1
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 96.1
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 95.98
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 95.95
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 95.91
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 95.89
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 95.86
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 95.85
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.83
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 95.82
TIGR02655 484 circ_KaiC circadian clock protein KaiC; InterPro: IPR01 95.8
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.77
pfam02702211 KdpD Osmosensitive K+ channel His kinase sensor domain. 95.74
PRK10744257 phosphate transporter subunit; Provisional 95.74
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 95.66
PRK10790593 putative multidrug transporter membrane\ATP-binding com 95.66
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.58
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 95.56
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 95.53
PRK03695245 vitamin B12-transporter ATPase; Provisional 95.41
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 95.38
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 95.21
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 95.17
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 95.08
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 95.07
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 94.79
COG1129500 MglA ABC-type sugar transport system, ATPase component 94.76
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 94.58
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 94.36
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 94.34
pfam00772103 DnaB DnaB-like helicase N terminal domain. The hexameri 99.84
KOG2373514 consensus 99.77
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.71
cd03115173 SRP The signal recognition particle (SRP) mediates the 97.69
COG1084346 Predicted GTPase [General function prediction only] 97.56
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.56
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.42
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 97.35
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 97.22
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 97.2
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 97.17
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 97.09
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 96.79
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 96.78
COG4608268 AppF ABC-type oligopeptide transport system, ATPase com 96.72
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 96.71
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 96.16
PRK10636638 putative ABC transporter ATP-binding protein; Provision 96.16
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 96.11
PRK11784333 tRNA 2-selenouridine synthase; Provisional 96.01
COG2894272 MinD Septum formation inhibitor-activating ATPase [Cell 95.96
PRK11147632 ABC transporter ATPase component; Reviewed 95.91
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 95.83
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 95.63
COG0488530 Uup ATPase components of ABC transporters with duplicat 95.59
PTZ00243 1560 ABC transporter; Provisional 95.21
KOG0780 483 consensus 95.19
COG4987573 CydC ABC-type transport system involved in cytochrome b 95.12
PRK05632 702 phosphate acetyltransferase; Reviewed 95.09
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 95.07
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 94.84
KOG0744423 consensus 94.5
TIGR02770239 nickel_nikD nickel import ATP-binding protein NikD; Int 94.49
PRK08084235 DNA replication initiation factor; Provisional 94.48
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The Esch 94.27
pfam00406186 ADK Adenylate kinase. 94.05
PTZ00088225 adenylate kinase 1; Provisional 93.89
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 93.71
COG4133209 CcmA ABC-type transport system involved in cytochrome c 93.68
KOG0054 1381 consensus 93.64
PRK03846198 adenylylsulfate kinase; Provisional 93.61
pfam00580 494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 93.6
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 93.58
PRK06526254 transposase; Provisional 97.58
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 97.51
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.43
pfam07088484 GvpD GvpD gas vesicle protein. This family consists of 97.38
PRK08181269 transposase; Validated 97.28
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 97.17
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 97.17
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.13
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 97.12
PRK08116262 hypothetical protein; Validated 96.99
TIGR02655484 circ_KaiC circadian clock protein KaiC; InterPro: IPR01 96.96
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 96.94
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 96.89
PRK09183258 transposase/IS protein; Provisional 96.88
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 96.82
PRK11519720 tyrosine kinase; Provisional 96.76
PRK07952242 DNA replication protein DnaC; Validated 96.73
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.72
pfam01656212 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. Thi 96.62
PRK12377248 putative replication protein; Provisional 96.59
PRK05667600 dnaG DNA primase; Validated 96.48
PRK06921265 hypothetical protein; Provisional 96.37
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 96.2
KOG2680 454 consensus 96.2
pfam06564244 YhjQ YhjQ protein. This family consists of several bact 96.06
PRK06696227 uridine kinase; Validated 95.95
PHA02518211 ParA-like protein; Provisional 95.94
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 95.91
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 95.86
PRK00149447 dnaA chromosomal replication initiation protein; Review 95.81
TIGR00630956 uvra excinuclease ABC, A subunit; InterPro: IPR004602 A 95.65
COG0489265 Mrp ATPases involved in chromosome partitioning [Cell d 95.6
PRK10037250 cell division protein; Provisional 95.51
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 95.47
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 95.42
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide 95.37
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 95.36
PRK12422455 chromosomal replication initiation protein; Provisional 95.35
COG1484254 DnaC DNA replication protein [DNA replication, recombin 95.28
CHL00060480 atpB ATP synthase CF1 beta subunit 95.27
COG2884223 FtsE Predicted ATPase involved in cell division [Cell d 95.22
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 95.19
PRK13764605 ATPase; Provisional 95.17
COG1855604 ATPase (PilT family) [General function prediction only] 95.15
PRK06851368 hypothetical protein; Provisional 95.08
PRK06835330 DNA replication protein DnaC; Validated 95.08
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 94.98
cd02040270 NifH NifH gene encodes component II (iron protein) of n 94.97
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 94.85
PRK09280466 F0F1 ATP synthase subunit beta; Validated 94.8
cd02036179 MinD Bacterial cell division requires the formation of 94.54
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, an A 94.52
CHL00175279 minD septum-site determining protein; Validated 94.44
cd03111106 CpaE_like This protein family consists of proteins simi 94.4
PRK05642234 DNA replication initiation factor; Validated 94.36
cd02042104 ParA ParA and ParB of Caulobacter crescentus belong to 94.36
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta. 94.34
PRK12597459 F0F1 ATP synthase subunit beta; Provisional 94.21
PRK10818270 cell division inhibitor MinD; Provisional 94.19
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 94.15
PRK08903227 hypothetical protein; Validated 94.04
