peg_232

peg_232

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:-(230595, 230735)Protein Length:46aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40------
MAATIQLVKEIISLNIPRAIANIDEIDMNPKQKISKYVIPMVNLNS
ccHHHHHHHHHHHccccHHHccHHHHcccHHHHHHHHHHEEEEccc
ccHHHHHHHHHHHccccHHHHccHHccccccccEcEEEEEEEEccc
MAATIQLVKEIISLNipraianideidmnpkqkiskyvipmvnlns
MAATIQLVKEIislnipraianideidmnpkqkiskyvipmvnlns
MAATIQLVKEIISLNIPRAIANIDEIDMNPKQKISKYVIPMVNLNS
****IQLVKEIISLNIPRAIANIDEIDMNPKQKISKYVIPMVNL**
MAATIQLVKEIISLNIPRAIANIDEIDMNPKQKISKYVIPMVNLNS
MAATIQLVKEIISLNIPRAIANIDEIDMNPKQKISKYVIPMVNLNS
oooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooo
oooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiii
iiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATIQLVKEIISLNIPRAIANIDEIDMNPKQKISKYVIPMVNLNS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target46
31512224031 hypothetical protein CKC_02460 [Candidatus Liberibacter 1 2e-04
>gi|315122240|ref|YP_004062729.1| hypothetical protein CKC_02460 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 31 Back     alignment and organism information
 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%)

Query: 16 IPRAIANIDEIDMNPKQKISKYVIPMVNLNS 46
          +PR IANI EI+MNPKQ ISKYVI M+NLNS
Sbjct: 1  MPRTIANIAEINMNPKQIISKYVISMLNLNS 31


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00