254780334

254780334

DNA repair protein RadA

GeneID in NCBI database:8209319Locus tag:CLIBASIA_01095
Protein GI in NCBI database:254780334Protein Accession:YP_003064747.1
Gene range:+(229184, 230623)Protein Length:479aa
Gene description:DNA repair protein RadA
COG prediction:[O] Predicted ATP-dependent serine protease
KEGG prediction:DNA repair protein RadA; K04485 DNA repair protein RadA/Sms
SEED prediction:DNA repair protein RadA
Pathway involved in KEGG:not defined
Subsystem involved in SEED:DNA repair, bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MVKIRSQYFCQSCGEIHSRWIGKCDSCNAWNTIIEDSSRKESDQRFSKTIKQGHSISLFMLSEESIEEESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLITNEKPDLVIIDSIQTLWSQTAESSPGTVIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEGQIAGPRVIEHMVDAVLYFEGGTRNTQYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSKIFLSDRDSTSPGTAVFAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAMILAVLEARCNIKFGNHDVHLNIAGGYRISEPAADVAVAAALISSILSIPLPSDFVYFGEVSLSGSVRAVGHMQQRLKEAEKIGFLSGVFPESAKGECKIGMLDRQYIKNLSDLVKKITALQKKDKKTVHKTRSLNSPWE
ccccccEEEEccccccccccccccccccccccEEEEcccccccccccHHHcccccccEEEccccccccccccccccHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccccccEEcccccHHHHHHHHHHcccccEEEEEcHHHHcccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHEEEEEccccccccEEEHHHHHHHHccccccEEEEEEccccHHHHccccHHHcccccccccEEEEEEEEccccEEEEEEEEEEccccccccEEEEHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccccHHHHHHHHHHHccccccccEEEEEEEcccEEEEEcccHHHHHHHHHHccccEEEEcHHHHcccccccEEEEEEccHHHHHHHHHHccccccccHHHHHHcccccc
ccccccEEEcHHccccccccccccccccccccEEEEcccccccccccccccccccccEEEccHcccccccccccccHHHHHEccccccccEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHcccccHccEEEEcccHHHHHHHHHHHccccEEEEEccEEEccHHcccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccHHHHHHHcEEEEEcccccccccHHHHHHHHHHHcccHHHHHHEEEHcccccEcccHHHHHHccccccccccEEEEEEcccccEEEEEHHHccccccccccHEEcccHHHHHHHHHHHHHHHcccEEccccEEEEEEccEEccccHHHHHHHHHHHHHHcccccccccEEEEEEcccccEcccccHHHHHHHHHHccccccccccccccccEccccHHHcEccHHHHHHHHHHHHHHHHHHHccccccccccc
MVKIRSQYFCQSCGeihsrwigkcdscnawntiiedssrkesdQRFSKTIKQGHSISlfmlseesieEESRIQTHIDeldrvtgggfvrgsvilvggdpgigkSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLitnekpdlVIIDSIQTLWsqtaesspgtvIQVRTSVQAMIQYAKKNGVAMVLVGHVtkegqiagpRVIEHMVDAVLYfeggtrntqyDYRILRSVknrfgptdeigvfemsdkglqevsdpskiflsdrdstspgtavFAGIEGTRALLVEIQSlvvptslgmprrtvvgwdSSRLAMILAVLEARCnikfgnhdvhlniaggyrisepaADVAVAAALISSIlsiplpsdfvyfgeVSLSGSVRAVGHMQQRLKEAEKigflsgvfpesakgeckigmlDRQYIKNLSDLVKKITALQKkdkktvhktrslnspwe
MVKIRSQYFCQSCGEIHSRWIGKCDSCNAWNTIiedssrkesdQRFSKTIKQGHSISLFMLSEESIEEESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLITNEKPDLVIIDSIQTLWsqtaesspgtvIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEGQIAGPRVIEHMVDAVLYFEggtrntqydyRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSKiflsdrdstspGTAVFAGIEGTRALLVEIQSlvvptslgmprrtvVGWDSSRLAMILAVLEARCNIKFGNHDVHLNIAGGYRISEPAADVAVAAALISSILSIPLPSDFVYFGEVSLSGSVRAVGHMQQRLKEAEKIGFLSGVFPESAKGECKIGMLDRQYIKNLSDLVKKITalqkkdkktvhktrslnspwe
MVKIRSQYFCQSCGEIHSRWIGKCDSCNAWNTIIEDSSRKESDQRFSKTIKQGHsislfmlseesieeesRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLITNEKPDLVIIDSIQTLWSQTAESSPGTVIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEGQIAGPRVIEHMVDAVLYFEGGTRNTQYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSKIFLSDRDSTSPGTAVFAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAMILAVLEARCNIKFGNHDVHLNIAGGYRISEpaadvavaaalissilsiplpsdFVYFGEVSLSGSVRAVGHMQQRLKEAEKIGFLSGVFPESAKGECKIGMLDRQYIKNLSDLVKKITALQKKDKKTVHKTRSLNSPWE
**KIRSQYFCQSCGEIHSRWIGKCDSCNAWNTI************************************SRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLITNEKPDLVIIDSIQTLWSQTAESSPGTVIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEGQIAGPRVIEHMVDAVLYFEGGTRNTQYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSKIFLSDRDSTSPGTAVFAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAMILAVLEARCNIKFGNHDVHLNIAGGYRISEPAADVAVAAALISSILSIPLPSDFVYFGEVSLSGSVRAVGHMQQRLKEAEKIGFLSGVFPESAK*****GMLDRQYIKNLSDLVK************************
MVKIRSQYFCQSCGEIHSRWIGKCDSCNAWNTIIEDS***********TIKQGHSISLFMLSEESIEEESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLITNEKPDLVIIDSIQTLWSQTAESSPGTVIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEGQIAGPRVIEHMVDAVLYFEGGTRNTQYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSKIFLSDRDSTSPGTAVFAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAMILAVLEARCNIKFGNHDVHLNIAGGYRISEPAADVAVAAALISSILSIPLPSDFVYFGEVSLSGSVRAVGHMQQRLKEAEKIGFLSGVFPESAKGECKIGMLDRQYIKNLSDLVKKITALQ******************
****RSQYFCQSCGEIHSRWIGKCDSCNAWNTIIEDSSR***************SISLFMLSEESIEEESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLITNEKPDLVIIDSIQTLWSQTAESSPGTVIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEGQIAGPRVIEHMVDAVLYFEGGTRNTQYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSKIFLSDRDSTSPGTAVFAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAMILAVLEARCNIKFGNHDVHLNIAGGYRISEPAADVAVAAALISSILSIPLPSDFVYFGEVSLSGSVRAVGHMQQRLKEAEKIGFLSGVFPESAKGECKIGMLDRQYIKNLSDLVKKITALQKKDKKTVHKTRSLNS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKIRSQYFCQSCGEIHSRWIGKCDSCNAWNTIIEDSSRKESDQRFSKTIKQGHSISLFMLSEESIEEESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLITNEKPDLVIIDSIQTLWSQTAESSPGTVIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEGQIAGPRVIEHMVDAVLYFEGGTRNTQYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSKIFLSDRDSTSPGTAVFAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAMILAVLEARCNIKFGNHDVHLNIAGGYRISEPAADVAVAAALISSILSIPLPSDFVYFGEVSLSGSVRAVGHMQQRLKEAEKIGFLSGVFPESAKGECKIGMLDRQYIKNLSDLVKKITALQKKDKKTVHKTRSLNSPWE
MVKIRSQYFCQSCGEIHSRWIGKCDSCNAWNTIIEDSSRKESDQRFSKTIKQGHSISLFMLSEESIEEESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLITNEKPDLVIIDSIQTLWSQTAESSPGTVIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEGQIAGPRVIEHMVDAVLYFEGGTRNTQYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSKIFLSDRDSTSPGTAVFAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAMILAVLEARCNIKFGNHDVHLNIAGGYRISEPAADVAVAAALISSILSIPLPSDFVYFGEVSLSGSVRAVGHMQQRLKEAEKIGFLSGVFPESAKGECKIGMLDRQYIKNLSDLVKKITALQKKDKKTVHKTRSLNSPWE
MVKIRSQYFCQSCGEIHSRWIGKCDSCNAWNTIIEDSSRKESDQRFSKTIKQGHSISLFMLSEESIEEESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLITNEKPDLVIIDSIQTLWSQTAESSPGTVIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEGQIAGPRVIEHMVDAVLYFEGGTRNTQYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSKIFLSDRDSTSPGTAVFAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAMILAVLEARCNIKFGNHDVHLNIAGGYRISEPAADVAVAAALISSILSIPLPSDFVYFGEVSLSGSVRAVGHMQQRLKEAEKIGFLSGVFPESAKGECKIGMLDRQYIKNLSDLVKKITALQKKDKKTVHKTRSLNSPWE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target479 DNA repair protein RadA [Candidatus Liberibacter asiati
254780270820 ATP-dependent protease La [Candidatus Liberibacter 9e-06
254781149266 replicative DNA helicase [Candidatus Liberibacter 0.001
255764460363 recombinase A [Candidatus Liberibacter asiaticus s 0.002
254780332504 replicative DNA helicase [Candidatus Liberibacter 0.019
254780184 959 excinuclease ABC subunit A [Candidatus Liberibacte 0.036
>gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Back     alignment
 Score = 43.1 bits (100), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 353 FGNHDVHLNIAGGYRISE-PAADVAVAAALISSILSIPLPSDFVYFGEVSLSGSVRAVGH 411
           F   ++H+++  G    + P+A +A+A A++S +  IP+  +    GE++L G V  +G 
Sbjct: 675 FNEINIHVHVPEGATPKDGPSAGIAMATAIVSIMTCIPVYKNVAMTGELTLRGRVLPIGG 734

