254780336

254780336

amidophosphoribosyltransferase

GeneID in NCBI database:8209321Locus tag:CLIBASIA_01105
Protein GI in NCBI database:254780336Protein Accession:YP_003064749.1
Gene range:+(231334, 232800)Protein Length:488aa
Gene description:amidophosphoribosyltransferase
COG prediction:none
KEGG prediction:amidophosphoribosyltransferase (EC:2.4.2.14); K00764 amidophosphoribosyltransferase [EC:2.4.2.14]
SEED prediction:Amidophosphoribosyltransferase (EC 2.4.2.14)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Alanine, aspartate and glutamate metabolism [PATH:las00250]
Subsystem involved in SEED:De Novo Purine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MCSKRNNYKQINEKCGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETLSLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQGAYAMLALTRTKLIATRDPIGIRPLIMGELHGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISIDSYKNPSTSPERMCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKESPVIADIVVPIPDGGVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKHSANRTILAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHLRVASPMVLYPDFYGIDIPDPTALLANKCSSPQEMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPLVDKQSQHNDEELSLIISS
ccccccccccccccccEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEccEEEEEEcccccHHHHHHHHHHccccccEEEEEEEcccccccccccccccEEEcccccEEEEEccEEccHHHHHHHHHHcccEEcccccHHHHHHHHHHHHHccHHHHHHHHHHHccccEEEEEEEccEEEEEEcccccccEEEEEEccEEEEEccccccccccccEEEEcccccEEEEEEccccEEEEEcccccccccccccccccccccccHHHHccccccHHHHHHHHHHHHHccccccEEcccccccHHHHHHHHHHHccHHHHHHccccccccEEccccHHHHHHHHHHHHccccHHccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccHHHHHHcccccHHHHHHHHcccEEEEEcHHHHHHHHHHccccccccccccEEEccccccccccHHHHccHHHHHHHHcc
ccccccccccccHHcccEEccccHHHHHHHHHHHHHHHHccccccEEEEEcccEEEEEcccccHHHHcccHHHHHHcccccEEEEEEEcccccccccccccEEEEcccccEEEEccccHHHHHHHHHHHHHcccEEEccccHHHHHHHHHHcccccHHHHHHHHHHHHcccEEEEEEccccEEEEEccccccEEEEEcccccEEEEEHHHHHHHHccEEEEEccccEEEEEEEccccEEEEEcccccccccccEEHHHHHcccccccEEccEEHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHcccEcccEEEccccccccccccccccccHHHHHEEEcHHHcccccEEEEEccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccccccHHHccccccccHHHHHHHHccccHHHccHHHHHHHHccccccccccccEEEEEccccccccccHHHccHHHHHHHHHcc
mcskrnnykqinekcgvfgilghpdaATLTAIGLHALQhrgqeatgiisfngnkfhserhlglvgdhftkpetlsllpgnmaighvrysttgdqiIRNVQPlfadlqvggiaiahngnftnGLTLRKKLIssgaifqstsDTEVILHLIARSqkngscdrFIDSLRHVQGAYAMLALTRTKLiatrdpigirplimgelhgkpifcsetcaleitgakyirdvENGETIVCELqedgfisidsyknpstspermCIFEYvyfarpdsiisgrSIYVSRRNmgknlakespviadivvpipdggvpaaigyakesgipfeqgiirnhyvgrtfiepshhIRAFGVKLKHSANRTILAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHLRVaspmvlypdfygidipdptallankcsspqemcnfigvdslgflsvdglynaicgiprdpqnpafadhcftgdyptplvdkqsqhndEELSLIISS
MCSKRNNYKQINEKCGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETLSLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQGAYAMLALTRTKLIATRDPIGIRPLIMGELHGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISIDsyknpstspeRMCIFEYVYfarpdsiisGRSIYVSRRNMGKNLAKESPVIADIVVPIPDGGVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKhsanrtilagkrvvliddsivrgTTSVKIVQMIRsagasevhlRVASPMVLYPDFYGIDIPDPTALLANKCSSPQEMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPlvdkqsqhndeelsliiss
MCSKRNNYKQINEKCGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETLSLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQGAYAMLALTRTKLIATRDPIGIRPLIMGELHGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISIDSYKNPSTSPERMCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKESPVIADIVVPIPDGGVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKHSANRTILAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHLRVASPMVLYPDFYGIDIPDPTALLANKCSSPQEMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPLVDKQSQHNDEELSLIISS
***********NEKCGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETLSLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQGAYAMLALTRTKLIATRDPIGIRPLIMGELHGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISIDS*****TSPERMCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKESPVIADIVVPIPDGGVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKHSANRTILAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHLRVASPMVLYPDFYGIDIPDPTALLANKCSSPQEMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPLVDKQSQHNDEELSLI***
********KQINEKCGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETLSLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQGAYAMLALTRTKLIATRDPIGIRPLIMGELHGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISIDSYKNPSTSPERMCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKESPVIADIVVPIPDGGVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKHSANRTILAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHLRVASPMVLYPDFYGIDIPDPTALLANKCSSPQEMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPLVDKQSQHNDEELSLIISS
*****NNYKQINEKCGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETLSLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQGAYAMLALTRTKLIATRDPIGIRPLIMGELHGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISIDSYKNPSTSPERMCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKESPVIADIVVPIPDGGVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKHSANRTILAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHLRVASPMVLYPDFYGIDIPDPTALLANKCSSPQEMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPLVDKQSQHNDEELSLIISS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCSKRNNYKQINEKCGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETLSLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQGAYAMLALTRTKLIATRDPIGIRPLIMGELHGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISIDSYKNPSTSPERMCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKESPVIADIVVPIPDGGVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKHSANRTILAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHLRVASPMVLYPDFYGIDIPDPTALLANKCSSPQEMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPLVDKQSQHNDEELSLIISS
MCSKRNNYKQINEKCGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETLSLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQGAYAMLALTRTKLIATRDPIGIRPLIMGELHGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISIDSYKNPSTSPERMCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKESPVIADIVVPIPDGGVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKHSANRTILAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHLRVASPMVLYPDFYGIDIPDPTALLANKCSSPQEMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPLVDKQSQHNDEELSLIISS
MCSKRNNYKQINEKCGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETLSLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQGAYAMLALTRTKLIATRDPIGIRPLIMGELHGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISIDSYKNPSTSPERMCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKESPVIADIVVPIPDGGVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKHSANRTILAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHLRVASPMVLYPDFYGIDIPDPTALLANKCSSPQEMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPLVDKQSQHNDEELSLIISS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target488 amidophosphoribosyltransferase [Candidatus Liberibacter
254780943 608 glucosamine--fructose-6-phosphate aminotransferase 2e-15
>gi|254780943|ref|YP_003065356.1| glucosamine--fructose-6-phosphate aminotransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 608 Back     alignment
 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 101/216 (46%), Gaps = 17/216 (7%)