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subu 93.96
PRK13230292 nitrogenase reductase-like protein; Reviewed 93.79
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 93.79
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 93.67
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 97.52
TIGR02768 888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 96.0
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Signal 93.94
PRK09401 1176 reverse gyrase; Reviewed 97.49
COG3839338 MalK ABC-type sugar transport systems, ATPase component 97.49
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 97.43
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 97.4
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 97.31
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.23
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 97.21
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 97.17
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 97.05
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 97.04
COG3842352 PotA ABC-type spermidine/putrescine transport systems, 96.8
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.34
cd03112158 CobW_like The function of this protein family is unkown 95.92
PRK07667190 uridine kinase; Provisional 95.66
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 95.5
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 95.44
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 95.36
PRK09270230 frcK putative fructose transport system kinase; Reviewe 95.28
PRK08769319 DNA polymerase III subunit delta'; Validated 94.86
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 94.72
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 94.36
PRK06871324 DNA polymerase III subunit delta'; Validated 94.21
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 94.19
PRK02362736 ski2-like helicase; Provisional 97.48
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 96.48
PRK13767 878 ATP-dependent helicase; Provisional 94.99
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 93.72
PRK00254717 ski2-like helicase; Provisional 97.17
PRK01172 674 ski2-like helicase; Provisional 96.79
PRK10636638 putative ABC transporter ATP-binding protein; Provision 96.12
PRK11147632 ABC transporter ATPase component; Reviewed 95.46
PRK10490895 sensor protein KdpD; Provisional 94.81
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 97.1
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 96.92
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 96.82
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 96.82
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 96.8
PRK03839180 putative kinase; Provisional 96.7
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 96.67
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 96.66
PRK04195403 replication factor C large subunit; Provisional 96.6
cd03246173 ABCC_Protease_Secretion This family represents the ABC 96.58
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 96.48
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 96.48
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 96.47
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 96.46
PRK13544208 consensus 96.32
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 96.32
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 96.31
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 96.18
cd03110179 Fer4_NifH_child This protein family's function is unkow 96.09
KOG0065 1391 consensus 96.06
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 96.02
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 95.92
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 95.9
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 95.88
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 95.77
KOG0989346 consensus 95.67
COG1160444 Predicted GTPases [General function prediction only] 95.57
TIGR02545439 ATP_syn_fliI flagellar protein export ATPase FliI; Inte 95.57
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 95.48
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 95.46
TIGR02546430 III_secr_ATP type III secretion apparatus H+-transporti 95.45
COG1135339 AbcC ABC-type metal ion transport system, ATPase compon 95.43
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 95.27
PRK12402337 replication factor C small subunit 2; Reviewed 95.25
PRK09112352 DNA polymerase III subunit delta'; Validated 95.18
PRK13549513 xylose transporter ATP-binding subunit; Provisional 95.16
KOG0733 802 consensus 95.14
PRK04213195 GTP-binding protein; Provisional 95.14
COG1123 539 ATPase components of various ABC-type transport systems 95.06
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 95.03
COG1118345 CysA ABC-type sulfate/molybdate transport systems, ATPa 94.99
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 94.79
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 94.73
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 94.58
PRK08233182 hypothetical protein; Provisional 94.56
PRK07471363 DNA polymerase III subunit delta'; Validated 94.56
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 94.37
PRK03992390 proteasome-activating nucleotidase; Provisional 94.37
PRK05564313 DNA polymerase III subunit delta'; Validated 94.32
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 94.31
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 94.28
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 94.15
KOG0057591 consensus 94.14
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 94.13
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 94.03
PRK08927441 fliI flagellum-specific ATP synthase; Validated 94.01
CHL00195491 ycf46 Ycf46; Provisional 93.87
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 93.81
COG1157441 FliI Flagellar biosynthesis/type III secretory pathway 93.77
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. Membe 93.61
PRK04841903 transcriptional regulator MalT; Provisional 97.01
PRK13766764 Hef nuclease; Provisional 96.0
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 94.83
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 97.0
PRK13549513 xylose transporter ATP-binding subunit; Provisional 96.95
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 96.76
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 96.74
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 96.68
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 96.67
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 96.59
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 95.92
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 96.8
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 94.79
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 94.48
CHL00095 823 clpC Clp protease ATP binding subunit 93.64
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 96.57
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 96.49
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 96.46
PRK09700510 D-allose transporter ATP-binding protein; Provisional 95.52
PRK10762501 D-ribose transporter ATP binding protein; Provisional 94.77
PRK00349 944 uvrA excinuclease ABC subunit A; Reviewed 94.25
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 96.34
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recombinati 96.29
TIGR02773 1192 addB_Gpos ATP-dependent nuclease subunit B; InterPro: I 95.58
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, reco 94.09
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 96.24
TIGR00345330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 95.0
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 95.86
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 94.56
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.19
TIGR01187331 potA polyamine ABC transporter, ATP-binding protein; In 93.99
PRK13341726 recombination factor protein RarA/unknown domain fusion 93.78
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back