Query: 412 MQQRLKEAEKIGFLSGVFPE 431
           ++++L  A + G    + PE
Sbjct: 735 LKEKLLAALRAGVTKVLIPE 754

>gi|254781149|ref|YP_003065562.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 266 Back     alignment
 Score = 36.2 bits (82), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 68  EESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGE 127
           E   I+  +  +D + GG  +R  +IL+G  P +GK+T  + TA  +A   H + + S E
Sbjct: 121 ENPDIKWGLQSVDHLMGGVQLR-ELILIGARPSMGKTTFALSTALHMAMSGHGVAFFSLE 179

>gi|255764460|ref|YP_003064605.2| recombinase A [Candidatus Liberibacter asiaticus str. psy62] Length = 363 Back     alignment
 Score = 35.4 bits (80), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 85  GGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHRITYVSGEEAIGQIRLRAQRLNTIN 144
           GGF +G ++ + G    GK+TL + T A          +V  E A+  I   A++L    
Sbjct: 62  GGFPKGRIVEIYGPESSGKTTLALHTIAQSQKTGGTCAFVDAEHALDSI--YARKLGVDL 119

Query: 145 SSVYIAIETNVE---DIIATLITNEKPDLVIIDSIQTLWSQT------AESSPGTVIQVR 195
            ++ I+     E   +I   L+ +   D+++IDS+  L  +        ES PG  +Q R
Sbjct: 120 KNLLISQPDTGEQALEITDMLVRSGAVDIIVIDSVAALTPRAEIEGDMGESLPG--MQAR 177

Query: 196 TSVQAM 201
              QA+
Sbjct: 178 LMSQAL 183

>gi|254780332|ref|YP_003064745.1| replicative DNA helicase [Candidatus Liberibacter asiaticus str. psy62] Length = 504 Back     alignment
 Score = 32.3 bits (72), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 72  IQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLA 115
           + T I  LD+  GG   R  +I++ G PG+GK++L    A ++A
Sbjct: 202 VSTGIQTLDKQMGG-LQRSDLIIIAGRPGMGKTSLATNIAYNVA 244