Query: 15  CGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETL 74
           CG+ GI+G           L  L++RG +++G+ +    K    R  G + +   K    
Sbjct: 2   CGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGKLSE-LEKELNK 60

Query: 75  SLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGA 134
             L GN+ I H R++T G     N  P   +    GIA+ HNG   N   L+K+  SS  
Sbjct: 61  KPLKGNIGIAHTRWATHGLPNKENSHPHCIE----GIAVTHNGIIENFSRLKKEHFSSQQ 116

Query: 135 IFQSTSDTEVILHLIARSQKNGSCDR--FIDSLRHVQGAYAMLALTR----TKLIATRDP 188
           +F + +DTEVI  L+ +  KNGS  +      ++ + G+Y++  +      + ++A + P
Sbjct: 117 VFLTETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGP 176

Query: 189 IGIRPLIMGELHGKPIFCSETCALEITGAK--YIRD 222
               PLI+G   G+    S+  AL +   K  Y+ D
Sbjct: 177 ----PLIIGHGEGEMFVGSDVTALTLLTDKVTYMED 208

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target488 amidophosphoribosyltransferase [Candidatus Liberibacter
315122238495 amidophosphoribosyltransferase [Candidatus Liberibacter 1 0.0
222085424494 amidophosphoribosyltransferase [Agrobacterium radiobact 1 0.0
227821449496 amidophosphoribosyltransferase [Sinorhizobium fredii NG 1 0.0
153007905496 amidophosphoribosyltransferase [Ochrobactrum anthropi A 1 0.0
150395951496 amidophosphoribosyltransferase [Sinorhizobium medicae W 1 0.0
15964877496 amidophosphoribosyltransferase [Sinorhizobium meliloti 1 0.0
190891113496 glutamine phosphoribosylpyrophosphate amidotransferase 1 0.0
327187992496 amidophosphoribosyltransferase [Rhizobium etli CNPAF512 1 0.0
239831318506 amidophosphoribosyltransferase [Ochrobactrum intermediu 1 0.0
209548645496 amidophosphoribosyltransferase [Rhizobium leguminosarum 1 0.0
>gi|315122238|ref|YP_004062727.1| amidophosphoribosyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 495 Back     alignment and organism information
 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/486 (88%), Positives = 461/486 (94%)

Query: 3   SKRNNYKQINEKCGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLG 62
           S R N  QINEKCGVFGILG+PDAATLTAIGLHALQHRGQE+ GIISFNGNKFHSE++LG
Sbjct: 10  SNRKNCNQINEKCGVFGILGNPDAATLTAIGLHALQHRGQESAGIISFNGNKFHSEKYLG 69

Query: 63  LVGDHFTKPETLSLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNG 122
           LVGDHFT PETLS LPGNMAIGHVRYSTTGD+IIRNVQPLFADLQ GGIAIAHNGNFTNG
Sbjct: 70  LVGDHFTNPETLSFLPGNMAIGHVRYSTTGDKIIRNVQPLFADLQAGGIAIAHNGNFTNG 129

Query: 123 LTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQGAYAMLALTRTKL 182
           L+LRKKLISSGAIFQSTSDTEV+LHLIARSQKNGS DRFIDSL++VQGAYAMLALTRTKL
Sbjct: 130 LSLRKKLISSGAIFQSTSDTEVVLHLIARSQKNGSGDRFIDSLQYVQGAYAMLALTRTKL 189

Query: 183 IATRDPIGIRPLIMGELHGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISID 242
           IATRDP GIRPLIMGELHGKP+FCSETCAL+ITGA+Y+RDVENGETIVCELQE+G ISI+
Sbjct: 190 IATRDPTGIRPLIMGELHGKPVFCSETCALDITGAQYVRDVENGETIVCELQENGSISIN 249

