254780335

254780335

colicin V production protein

GeneID in NCBI database:8209320Locus tag:CLIBASIA_01100
Protein GI in NCBI database:254780335Protein Accession:YP_003064748.1
Gene range:+(230614, 231084)Protein Length:156aa
Gene description:colicin V production protein
COG prediction:[R] Uncharacterized membrane protein, required for colicin V production
KEGG prediction:colicin V production protein; K03558 membrane protein required for colicin V production
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT4 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTSCWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccHHHHHHHHHHHHHHHc
MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTSCWNlivhesrepawIQKSISKKALDRMGTRLQSIVQ
MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTSCWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ
MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQVAiimtiiplfliilTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTSCWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ
MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTSCWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ
MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTSCWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ
*GITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTSCWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTSCWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ
MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTSCWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ
MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTSCWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target156 colicin V production protein [Candidatus Liberibacter a
315122239158 colicin V production protein [Candidatus Liberibacter s 1 2e-58
222148122199 colicin V production protein [Agrobacterium vitis S4] L 1 1e-17
121601989187 CvpA protein [Bartonella bacilliformis KC583] Length = 1 1e-16
150395952214 colicin V production protein [Sinorhizobium medicae WSM 1 3e-16
15964878199 putative colicin V production transmembrane protein [Si 1 5e-16
158422158232 putative uncharacterized membrane protein [Azorhizobium 1 5e-16
15888419195 colicin V production protein [Agrobacterium tumefaciens 1 5e-16
325292456195 colicin V production protein [Agrobacterium sp. H13-3] 1 8e-16
227821450199 colicin V production protein [Sinorhizobium fredii NGR2 1 1e-15
222085425203 colicin V production protein [Agrobacterium radiobacter 1 7e-15
>gi|315122239|ref|YP_004062728.1| colicin V production protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 158 Back     alignment and organism information
 Score =  228 bits (581), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/155 (70%), Positives = 131/155 (84%)

Query: 1   MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKS 60
           M ITYFDI CFGFI IS++LAM RGI SEMISLTNWI +AI+TRYLY M+  + SE+F++
Sbjct: 1   MEITYFDIICFGFILISAILAMVRGILSEMISLTNWIFSAIITRYLYLMIFAKGSEYFQN 60

Query: 61  KQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTS 120
           KQ+A+I TI+PLFLII T VSILL+I+S PI IRSV LDKILGC FGGVRGLFLL+I T+
Sbjct: 61  KQIALIATIVPLFLIIFTAVSILLRIISKPIYIRSVFLDKILGCLFGGVRGLFLLVIATA 120

Query: 121 CWNLIVHESREPAWIQKSISKKALDRMGTRLQSIV 155
           CWNLIV+ES+EP WIQKSISKK  D M T+L+ I+
Sbjct: 121 CWNLIVNESKEPEWIQKSISKKIFDDMSTKLKKII 155


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148122|ref|YP_002549079.1| colicin V production protein [Agrobacterium vitis S4] Length = 199 Back     alignment and organism information
>gi|121601989|ref|YP_988802.1| CvpA protein [Bartonella bacilliformis KC583] Length = 187 Back     alignment and organism information
>gi|150395952|ref|YP_001326419.1| colicin V production protein [Sinorhizobium medicae WSM419] Length = 214 Back     alignment and organism information
>gi|15964878|ref|NP_385231.1| putative colicin V production transmembrane protein [Sinorhizobium meliloti 1021] Length = 199 Back     alignment and organism information
>gi|158422158|ref|YP_001523450.1| putative uncharacterized membrane protein [Azorhizobium caulinodans ORS 571] Length = 232 Back     alignment and organism information
>gi|15888419|ref|NP_354100.1| colicin V production protein [Agrobacterium tumefaciens str. C58] Length = 195 Back     alignment and organism information
>gi|325292456|ref|YP_004278320.1| colicin V production protein [Agrobacterium sp. H13-3] Length = 195 Back     alignment and organism information
>gi|227821450|ref|YP_002825420.1| colicin V production protein [Sinorhizobium fredii NGR234] Length = 199 Back     alignment and organism information
>gi|222085425|ref|YP_002543955.1| colicin V production protein [Agrobacterium radiobacter K84] Length = 203 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target156 colicin V production protein [Candidatus Liberibacter a
COG1286182 COG1286, CvpA, Uncharacterized membrane protein, requir 8e-10
pfam02674145 pfam02674, Colicin_V, Colicin V production protein 4e-11
>gnl|CDD|31477 COG1286, CvpA, Uncharacterized membrane protein, required for colicin V production [General function prediction only] Back     alignment and domain information
>gnl|CDD|145693 pfam02674, Colicin_V, Colicin V production protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 156 colicin V production protein [Candidatus Liberibacter a
PRK10845162 colicin V production protein; Provisional 100.0
COG1286182 CvpA Uncharacterized membrane protein, required for col 99.97
pfam02674145 Colicin_V Colicin V production protein. Colicin V produ 99.97
pfam02674145 Colicin_V Colicin V production protein. Colicin V produ 97.12
>PRK10845 colicin V production protein; Provisional Back     alignment and domain information
>COG1286 CvpA Uncharacterized membrane protein, required for colicin V production [General function prediction only] Back     alignment and domain information
>pfam02674 Colicin_V Colicin V production protein Back     alignment and domain information
>pfam02674 Colicin_V Colicin V production protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00