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 31.2 bits (69), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 53/126 (42%), Gaps = 20/126 (15%)

Query: 162 LITNEKPDLVIIDSI-------QTLWSQTAESSPGTVIQVRTSVQAMIQYAKKNGVAMVL 214
           L T +KPD+  ID +       Q   S    S+ GT+ ++   ++ +         A + 
Sbjct: 68  LGTIKKPDVEQIDGLSPTISIEQKNTSHNPRSTVGTITEIHDYLRLLF--------ARIG 119

Query: 215 VGHVTKEGQIAGPRVIEHMVDAVLYFEGGTRNTQYDYRILRSVKNRFGPTDEIGVFEMSD 274
           + H    G     + I  M D +L FE GTR     Y +   V+NR G   +  + E+  
Sbjct: 120 IPHSPTTGLPIESQTISQMADRLLSFEQGTRM----YLLAPIVRNRKGEYKK-ELAEILK 174

Query: 275 KGLQEV 280
           KG Q V
Sbjct: 175 KGFQRV 180

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target479 DNA repair protein RadA [Candidatus Liberibacter asiati
315122241465 DNA repair protein RadA [Candidatus Liberibacter solana 1 0.0
15964879487 DNA repair protein RadA [Sinorhizobium meliloti 1021] L 1 1e-178
307300950467 DNA repair protein RadA [Sinorhizobium meliloti BL225C] 1 1e-177
150395953467 DNA repair protein RadA [Sinorhizobium medicae WSM419] 1 1e-177
227821451467 DNA repair protein RadA [Sinorhizobium fredii NGR234] L 1 1e-175
325292457466 DNA repair protein RadA [Agrobacterium sp. H13-3] Lengt 1 1e-175
190891115466 DNA repair protein [Rhizobium etli CIAT 652] Length = 4 1 1e-174
222148126466 DNA repair protein RadA [Agrobacterium vitis S4] Length 1 1e-173
15888420468 DNA repair protein RadA [Agrobacterium tumefaciens str. 1 1e-172
222085426467 DNA repair protein RadA [Agrobacterium radiobacter K84] 1 1e-170
>gi|315122241|ref|YP_004062730.1| DNA repair protein RadA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 465 Back     alignment and organism information
 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/464 (86%), Positives = 429/464 (92%)

Query: 1   MVKIRSQYFCQSCGEIHSRWIGKCDSCNAWNTIIEDSSRKESDQRFSKTIKQGHSISLFM 60
           M K RSQY CQ+CGEIHSRW+GKCDSCN WNTI+ED S++E DQRF+K IK+G  I L M
Sbjct: 1   MAKTRSQYLCQACGEIHSRWVGKCDSCNEWNTIVEDDSKQEDDQRFNKKIKKGRPIPLVM 60

Query: 61  LSEESIEEESRIQTHIDELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQTAASLAYKKHR 120
           LSEE IEEESRIQTHI ELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQ AASLAYKKH 
Sbjct: 61  LSEELIEEESRIQTHISELDRVTGGGFVRGSVILVGGDPGIGKSTLLMQAAASLAYKKHN 120

Query: 121 ITYVSGEEAIGQIRLRAQRLNTINSSVYIAIETNVEDIIATLITNEKPDLVIIDSIQTLW 180
           ITYVSGEE+IGQIRLR+QRLNT+NSSV + IETNVEDII TL+TNEKPDLVIIDSIQTLW
Sbjct: 121 ITYVSGEESIGQIRLRSQRLNTLNSSVQVGIETNVEDIIETLLTNEKPDLVIIDSIQTLW 180

Query: 181 SQTAESSPGTVIQVRTSVQAMIQYAKKNGVAMVLVGHVTKEGQIAGPRVIEHMVDAVLYF 240
           SQ AESSPGTVIQVRTSVQ +IQYAK N V+MVLVGHVTKEGQIAGPRVIEHMVDAVLYF
Sbjct: 181 SQIAESSPGTVIQVRTSVQLIIQYAKTNNVSMVLVGHVTKEGQIAGPRVIEHMVDAVLYF 240

Query: 241 EGGTRNTQYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSKIFLSDRDSTSPGTAV 300
           EGGTRN QYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSK+FLS+RDSTSPG AV
Sbjct: 241 EGGTRNAQYDYRILRSVKNRFGPTDEIGVFEMSDKGLQEVSDPSKMFLSNRDSTSPGAAV 300

Query: 301 FAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAMILAVLEARCNIKFGNHDVHL 360
           FAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAMILAVLEARC IKFGNHDVHL
Sbjct: 301 FAGIEGTRALLVEIQSLVVPTSLGMPRRTVVGWDSSRLAMILAVLEARCKIKFGNHDVHL 360

Query: 361 NIAGGYRISEPAADVAVAAALISSILSIPLPSDFVYFGEVSLSGSVRAVGHMQQRLKEAE 420
           N+AGGYRISEPAAD+AVAAALISSI  IPLPS  +YFGE+SLSG VR VGH+QQRLKEAE
Sbjct: 361 NVAGGYRISEPAADLAVAAALISSIFCIPLPSSCIYFGEISLSGDVRPVGHIQQRLKEAE 420

Query: 421 KIGFLSGVFPESAKGECKIGMLDRQYIKNLSDLVKKITALQKKD 464
           KIGFLSG+FPE +KGECKIG++D Q+I NLSDLV+KI +LQKK+
Sbjct: 421 KIGFLSGIFPEPSKGECKIGIIDSQHIINLSDLVQKIKSLQKKE 464