Query: 243 SYKNPSTSPERMCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKESPVIADIVVPIPDG 302
           SYKN S  PERMC+FEYVYFARPDSI+SGRSIYVSR+NMGKNLAKESPV ADIVVPIPDG
Sbjct: 250 SYKNSSVLPERMCMFEYVYFARPDSIVSGRSIYVSRQNMGKNLAKESPVAADIVVPIPDG 309

Query: 303 GVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKHSANRTILAGKRVVL 362
           GVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSH IR+FGVKLKHSANRTILAGKR+VL
Sbjct: 310 GVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHQIRSFGVKLKHSANRTILAGKRIVL 369

Query: 363 IDDSIVRGTTSVKIVQMIRSAGASEVHLRVASPMVLYPDFYGIDIPDPTALLANKCSSPQ 422
           IDDSIVRGTTSVKIVQMIR+AGA EVHLRVASPMVLYPDFYGIDIPDP  LLAN+ SS Q
Sbjct: 370 IDDSIVRGTTSVKIVQMIRNAGAKEVHLRVASPMVLYPDFYGIDIPDPNTLLANQYSSLQ 429

Query: 423 EMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPLVDKQSQHNDEEL 482
           EMC+FIGVDSLGFLSVDGLY AICG PRDP+NPAFADHCFTGDYPTPL+DK+ QH+ EEL
Sbjct: 430 EMCDFIGVDSLGFLSVDGLYEAICGSPRDPKNPAFADHCFTGDYPTPLLDKKLQHDAEEL 489