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15964879|ref|NP_385232.1| DNA repair protein RadA [Sinorhizobium meliloti 1021] Length = 487 Back     alignment and organism information
>gi|307300950|ref|ZP_07580719.1| DNA repair protein RadA [Sinorhizobium meliloti BL225C] Length = 467 Back     alignment and organism information
>gi|150395953|ref|YP_001326420.1| DNA repair protein RadA [Sinorhizobium medicae WSM419] Length = 467 Back     alignment and organism information
>gi|227821451|ref|YP_002825421.1| DNA repair protein RadA [Sinorhizobium fredii NGR234] Length = 467 Back     alignment and organism information
>gi|325292457|ref|YP_004278321.1| DNA repair protein RadA [Agrobacterium sp. H13-3] Length = 466 Back     alignment and organism information
>gi|190891115|ref|YP_001977657.1| DNA repair protein [Rhizobium etli CIAT 652] Length = 466 Back     alignment and organism information
>gi|222148126|ref|YP_002549083.1| DNA repair protein RadA [Agrobacterium vitis S4] Length = 466 Back     alignment and organism information
>gi|15888420|ref|NP_354101.1| DNA repair protein RadA [Agrobacterium tumefaciens str. C58] Length = 468 Back     alignment and organism information
>gi|222085426|ref|YP_002543956.1| DNA repair protein RadA [Agrobacterium radiobacter K84] Length = 467 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target479 DNA repair protein RadA [Candidatus Liberibacter asiati
PRK11823446 PRK11823, PRK11823, DNA repair protein RadA; Provisiona 0.0
TIGR00416454 TIGR00416, sms, DNA repair protein RadA 1e-138
COG1066456 COG1066, Sms, Predicted ATP-dependent serine protease [ 1e-168
cd01121372 cd01121, Sms, Sms (bacterial radA) DNA repair protein 1e-138
cd01120165 cd01120, RecA-like_NTPases, RecA-like NTPases 1e-13
cd01393226 cd01393, recA_like, RecA is a bacterial enzyme which ha 1e-09
smart00382148 smart00382, AAA, ATPases associated with a variety of c 2e-09
cd01124187 cd01124, KaiC, KaiC is a circadian clock protein primar 5e-08
COG0305435 COG0305, DnaB, Replicative DNA helicase [DNA replicatio 2e-05
TIGR03600421 TIGR03600, phage_DnaB, phage replicative helicase, DnaB 4e-05
cd01122271 cd01122, GP4d_helicase, GP4d_helicase is a homohexameri 2e-04
PRK05973237 PRK05973, PRK05973, replicative DNA helicase; Provision 0.001
TIGR02902531 TIGR02902, spore_lonB, ATP-dependent protease LonB 2e-12
COG1067647 COG1067, LonB, Predicted ATP-dependent protease [Posttr 3e-06
COG0468279 COG0468, RecA, RecA/RadA recombinase [DNA replication, 3e-12
COG0467260 COG0467, RAD55, RecA-superfamily ATPases implicated in 3e-12
pfam06745231 pfam06745, KaiC, KaiC 1e-10
TIGR02237209 TIGR02237, recomb_radB, DNA repair and recombination pr 2e-09
cd01394218 cd01394, radB, RadB 5e-09
cd01123235 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B 2e-08
PRK09361225 PRK09361, radB, DNA repair and recombination protein Ra 6e-08
PRK09302509 PRK09302, PRK09302, circadian clock protein KaiC; Revie 1e-05
TIGR03878259 TIGR03878, thermo_KaiC_2, KaiC domain protein, AF_0795 1e-05
TIGR03880224 TIGR03880, KaiC_arch_3, KaiC domain protein, AF_0351 fa 9e-05
KOG1433326 KOG1433, KOG1433, KOG1433, DNA repair protein RAD51/RHP 1e-04
PRK09302509 PRK09302, PRK09302, circadian clock protein KaiC; Revie 4e-12
TIGR03881229 TIGR03881, KaiC_arch_4, KaiC domain protein, PAE1156 fa 2e-06
PRK08533230 PRK08533, PRK08533, flagellar accessory protein FlaH; R 2e-06
PRK06067234 PRK06067, PRK06067, flagellar accessory protein FlaH; V 1e-04
cd00983325 cd00983, recA, RecA is a bacterial enzyme which has rol 3e-04
KOG1434335 KOG1434, KOG1434, KOG1434, Meiotic recombination protei 8e-04
TIGR02903615 TIGR02903, spore_lon_C, ATP-dependent protease, Lon fam 2e-10
TIGR00764608 TIGR00764, lon_rel, lon-related putative ATP-dependent 2e-08
COG0466782 COG0466, Lon, ATP-dependent Lon protease, bacterial typ 6e-05
PRK13765637 PRK13765, PRK13765, ATP-dependent protease Lon; Provisi 6e-05
TIGR00763775 TIGR00763, lon, ATP-dependent protease La 2e-04
PRK10787784 PRK10787, PRK10787, DNA-binding ATP-dependent protease 3e-04
pfam05362205 pfam05362, Lon_C, Lon protease (S16) C-terminal proteol 0.003
COG2874235 COG2874, FlaH, Predicted ATPases involved in biogenesis 7e-06
TIGR02655484 TIGR02655, circ_KaiC, circadian clock protein KaiC 6e-05
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 4e-04
cd00984242 cd00984, DnaB_C, DnaB helicase C terminal domain 0.002
KOG2004906 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent 2e-05
pfam03796186 pfam03796, DnaB_C, DnaB-like helicase C terminal domain 6e-05
PRK07773 886 PRK07773, PRK07773, replicative DNA helicase; Validated 0.002
TIGR00665434 TIGR00665, DnaB, replicative DNA helicase 0.003
>gnl|CDD|183326 PRK11823, PRK11823, DNA repair protein RadA; Provisional Back     alignment and domain information
>gnl|CDD|161868 TIGR00416, sms, DNA repair protein RadA Back     alignment and domain information
>gnl|CDD|31265 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|29987 cd01121, Sms, Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>gnl|CDD|29986 cd01120, RecA-like_NTPases, RecA-like NTPases Back     alignment and domain information
>gnl|CDD|30003 cd01393, recA_like, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|29990 cd01124, KaiC, KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>gnl|CDD|30653 COG0305, DnaB, Replicative DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132639 TIGR03600, phage_DnaB, phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>gnl|CDD|29988 cd01122, GP4d_helicase, GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>gnl|CDD|168322 PRK05973, PRK05973, replicative DNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|131948 TIGR02902, spore_lonB, ATP-dependent protease LonB Back     alignment and domain information
>gnl|CDD|31266 COG1067, LonB, Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30816 COG0468, RecA, RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|30815 COG0467, RAD55, RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|148381 pfam06745, KaiC, KaiC Back     alignment and domain information
>gnl|CDD|162777 TIGR02237, recomb_radB, DNA repair and recombination protein RadB Back     alignment and domain information
>gnl|CDD|30004 cd01394, radB, RadB Back     alignment and domain information
>gnl|CDD|29989 cd01123, Rad51_DMC1_radA, Rad51_DMC1_radA,B Back     alignment and domain information
>gnl|CDD|181799 PRK09361, radB, DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>gnl|CDD|181771 PRK09302, PRK09302, circadian clock protein KaiC; Reviewed Back     alignment and domain information
>gnl|CDD|163590 TIGR03878, thermo_KaiC_2, KaiC domain protein, AF_0795 family Back     alignment and domain information
>gnl|CDD|163592 TIGR03880, KaiC_arch_3, KaiC domain protein, AF_0351 family Back     alignment and domain information
>gnl|CDD|36646 KOG1433, KOG1433, KOG1433, DNA repair protein RAD51/RHP55 [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|181771 PRK09302, PRK09302, circadian clock protein KaiC; Reviewed Back     alignment and domain information
>gnl|CDD|163593 TIGR03881, KaiC_arch_4, KaiC domain protein, PAE1156 family Back     alignment and domain information
>gnl|CDD|181459 PRK08533, PRK08533, flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>gnl|CDD|180381 PRK06067, PRK06067, flagellar accessory protein FlaH; Validated Back     alignment and domain information
>gnl|CDD|29984 cd00983, recA, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>gnl|CDD|36647 KOG1434, KOG1434, KOG1434, Meiotic recombination protein Dmc1 [Energy production and conversion, Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|163066 TIGR02903, spore_lon_C, ATP-dependent protease, Lon family Back     alignment and domain information
>gnl|CDD|162029 TIGR00764, lon_rel, lon-related putative ATP-dependent protease Back     alignment and domain information
>gnl|CDD|30814 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184312 PRK13765, PRK13765, ATP-dependent protease Lon; Provisional Back     alignment and domain information
>gnl|CDD|162028 TIGR00763, lon, ATP-dependent protease La Back     alignment and domain information
>gnl|CDD|182730 PRK10787, PRK10787, DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>gnl|CDD|114104 pfam05362, Lon_C, Lon protease (S16) C-terminal proteolytic domain Back     alignment and domain information
>gnl|CDD|32701 COG2874, FlaH, Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|131703 TIGR02655, circ_KaiC, circadian clock protein KaiC Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|29985 cd00984, DnaB_C, DnaB helicase C terminal domain Back     alignment and domain information
>gnl|CDD|37215 KOG2004, KOG2004, KOG2004, Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|146436 pfam03796, DnaB_C, DnaB-like helicase C terminal domain Back     alignment and domain information
>gnl|CDD|181111 PRK07773, PRK07773, replicative DNA helicase; Validated Back     alignment and domain information
>gnl|CDD|161985 TIGR00665, DnaB, replicative DNA helicase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 479 DNA repair protein RadA [Candidatus Liberibacter asiati
TIGR00416481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 100.0
PRK11823454 DNA repair protein RadA; Provisional 100.0
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 100.0
KOG0732 1080 consensus 96.7
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 100.0
cd01394218 radB RadB. The archaeal protein radB shares similarity 100.0
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 100.0
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 100.0
pfam06745231 KaiC KaiC. This family represents a conserved region wi 99.97
PRK04328250 hypothetical protein; Provisional 99.97
PRK09302501 circadian clock protein KaiC; Reviewed 99.97
PRK09302501 circadian clock protein KaiC; Reviewed 99.97
PRK06067241 flagellar accessory protein FlaH; Validated 99.94
pfam08423261 Rad51 Rad51. Rad51 is a DNA repair and recombination pr 99.93
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 99.93
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 99.93
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 99.92
cd01393226 recA_like RecA is a bacterial enzyme which has roles in 99.92
PRK04301318 radA DNA repair and recombination protein RadA; Validat 99.92
PRK07004460 replicative DNA helicase; Provisional 99.91
PRK06749428 replicative DNA helicase; Provisional 99.91
PRK08840464 replicative DNA helicase; Provisional 99.91
PRK09165484 replicative DNA helicase; Provisional 99.91
PRK05595444 replicative DNA helicase; Provisional 99.91
PRK08082453 consensus 99.91
PRK08760476 replicative DNA helicase; Provisional 99.91
PRK05636507 replicative DNA helicase; Provisional 99.91
PRK08006471 replicative DNA helicase; Provisional 99.91
PRK08694468 consensus 99.9
PRK05748448 replicative DNA helicase; Provisional 99.9
PRK07263453 consensus 99.9
PRK06321472 replicative DNA helicase; Provisional 99.9
PRK06904472 replicative DNA helicase; Validated 99.9
COG0468279 RecA RecA/RadA recombinase [DNA replication, recombinat 99.9
PRK08506473 replicative DNA helicase; Provisional 99.89
PTZ00035350 Rad51; Provisional 99.89
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 99.89
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 99.89
cd00983325 recA RecA is a bacterial enzyme which has roles in homo 99.88
pfam00154322 RecA recA bacterial DNA recombination protein. RecA is 99.88
PRK09354350 recA recombinase A; Provisional 99.88
cd01124187 KaiC KaiC is a circadian clock protein primarily found 99.87
PRK08533230 flagellar accessory protein FlaH; Reviewed 99.86
COG0305435 DnaB Replicative DNA helicase [DNA replication, recombi 99.81
TIGR02236333 recomb_radA DNA repair and recombination protein RadA; 99.79
TIGR02012322 tigrfam_recA protein RecA; InterPro: IPR001553 The recA 99.74
KOG1434335 consensus 99.72
TIGR02238314 recomb_DMC1 meiotic recombinase Dmc1; InterPro: IPR0119 99.54
COG2874235 FlaH Predicted ATPases involved in biogenesis of archae 99.49
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is encod 99.46
KOG1433326 consensus 99.35
TIGR00665465 DnaB replicative DNA helicase; InterPro: IPR007692 This 99.34
TIGR02655484 circ_KaiC circadian clock protein KaiC; InterPro: IPR01 99.3
KOG2373514 consensus 99.27
TIGR02239317 recomb_RAD51 DNA repair protein RAD51; InterPro: IPR011 99.2
pfam07088484 GvpD GvpD gas vesicle protein. This family consists of 98.95
PRK12377248 putative replication protein; Provisional 98.67
PRK06526254 transposase; Provisional 98.34
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 98.05
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 97.92
PRK09536409 btuD corrinoid ABC transporter ATPase; Reviewed 97.64
TIGR02142361 modC_ABC molybdate ABC transporter, ATP-binding protein 97.56
COG1435201 Tdk Thymidine kinase [Nucleotide transport and metaboli 97.55
pfam09807249 DUF2348 Uncharacterized conserved protein (DUF2348). Me 97.53
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 97.52
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 97.21
PRK06696227 uridine kinase; Validated 97.19
COG4618580 ArpD ABC-type protease/lipase transport system, ATPase 97.09
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 97.03
PRK00090223 bioD dithiobiotin synthetase; Reviewed 96.7
PRK10865 857 protein disaggregation chaperone; Provisional 96.65
KOG0061 613 consensus 96.65
TIGR00763941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 99.98
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.97
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Posttra 99.96
TIGR02902532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 99.96
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.96
KOG2004906 consensus 99.9
pfam05362205 Lon_C Lon protease (S16) C-terminal proteolytic domain. 99.89
PRK13765637 ATP-dependent protease Lon; Provisional 99.81
TIGR00764662 lon_rel ATP-dependent protease, putative; InterPro: IPR 99.18
TIGR02653677 Lon_rel_chp conserved hypothetical protein; InterPro: I 98.22
COG3480342 SdrC Predicted secreted protein containing a PDZ domain 98.04
COG4930683 Predicted ATP-dependent Lon-type protease [Posttranslat 96.8
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 99.94
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 99.87
PRK05973237 replicative DNA helicase; Provisional 99.72
KOG1564351 consensus 99.59
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 99.21
smart00382148 AAA ATPases associated with a variety of cellular activ 98.65
PRK07952242 DNA replication protein DnaC; Validated 98.43
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 98.25
cd03246173 ABCC_Protease_Secretion This family represents the ABC 98.21
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 98.2
PRK08116262 hypothetical protein; Validated 98.15
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 98.12
PRK06921265 hypothetical protein; Provisional 98.11
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 98.09
PRK06835330 DNA replication protein DnaC; Validated 98.06
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 98.05
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 98.04
pfam05621302 TniB Bacterial TniB protein. This family consists of se 98.03
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 98.03
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide 98.01
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 98.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 98.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 97.99
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 97.99
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 97.98
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 97.97