Query: 483 SLIISS 488
           S+I+SS
Sbjct: 490 SMIVSS 495


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085424|ref|YP_002543954.1| amidophosphoribosyltransferase [Agrobacterium radiobacter K84] Length = 494 Back     alignment and organism information
>gi|227821449|ref|YP_002825419.1| amidophosphoribosyltransferase [Sinorhizobium fredii NGR234] Length = 496 Back     alignment and organism information
>gi|153007905|ref|YP_001369120.1| amidophosphoribosyltransferase [Ochrobactrum anthropi ATCC 49188] Length = 496 Back     alignment and organism information
>gi|150395951|ref|YP_001326418.1| amidophosphoribosyltransferase [Sinorhizobium medicae WSM419] Length = 496 Back     alignment and organism information
>gi|15964877|ref|NP_385230.1| amidophosphoribosyltransferase [Sinorhizobium meliloti 1021] Length = 496 Back     alignment and organism information
>gi|190891113|ref|YP_001977655.1| glutamine phosphoribosylpyrophosphate amidotransferase [Rhizobium etli CIAT 652] Length = 496 Back     alignment and organism information
>gi|327187992|gb|EGE55222.1| amidophosphoribosyltransferase [Rhizobium etli CNPAF512] Length = 496 Back     alignment and organism information
>gi|239831318|ref|ZP_04679647.1| amidophosphoribosyltransferase [Ochrobactrum intermedium LMG 3301] Length = 506 Back     alignment and organism information
>gi|209548645|ref|YP_002280562.1| amidophosphoribosyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 496 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target488 amidophosphoribosyltransferase [Candidatus Liberibacter
PRK09123479 PRK09123, PRK09123, amidophosphoribosyltransferase; Pro 0.0
TIGR01134442 TIGR01134, purF, amidophosphoribosyltransferase 1e-168
PRK07272484 PRK07272, PRK07272, amidophosphoribosyltransferase; Pro 1e-160
PLN02440479 PLN02440, PLN02440, amidophosphoribosyltransferase 1e-156
PRK05793469 PRK05793, PRK05793, amidophosphoribosyltransferase; Pro 1e-155
PRK08525445 PRK08525, PRK08525, amidophosphoribosyltransferase; Pro 1e-154
PRK07631475 PRK07631, PRK07631, amidophosphoribosyltransferase; Pro 1e-138
KOG0572474 KOG0572, KOG0572, KOG0572, Glutamine phosphoribosylpyro 1e-137
PRK07349500 PRK07349, PRK07349, amidophosphoribosyltransferase; Pro 1e-135
PRK06781471 PRK06781, PRK06781, amidophosphoribosyltransferase; Pro 1e-133
PRK07847510 PRK07847, PRK07847, amidophosphoribosyltransferase; Pro 1e-129
PRK09246501 PRK09246, PRK09246, amidophosphoribosyltransferase; Pro 1e-107
PRK06388474 PRK06388, PRK06388, amidophosphoribosyltransferase; Pro 1e-106
PRK08341442 PRK08341, PRK08341, amidophosphoribosyltransferase; Pro 1e-103
COG0034470 COG0034, PurF, Glutamine phosphoribosylpyrophosphate am 1e-178
cd00715252 cd00715, GPATase_N, Glutamine amidotransferases class-I 1e-95
COG0367542 COG0367, AsnB, Asparagine synthase (glutamine-hydrolyzi 2e-19
TIGR01536467 TIGR01536, asn_synth_AEB, asparagine synthase (glutamin 4e-16
PTZ00295 640 PTZ00295, PTZ00295, glucosamine-fructose-6-phosphate am 5e-14
cd00352220 cd00352, Gn_AT_II, Glutamine amidotransferases class-II 1e-41
COG0449 597 COG0449, GlmS, Glucosamine 6-phosphate synthetase, cont 9e-27
pfam00310223 pfam00310, GATase_2, Glutamine amidotransferases class- 7e-26
cd00714215 cd00714, GFAT, Glutamine amidotransferases class-II (Gn 1e-24
TIGR01135 607 TIGR01135, glmS, glucosamine--fructose-6-phosphate amin 3e-22
cd00712220 cd00712, AsnB, Glutamine amidotransferases class-II (GA 5e-20
PRK00331 604 PRK00331, PRK00331, glucosamine--fructose-6-phosphate a 3e-19
cd01907249 cd01907, GlxB, Glutamine amidotransferases class-II (Gn 2e-15
PRK09431 554 PRK09431, asnB, asparagine synthetase B; Provisional 7e-15
TIGR03108 628 TIGR03108, eps_aminotran_1, exosortase 1 system-associa 3e-11
PTZ00077 586 PTZ00077, PTZ00077, asparagine synthetase-like protein; 3e-11
KOG1268 670 KOG1268, KOG1268, KOG1268, Glucosamine 6-phosphate synt 4e-11
PTZ00394 670 PTZ00394, PTZ00394, glucosamine-fructose-6-phosphate am 2e-10
KOG0571 543 KOG0571, KOG0571, KOG0571, Asparagine synthase (glutami 1e-09
TIGR03104 589 TIGR03104, trio_amidotrans, asparagine synthase family 4e-09
PLN02549 578 PLN02549, PLN02549, asparagine synthase (glutamine-hydr 3e-08
pfam00156123 pfam00156, Pribosyltran, Phosphoribosyl transferase dom 4e-12
COG0503179 COG0503, Apt, Adenine/guanine phosphoribosyltransferase 4e-06
COG0856203 COG0856, COG0856, Orotate phosphoribosyltransferase hom 3e-04
PRK00455202 PRK00455, pyrE, orotate phosphoribosyltransferase; Vali 0.002
COG1926220 COG1926, COG1926, Predicted phosphoribosyltransferases 0.003
PLN02981 680 PLN02981, PLN02981, glucosamine:fructose-6-phosphate am 6e-08
cd01908257 cd01908, YafJ, Glutamine amidotransferases class-II (Gn 2e-05
COG0067371 COG0067, GltB, Glutamate synthase domain 1 [Amino acid 1e-04
PRK09162181 PRK09162, PRK09162, hypoxanthine-guanine phosphoribosyl 2e-04
PRK06031233 PRK06031, PRK06031, phosphoribosyltransferase; Provisio 0.004
>gnl|CDD|181660 PRK09123, PRK09123, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|162218 TIGR01134, purF, amidophosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|180913 PRK07272, PRK07272, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178059 PLN02440, PLN02440, amidophosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|180262 PRK05793, PRK05793, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181456 PRK08525, PRK08525, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181061 PRK07631, PRK07631, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|35792 KOG0572, KOG0572, KOG0572, Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|180940 PRK07349, PRK07349, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|136048 PRK06781, PRK06781, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181143 PRK07847, PRK07847, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181724 PRK09246, PRK09246, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|102351 PRK06388, PRK06388, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181395 PRK08341, PRK08341, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30383 COG0034, PurF, Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|48479 cd00715, GPATase_N, Glutamine amidotransferases class-II (GN-AT)_GPAT- type Back     alignment and domain information