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 97.97
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.97
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 97.96
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.95
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 97.95
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 97.94
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.92
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 97.92
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.91
pfam00006213 ATP-synt_ab ATP synthase alpha/beta family, nucleotide- 97.91
CHL00059501 atpA ATP synthase CF1 alpha subunit 97.91
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 97.91
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 97.91
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 97.91
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 97.9
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central domain. 97.9
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 97.9
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 97.89
COG1123539 ATPase components of various ABC-type transport systems 97.88
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 97.88
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 97.88
COG4608268 AppF ABC-type oligopeptide transport system, ATPase com 97.87
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 97.87
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.86
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 97.84
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 97.84
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.83
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha. 97.82
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 97.82
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 97.82
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.82
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.82
CHL00195491 ycf46 Ycf46; Provisional 97.81
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 97.81
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 97.81
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 97.81
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 97.8
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 97.8
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 97.8
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.8
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.8
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subu 97.79
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 97.79
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 97.79
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.78
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 97.78
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 97.77
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 97.77
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 97.77
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 97.76
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 97.76
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 97.76
PRK10908222 cell division protein FtsE; Provisional 97.75
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 97.75
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 97.75
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 97.75
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 97.75
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 97.74
COG1122235 CbiO ABC-type cobalt transport system, ATPase component 97.74
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 97.73
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 97.73
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 97.73
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.73
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 97.71
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 97.71
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 97.71
pfam03266168 DUF265 Protein of unknown function, DUF265. 97.71
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 97.7
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 97.7
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.7
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 97.7
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 97.7
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 97.69
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 97.68
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.68
PRK05642234 DNA replication initiation factor; Validated 97.68
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 97.67
PRK08084235 DNA replication initiation factor; Provisional 97.67
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 97.67
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.66
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 97.65
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 97.65
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 97.65
PRK08727233 hypothetical protein; Validated 97.65
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.65
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 97.64
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 97.63
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 97.63
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 97.63
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 97.62
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 97.62
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 97.61
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 97.61
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 97.61
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 97.59
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 97.58
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 97.58
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 97.58
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 97.57
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 97.57
PRK13536306 nodulation factor exporter subunit NodI; Provisional 97.56
KOG0733 802 consensus 97.54
pfam00308219 Bac_DnaA Bacterial dnaA protein. 97.54
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 97.54
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 97.54
PRK00149447 dnaA chromosomal replication initiation protein; Review 97.54
PRK12422455 chromosomal replication initiation protein; Provisional 97.53
COG4178604 ABC-type uncharacterized transport system, permease and 97.53
PRK08903227 hypothetical protein; Validated 97.53
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 97.52
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 97.51
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. Membe 97.5
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 97.5
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 97.49
PRK06893229 DNA replication initiation factor; Validated 97.49
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 97.48
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 97.48
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 97.48
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 97.47
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 97.47
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 97.47
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 97.47
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 97.45
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 97.45
PRK04841 903 transcriptional regulator MalT; Provisional 97.44
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 97.43
PRK08472435 fliI flagellum-specific ATP synthase; Validated 97.42
KOG0780483 consensus 97.42
KOG0060659 consensus 97.41
PRK13894320 conjugal transfer ATPase TrbB; Provisional 97.4
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 97.4
PRK06002450 fliI flagellum-specific ATP synthase; Validated 97.4