>gnl|CDD|30716 COG0367, AsnB, Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162406 TIGR01536, asn_synth_AEB, asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>gnl|CDD|185544 PTZ00295, PTZ00295, glucosamine-fructose-6-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|48475 cd00352, Gn_AT_II, Glutamine amidotransferases class-II (GATase) Back     alignment and domain information
>gnl|CDD|30798 COG0449, GlmS, Glucosamine 6-phosphate synthetase, contains amidotransferase and phosphosugar isomerase domains [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144048 pfam00310, GATase_2, Glutamine amidotransferases class-II Back     alignment and domain information
>gnl|CDD|48478 cd00714, GFAT, Glutamine amidotransferases class-II (Gn-AT)_GFAT-type Back     alignment and domain information
>gnl|CDD|130205 TIGR01135, glmS, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) Back     alignment and domain information
>gnl|CDD|48476 cd00712, AsnB, Glutamine amidotransferases class-II (GATase) asparagine synthase_B type Back     alignment and domain information
>gnl|CDD|178980 PRK00331, PRK00331, glucosamine--fructose-6-phosphate aminotransferase; Reviewed Back     alignment and domain information
>gnl|CDD|73286 cd01907, GlxB, Glutamine amidotransferases class-II (Gn-AT)_GlxB-type Back     alignment and domain information
>gnl|CDD|181851 PRK09431, asnB, asparagine synthetase B; Provisional Back     alignment and domain information
>gnl|CDD|132152 TIGR03108, eps_aminotran_1, exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>gnl|CDD|185431 PTZ00077, PTZ00077, asparagine synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|36482 KOG1268, KOG1268, KOG1268, Glucosamine 6-phosphate synthetases, contain amidotransferase and phosphosugar isomerase domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|173585 PTZ00394, PTZ00394, glucosamine-fructose-6-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|35791 KOG0571, KOG0571, KOG0571, Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163136 TIGR03104, trio_amidotrans, asparagine synthase family amidotransferase Back     alignment and domain information
>gnl|CDD|178164 PLN02549, PLN02549, asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>gnl|CDD|143924 pfam00156, Pribosyltran, Phosphoribosyl transferase domain Back     alignment and domain information
>gnl|CDD|30849 COG0503, Apt, Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|31197 COG0856, COG0856, Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179036 PRK00455, pyrE, orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>gnl|CDD|32109 COG1926, COG1926, Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|178562 PLN02981, PLN02981, glucosamine:fructose-6-phosphate aminotransferase Back     alignment and domain information
>gnl|CDD|48481 cd01908, YafJ, Glutamine amidotransferases class-II (Gn-AT)_YafJ-type Back     alignment and domain information
>gnl|CDD|30416 COG0067, GltB, Glutamate synthase domain 1 [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181675 PRK09162, PRK09162, hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|180357 PRK06031, PRK06031, phosphoribosyltransferase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 488 amidophosphoribosyltransferase [Candidatus Liberibacter
PRK09123480 amidophosphoribosyltransferase; Provisional 100.0
PRK07631475 amidophosphoribosyltransferase; Provisional 100.0
PRK07272484 amidophosphoribosyltransferase; Provisional 100.0
PRK07349495 amidophosphoribosyltransferase; Provisional 100.0
PRK06781471 amidophosphoribosyltransferase; Provisional 100.0
PRK05793472 amidophosphoribosyltransferase; Provisional 100.0
COG0034470 PurF Glutamine phosphoribosylpyrophosphate amidotransfe 100.0
TIGR01134467 purF amidophosphoribosyltransferase; InterPro: IPR00585 100.0
PRK06388474 amidophosphoribosyltransferase; Provisional 100.0
PRK09246503 amidophosphoribosyltransferase; Provisional 100.0
PRK07847489 amidophosphoribosyltransferase; Provisional 100.0
PRK08525445 amidophosphoribosyltransferase; Provisional 100.0
PRK08341442 amidophosphoribosyltransferase; Provisional 100.0
KOG0572474 consensus 100.0
cd00715252 GPATase_N Glutamine amidotransferases class-II (GN-AT)_ 100.0
TIGR01135 628 glmS glucosamine--fructose-6-phosphate aminotransferase 100.0
COG0449 597 GlmS Glucosamine 6-phosphate synthetase, contains amido 100.0
KOG1268 670 consensus 99.96
cd01907249 GlxB Glutamine amidotransferases class-II (Gn-AT)_GlxB- 100.0
cd00714215 GFAT Glutamine amidotransferases class-II (Gn-AT)_GFAT- 100.0
pfam00310223 GATase_2 Glutamine amidotransferases class-II. 100.0
PRK00331 604 glucosamine--fructose-6-phosphate aminotransferase; Rev 100.0
PTZ00295 691 glucosamine-fructose-6-phosphate aminotransferase; Prov 100.0
cd00352220 Gn_AT_II Glutamine amidotransferases class-II (GATase). 100.0
TIGR01536 646 asn_synth_AEB asparagine synthase (glutamine-hydrolyzin 100.0
cd00712220 AsnB Glutamine amidotransferases class-II (GATase) aspa 100.0
cd03766181 Gn_AT_II_novel Gn_AT_II_novel. This asparagine synthase 99.96
cd01908257 YafJ Glutamine amidotransferases class-II (Gn-AT)_YafJ- 99.87
TIGR03442251 conserved hypothetical protein TIGR03442. Members of th 99.79
COG0121252 Predicted glutamine amidotransferase [General function 99.62
KOG0573520 consensus 99.09
TIGR03104 589 trio_amidotrans asparagine synthase family amidotransfe 100.0
TIGR03108 628 eps_aminotran_1 exosortase 1 system-associated amidotra 100.0
PRK09431 555 asnB asparagine synthetase B; Provisional 100.0
PTZ00077 610 asparagine synthetase; Provisional 100.0
COG0367 542 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino 100.0
KOG0571 543 consensus 99.91
cd01909199 betaLS_CarA_N Glutamine amidotransferases class-II (GAT 99.86
COG0067371 GltB Glutamate synthase domain 1 [Amino acid transport 99.83
PRK11750 1483 gltB glutamate synthase subunit alpha; Provisional 99.78
cd01910224 Wali7 This domain is present in Wali7, a protein of unk 98.71
cd00713413 GltS Glutamine amidotransferases class-II (Gn-AT), glut 99.74
KOG0399 2142 consensus 99.04
pfam00156123 Pribosyltran Phosphoribosyl transferase domain. This fa 99.12