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 97.39
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 97.38
COG1341398 Predicted GTPase or GTP-binding protein [General functi 97.37
COG1123539 ATPase components of various ABC-type transport systems 97.37
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A. 97.37
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 97.37
PRK11607377 potG putrescine transporter ATP-binding subunit; Provis 97.37
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 97.36
PRK13900332 type IV secretion system ATPase VirB11; Provisional 97.36
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 97.35
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 97.34
PRK07165507 F0F1 ATP synthase subunit alpha; Validated 97.33
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 97.32
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 97.31
COG1134249 TagH ABC-type polysaccharide/polyol phosphate transport 97.3
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 97.29
KOG0730 693 consensus 97.29
PRK09435325 arginine/ornithine transport system ATPase; Provisional 97.28
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 97.28
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 97.27
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 97.26
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 97.25
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 97.24
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 97.23
COG4172534 ABC-type uncharacterized transport system, duplicated A 97.23
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.22
cd01128249 rho_factor Transcription termination factor rho is a ba 97.21
KOG0735 952 consensus 97.21
PRK04296197 thymidine kinase; Provisional 97.2
KOG0744423 consensus 97.19
PRK13851343 type IV secretion system protein VirB11; Provisional 97.19
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 97.18
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. Membe 97.14
COG1135339 AbcC ABC-type metal ion transport system, ATPase compon 97.13
PRK05688451 fliI flagellum-specific ATP synthase; Validated 97.13
TIGR01187331 potA polyamine ABC transporter, ATP-binding protein; In 97.11
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 97.11
PRK13833323 conjugal transfer protein TrbB; Provisional 97.1
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 97.09
COG3845501 ABC-type uncharacterized transport systems, ATPase comp 97.02
TIGR01618229 phage_P_loop phage nucleotide-binding protein; InterPro 97.01
COG2087175 CobU Adenosyl cobinamide kinase/adenosyl cobinamide pho 96.98
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 96.96
COG0410237 LivF ABC-type branched-chain amino acid transport syste 96.93
TIGR01969258 minD_arch cell division ATPase MinD; InterPro: IPR01022 96.91
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 96.91
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; Vali 96.87
TIGR00959439 ffh signal recognition particle protein; InterPro: IPR0 96.86
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 96.85
COG1129500 MglA ABC-type sugar transport system, ATPase component 96.84
PRK04196460 V-type ATP synthase subunit B; Provisional 96.84
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 96.83
TIGR01166190 cbiO cobalt ABC transporter, ATP-binding protein; Inter 96.82
COG4619223 ABC-type uncharacterized transport system, ATPase compo 96.82
TIGR01184230 ntrCD nitrate ABC transporter, ATP-binding proteins C a 96.8
pfam00265175 TK Thymidine kinase. 96.8
PRK02118432 V-type ATP synthase subunit B; Provisional 96.75
COG3840231 ThiQ ABC-type thiamine transport system, ATPase compone 96.75
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 96.75
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 96.75
PRK09862 506 putative ATP-dependent protease; Provisional 99.89
TIGR00368 505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 99.84
COG0606 490 Predicted ATPase with chaperone activity [Posttranslati 99.72
COG1750 579 Archaeal serine proteases [General function prediction 99.04
PRK07773 868 replicative DNA helicase; Validated 99.84
TIGR02655484 circ_KaiC circadian clock protein KaiC; InterPro: IPR01 99.47
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 97.16
PRK09401 1176 reverse gyrase; Reviewed 96.88
PRK09519 790 recA recombinase A; Reviewed 99.78
PRK08181269 transposase; Validated 98.33
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 98.25
PRK09183258 transposase/IS protein; Provisional 98.19
PRK08939306 primosomal protein DnaI; Reviewed 97.93
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 97.31
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 97.26
TIGR02858282 spore_III_AA stage III sporulation protein AA; InterPro 97.14
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 97.14
KOG0728404 consensus 96.9
KOG0727408 consensus 96.68
COG1067647 LonB Predicted ATP-dependent protease [Posttranslationa 99.75
cd03115173 SRP The signal recognition particle (SRP) mediates the 98.45
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 98.35
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 98.34
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 98.14
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 98.12
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 98.11
COG1484254 DnaC DNA replication protein [DNA replication, recombin 98.05
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 98.02
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 97.99
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.95
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 97.91
PRK03992390 proteasome-activating nucleotidase; Provisional 97.89
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.87
pfam00004131 AAA ATPase family associated with various cellular acti 97.73
PRK06315442 type III secretion system ATPase; Provisional 97.68
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-specific 97.68
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 97.67
PRK13849231 putative crown gall tumor protein VirC1; Provisional 97.64
PRK00771433 signal recognition particle protein Srp54; Provisional 97.63
KOG0734752 consensus 97.61
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta. 97.59
PRK09280466 F0F1 ATP synthase subunit beta; Validated 97.58
PRK07196434 fliI flagellum-specific ATP synthase; Validated 97.55
PRK12597459 F0F1 ATP synthase subunit beta; Provisional 97.52
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 97.49
PRK07960455 fliI flagellum-specific ATP synthase; Validated 97.48
PRK07594433 type III secretion system ATPase; Validated 97.46
PRK07721435 fliI flagellum-specific ATP synthase; Validated 97.46
PRK10416499 cell division protein FtsY; Provisional 97.45
PRK08927441 fliI flagellum-specific ATP synthase; Validated 97.43
CHL00176631 ftsH cell division protein; Validated 97.42
PHA02518211 ParA-like protein; Provisional 97.41
PRK08149427 ATP synthase SpaL; Validated 97.4
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. Membe 97.39
PRK09099441 type III secretion system ATPase; Provisional 97.37
PRK06793432 fliI flagellum-specific ATP synthase; Validated 97.35
PRK06936439 type III secretion system ATPase; Provisional 97.32
PRK10867453 signal recognition particle protein; Provisional 97.28
PRK06820445 type III secretion system ATPase; Validated 97.27
PRK05922434 type III secretion system ATPase; Validated 97.27
PRK13768253 GTPase; Provisional 97.25
COG0541451 Ffh Signal recognition particle GTPase [Intracellular t 97.22
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 97.11
PRK08972440 fliI flagellum-specific ATP synthase; Validated 97.03
pfam00931285 NB-ARC NB-ARC domain. 96.99
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 96.98
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 96.97