PRK11595227 gluconate periplasmic binding protein; Provisional 98.94
PRK06031233 phosphoribosyltransferase; Provisional 98.63
COG1926220 Predicted phosphoribosyltransferases [General function 98.49
COG1040225 ComFC Predicted amidophosphoribosyltransferases [Genera 98.43
PRK07322178 adenine phosphoribosyltransferase; Provisional 98.42
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Provisi 98.37
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and rela 98.22
PRK12560184 adenine phosphoribosyltransferase; Provisional 98.17
PRK02277201 orotate phosphoribosyltransferase-like protein; Provisi 98.16
PRK08558238 adenine phosphoribosyltransferase; Provisional 98.12
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleotide 98.06
PRK09219189 xanthine phosphoribosyltransferase; Validated 98.03
PRK03675279 consensus 98.01
PRK05205176 bifunctional pyrimidine regulatory protein PyrR uracil 97.99
PRK00934286 ribose-phosphate pyrophosphokinase; Provisional 97.98
PRK02304174 adenine phosphoribosyltransferase; Provisional 97.96
PTZ00271211 hypoxanthine-guanine phosphoribosyltransferase; Provisi 97.95
PRK13810187 orotate phosphoribosyltransferase; Provisional 97.91
PRK06827381 phosphoribosylpyrophosphate synthetase; Provisional 97.9
COG0634178 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nuc 97.9
PRK01132286 consensus 97.86
PRK13812174 orotate phosphoribosyltransferase; Provisional 97.75
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisional 97.71
TIGR01090175 apt adenine phosphoribosyltransferase; InterPro: IPR005 97.41
PRK09213274 purine operon repressor; Provisional 97.39
PRK09177156 xanthine-guanine phosphoribosyltransferase; Validated 97.3
TIGR00201207 comF comF family protein; InterPro: IPR005222 Proteins 97.24
PTZ00149231 hypoxanthine phosphoribosyltransferase; Provisional 96.87
COG2065179 PyrR Pyrimidine operon attenuation protein/uracil phosp 96.58
TIGR01743269 purR_Bsub pur operon repressor; InterPro: IPR010078 Thi 96.34
TIGR01251316 ribP_PPkin ribose-phosphate pyrophosphokinase; InterPro 96.34
COG2236192 Predicted phosphoribosyltransferases [General function 96.33
TIGR01744191 XPRTase xanthine phosphoribosyltransferase; InterPro: I 94.61
TIGR01203183 HGPRTase hypoxanthine phosphoribosyltransferase; InterP 94.46
KOG1448316 consensus 94.18
KOG1712183 consensus 93.62
TIGR01367205 pyrE_Therm orotate phosphoribosyltransferase; InterPro: 93.46
PRK12562334 ornithine carbamoyltransferase subunit F; Provisional 91.45
PRK02255341 putrescine carbamoyltransferase; Provisional 91.01
PRK02269321 ribose-phosphate pyrophosphokinase; Provisional 98.19
PRK00455200 pyrE orotate phosphoribosyltransferase; Validated 98.11
PRK02458323 ribose-phosphate pyrophosphokinase; Provisional 98.02
PRK13809206 orotate phosphoribosyltransferase; Provisional 98.01
PRK04117309 consensus 97.98
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 97.95
PRK13811170 orotate phosphoribosyltransferase; Provisional 97.92
PRK02270327 consensus 97.91
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 97.91
PRK02039316 consensus 97.89
PRK01506317 consensus 97.88
PRK01999311 consensus 97.86
PRK00553340 ribose-phosphate pyrophosphokinase; Provisional 97.86
PRK05500478 bifunctional orotidine 5'-phosphate decarboxylase/orota 97.86
PRK05259310 consensus 97.85
PRK04554327 consensus 97.84
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 97.81
PRK05038315 consensus 97.81
PRK02812331 ribose-phosphate pyrophosphokinase; Provisional 97.8
COG0462314 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide 97.75
COG0461201 PyrE Orotate phosphoribosyltransferase [Nucleotide tran 97.41
PTZ00145443 phosphoribosylpyrophosphate synthetase; Provisional 97.4
TIGR00336187 pyrE orotate phosphoribosyltransferase; InterPro: IPR00 94.07
pfam09147201 DUF1933 Domain of unknown function (DUF1933). Members o 97.04
KOG3367216 consensus 94.93
PRK00129208 upp uracil phosphoribosyltransferase; Reviewed 93.47
PRK01506317 consensus 92.37
PRK00934286 ribose-phosphate pyrophosphokinase; Provisional 93.25
PRK02812331 ribose-phosphate pyrophosphokinase; Provisional 93.15
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 92.71
PRK04117309 consensus 92.28
PRK05259310 consensus 92.27
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07272 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06781 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05793 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01134 purF amidophosphoribosyltransferase; InterPro: IPR005854 Purine nucleotides are synthesised both via the de novo pathway and via the salvage pathway and are vital for cell functions and cell proliferation through DNA and RNA syntheses and ATP energy supply Back     alignment and domain information
>PRK06388 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09246 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07847 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08525 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08341 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG0572 consensus Back     alignment and domain information
>cd00715 GPATase_N Glutamine amidotransferases class-II (GN-AT)_GPAT- type Back     alignment and domain information
>TIGR01135 glmS glucosamine--fructose-6-phosphate aminotransferase, isomerizing; InterPro: IPR005855 Glucosamine:fructose-6-phosphate aminotransferase (2 Back     alignment and domain information
>COG0449 GlmS Glucosamine 6-phosphate synthetase, contains amidotransferase and phosphosugar isomerase domains [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1268 consensus Back     alignment and domain information
>cd01907 GlxB Glutamine amidotransferases class-II (Gn-AT)_GlxB-type Back     alignment and domain information
>cd00714 GFAT Glutamine amidotransferases class-II (Gn-AT)_GFAT-type Back     alignment and domain information
>pfam00310 GATase_2 Glutamine amidotransferases class-II Back     alignment and domain information
>PRK00331 glucosamine--fructose-6-phosphate aminotransferase; Reviewed Back     alignment and domain information
>PTZ00295 glucosamine-fructose-6-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd00352 Gn_AT_II Glutamine amidotransferases class-II (GATase) Back     alignment and domain information
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing); InterPro: IPR006426 These sequences represent glutamine-hydrolysing asparagine synthase Back     alignment and domain information
>cd00712 AsnB Glutamine amidotransferases class-II (GATase) asparagine synthase_B type Back     alignment and domain information
>cd03766 Gn_AT_II_novel Gn_AT_II_novel Back     alignment and domain information
>cd01908 YafJ Glutamine amidotransferases class-II (Gn-AT)_YafJ-type Back     alignment and domain information
>TIGR03442 conserved hypothetical protein TIGR03442 Back     alignment and domain information
>COG0121 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>KOG0573 consensus Back     alignment and domain information
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase Back     alignment and domain information
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>PRK09431 asnB asparagine synthetase B; Provisional Back     alignment and domain information
>PTZ00077 asparagine synthetase; Provisional Back     alignment and domain information
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0571 consensus Back     alignment and domain information
>cd01909 betaLS_CarA_N Glutamine amidotransferases class-II (GATase) asparagine synthase_betaLS-type Back     alignment and domain information
>COG0067 GltB Glutamate synthase domain 1 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>cd01910 Wali7 This domain is present in Wali7, a protein of unknown function, expressed in wheat and induced by aluminum Back     alignment and domain information
>cd00713 GltS Glutamine amidotransferases class-II (Gn-AT), glutamate synthase (GltS)-type Back     alignment and domain information
>KOG0399 consensus Back     alignment and domain information
>pfam00156 Pribosyltran Phosphoribosyl transferase domain Back     alignment and domain information
>PRK11595 gluconate periplasmic binding protein; Provisional Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12560 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09219 xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK03675 consensus Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13810 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01132 consensus Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase; InterPro: IPR005764 Adenine phosphoribosyltransferase (APRTase, 2 Back     alignment and domain information
>PRK09213 purine operon repressor; Provisional Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>TIGR00201 comF comF family protein; InterPro: IPR005222 Proteins in this family are found in bacterial species which posses systems for natural transformation with exogenous DNA (eg Bacillus subtilis, Haemophilus influenzae), and also species without these systems (eg Escherichia coli) Back     alignment and domain information
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01743 purR_Bsub pur operon repressor; InterPro: IPR010078 This entry represents the pur operon repressor PurR of low-GC Gram-positive bacteria Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase; InterPro: IPR005946 Synonyms: phosphoribosylpyrophosphate synthetase Phosphoribosyldiphosphate synthetase (PRPPsase, 2 Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>TIGR01744 XPRTase xanthine phosphoribosyltransferase; InterPro: IPR010079 This entry represent a xanthine-specific phosphoribosyltransferase of Bacillus subtilis and closely related proteins from other species, mostly from other Gram-positive bacteria Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase; InterPro: IPR005904 Phosphoribosyltransferases (PRT) are enzymes that catalyze the synthesis of beta-n-5'-monophosphates from phosphoribosylpyrophosphate (PRPP) and an enzyme specific amine Back     alignment and domain information
>KOG1448 consensus Back     alignment and domain information
>KOG1712 consensus Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase; InterPro: IPR006273 This group of sequences are a distinct clade of orotate phosphoribosyltransferases Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK13809 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK04117 consensus Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02270 consensus Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK02039 consensus Back     alignment and domain information
>PRK01506 consensus Back     alignment and domain information
>PRK01999 consensus Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>PRK05259 consensus Back     alignment and domain information
>PRK04554 consensus Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK05038 consensus Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase; InterPro: IPR004467 Orotate phosphoribosyl transferase (OPRTase) is involved in the biosynthesis of pyrimidine nucleotides Back     alignment and domain information
>pfam09147 DUF1933 Domain of unknown function (DUF1933) Back     alignment and domain information
>KOG3367 consensus Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PRK01506 consensus Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK04117 consensus Back     alignment and domain information
>PRK05259 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target488 amidophosphoribosyltransferase [Candidatus Liberibacter
1gph_1465 Structure Of The Allosteric Regulatory Enzyme Of Pu 1e-122
1ao0_A459 Glutamine Phosphoribosylpyrophosphate (Prpp) Amidot 1e-121
1ecf_A504 Escherichia Coli Glutamine Phosphoribosylpyrophosph 1e-113
2j6h_A 608 E. Coli Glucosamine-6-P Synthase In Complex With Gl 1e-31
1jxa_A 608 Glucosamine 6-Phosphate Synthase With Glucose 6-Pho 1e-31
1xff_A240 Glutaminase Domain Of Glucosamine 6-Phosphate Synth 1e-31
1ct9_A 553 Crystal Structure Of Asparagine Synthetase B From E 9e-06
>gi|576138|pdb|1GPH|1 Chain 1, Structure Of The Allosteric Regulatory Enzyme Of Purine Biosynthesis Length = 465 Back     alignment and structure
 Score =  442 bits (1136), Expect = e-122,   Method: Composition-based stats.
 Identities = 214/468 (45%), Positives = 297/468 (63%), Gaps = 9/468 (1%)