KOG0731774 consensus 96.96
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 96.95
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 96.89
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.86
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 96.83
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 96.79
PRK12608379 transcription termination factor Rho; Provisional 96.73
COG2894272 MinD Septum formation inhibitor-activating ATPase [Cell 96.73
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 96.73
KOG3062281 consensus 96.67
KOG0739439 consensus 96.65
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 96.63
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 98.17
pfam05625353 PAXNEB PAXNEB protein. PAXNEB or PAX6 neighbour is foun 97.98
KOG3949360 consensus 97.88
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 97.83
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 97.81
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 97.8
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 97.79
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 97.79
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 97.76
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 97.75
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 97.74
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 97.74
PRK10789569 putative multidrug transporter membrane\ATP-binding com 97.74
PRK09700510 D-allose transporter ATP-binding protein; Provisional 97.72
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 97.69
PRK10762501 D-ribose transporter ATP binding protein; Provisional 97.68
PRK13549513 xylose transporter ATP-binding subunit; Provisional 97.67
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 97.65
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.64
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 97.64
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 97.63
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.63
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 97.61
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 97.61
PRK13409 590 putative ATPase RIL; Provisional 97.61
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.61
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 97.6
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 97.59
PRK13695174 putative NTPase; Provisional 97.57
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 97.57
KOG0736 953 consensus 97.55
CHL00060480 atpB ATP synthase CF1 beta subunit 97.55
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 97.51
cd03114148 ArgK-like The function of this protein family is unkown 97.51
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 97.5
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.5
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 97.48
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 97.47
cd03234226 ABCG_White The White subfamily represents ABC transport 97.46
PRK10790593 putative multidrug transporter membrane\ATP-binding com 97.45
PRK10522547 multidrug transporter membrane component/ATP-binding co 97.42
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 97.41
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.41
KOG1969 877 consensus 97.39
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 97.38
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 97.38
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 97.36
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 97.34
PRK11147 632 ABC transporter ATPase component; Reviewed 97.3
PRK03695245 vitamin B12-transporter ATPase; Provisional 97.29
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 97.26
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 97.25
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 97.24
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 97.24
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 97.21
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 97.2
PRK10744257 phosphate transporter subunit; Provisional 97.18
KOG0055 1228 consensus 97.15
PRK03839180 putative kinase; Provisional 97.14
PRK13544208 consensus 97.13
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 97.11
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 97.11
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 97.09
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 97.08
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 97.07
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 97.07
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 97.06
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 97.05
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 97.05
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 97.05
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 97.03
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 96.99
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 96.99
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 96.98
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 96.97
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 96.95
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 96.93
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 96.91
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 96.89
PRK05541176 adenylylsulfate kinase; Provisional 96.88
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 96.8
COG4988559 CydD ABC-type transport system involved in cytochrome b 96.8
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 96.79
PTZ00243 1560 ABC transporter; Provisional 96.76
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 96.76
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 96.66
KOG0054 1381 consensus 96.64
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 96.63
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 97.94
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 97.82
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 97.73
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 97.72
PRK13549513 xylose transporter ATP-binding subunit; Provisional 97.46
PRK09984262 phosphonate/organophosphate ester transporter subunit; 97.35
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 97.23
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 97.23
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 97.17
PRK10762501 D-ribose transporter ATP binding protein; Provisional 97.15
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 97.06
PRK09700510 D-allose transporter ATP-binding protein; Provisional 96.92
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 96.89
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 96.85
PRK11147 632 ABC transporter ATPase component; Reviewed 96.81
PRK04195403 replication factor C large subunit; Provisional 97.76
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 97.61
PRK13542224 consensus 97.36
TIGR02546430 III_secr_ATP type III secretion apparatus H+-transporti 97.34
PRK12402337 replication factor C small subunit 2; Reviewed 97.3
PRK13342417 recombination factor protein RarA; Reviewed 97.25
PRK13341 726 recombination factor protein RarA/unknown domain fusion 97.08
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 96.89
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 96.88
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 96.83
PRK09112352 DNA polymerase III subunit delta'; Validated 97.5
PRK07471363 DNA polymerase III subunit delta'; Validated 97.25
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 97.49
KOG0058716 consensus 96.8
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 97.44
PRK11519720 tyrosine kinase; Provisional 97.28
>TIGR00416 sms DNA repair protein RadA; InterPro: IPR004504 RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>pfam06745 KaiC KaiC Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information