Query: 15  CGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETL 74
           CGVFGI GH +A  +T  GLH+LQHRGQE  GI++ +G K  + +  GL+ + F   E L
Sbjct: 1   CGVFGIWGHEEAPQITYYGLHSLQHRGQEGAGIVATDGEKLTAHKGQGLITEVFQNGE-L 59

Query: 75  SLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQV-GGIAIAHNGNFTNGLTLRKKLISSG 133
           S + G  AIGHVRY+T G     NVQPL    Q  G +A+AHNGN  N   L+++L + G
Sbjct: 60  SKVKGKGAIGHVRYATAGGGGYENVQPLLFRSQNNGSLALAHNGNLVNATQLKQQLENQG 119

Query: 134 AIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQGAYAMLALTRTKLIATRDPIGIRP 193
           +IFQ++SDTEV+ HLI RS      D+  +SL  ++GAYA L +T T++I   DP G+RP
Sbjct: 120 SIFQTSSDTEVLAHLIKRSGHFTLKDQIKNSLSMLKGAYAFLIMTETEMIVALDPNGLRP 179

Query: 194 LIMGELHGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISIDSYKNPSTSPER 253
           L +G +    +  SETCA ++ GA Y+R+VE GE ++   +                   
Sbjct: 180 LSIGMMGDAYVVASETCAFDVVGATYLREVEPGEMLIINDEGMKSERFSM-----NINRS 234

Query: 254 MCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKESPVIADIVVPIPDGGVPAAIGYAKE 313
           +C  EY+YF+RPDS I G +++ +R+N+GK LA+ES V AD+V  +PD  + AAIGYA+ 
Sbjct: 235 ICSMEYIYFSRPDSNIDGINVHSARKNLGKMLAQESAVEADVVTGVPDSSISAAIGYAEA 294

Query: 314 SGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKHSANRTILAGKRVVLIDDSIVRGTTS 373
           +GIP+E G+I+N YVGRTFI+PS  +R  GV++K SA R ++ GKRVV++DDSIVRGTTS
Sbjct: 295 TGIPYELGLIKNRYVGRTFIQPSQALREQGVRMKLSAVRGVVEGKRVVMVDDSIVRGTTS 354

Query: 374 VKIVQMIRSAGASEVHLRVASPMVLYPDFYGIDIPDPTALLANKCSSPQEMCNFIGVDSL 433
            +IV M+R AGA+EVH++++SP + +P FYGID      L+A+   S  E+   IG D+L
Sbjct: 355 RRIVTMLREAGATEVHVKISSPPIAHPCFYGIDTSTHEELIAS-SHSVDEIRQEIGADTL 413

Query: 434 GFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPLVDKQSQHNDEE 481
            FLSV+GL   I G   D  N      CFTG YPT +       + +E
Sbjct: 414 SFLSVEGLLKGI-GRKYDDSNCGQCLACFTGKYPTEIYQDTVLPHVKE 460


>gi|2624597|pdb|1AO0|A Chain A, Glutamine Phosphoribosylpyrophosphate (Prpp) Amidotransferase From B. Subtilis Complexed With Adp And Gmp Length = 459 Back     alignment and structure
>gi|1943557|pdb|1ECF|A Chain A, Escherichia Coli Glutamine Phosphoribosylpyrophosphate (Prpp) Amidotransferase Length = 504 Back     alignment and structure
>gi|118138642|pdb|2J6H|A Chain A, E. Coli Glucosamine-6-P Synthase In Complex With Glucose-6p And 5-Oxo-L-Norleucine Length = 608 Back     alignment and structure
>gi|17942686|pdb|1JXA|A Chain A, Glucosamine 6-Phosphate Synthase With Glucose 6-Phosphate Length = 608 Back     alignment and structure
>gi|55670838|pdb|1XFF|A Chain A, Glutaminase Domain Of Glucosamine 6-Phosphate Synthase Complexed With Glutamate Length = 240 Back     alignment and structure
>gi|6730195|pdb|1CT9|A Chain A, Crystal Structure Of Asparagine Synthetase B From Escherichia Coli Length = 553 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target488 amidophosphoribosyltransferase [Candidatus Liberibacter
1ecf_A504 Glutamine phosphoribosylpyrophosphate amidotransferase; 1e-132
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransferase; 1e-118
2bpl_A 608 Glucosamine--fructose-6-phosphate aminotransferase [iso 3e-48
1xff_A240 D-fructose-6-, glucosamine--fructose-6-phosphate aminot 1e-39
1te5_A257 Conserved hypothetical protein; glutamine amidotransfer 1e-29
3mdn_A274 Glutamine amidotransferases class-II domain prote; stru 1e-25
1o57_A291 PUR operon repressor; purine operon repressor, helix-tu 1e-27
1wd5_A208 Hypothetical protein TT1426; structural genomics, riken 7e-21
1vch_A175 Phosphoribosyltransferase-related protein; structural g 2e-15
2wns_A205 Orotate phosphoribosyltransferase; alternative splicing 2e-14
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabolism, 8e-12
1vdm_A153 Purine phosphoribosyltransferase; structural genomics, 2e-06
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; purin 7e-06
2jky_A213 Hypoxanthine-guanine phosphoribosyltransferase; nucleus 8e-06
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardia lam 2e-05
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyl 6e-05
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleotide b 4e-04
1j7j_A178 HPRT, hypoxanthine phosphoribosyltransferase; glycosylt 4e-04
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthine-gu 5e-04
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransferase; 7e-04
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural geno 7e-04
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxantine-gua 9e-04
1w30_A201 PYRR bifunctional protein; transferase, glycosyltransfe 0.001
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; protein 0.003
1jgt_A513 Beta-lactam synthetase; asparagine synthetase, clavulan 3e-20
3dah_A319 Ribose-phosphate pyrophosphokinase; seattle structural 5e-13
1ct9_A 553 Asparagine synthetase B; amidotransferase, substrate ch 5e-13
1q15_A503 CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lac 2e-12
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransferase; purine biosynthesis, glycosyltransferase, glutamine amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Length = 504 Back     alignment and structure
 Score =  468 bits (1205), Expect = e-132
 Identities = 182/490 (37%), Positives = 258/490 (52%), Gaps = 31/490 (6%)

Query: 15  CGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNK-FHSERHLGLVGDHFTKPET 73
           CG+ GI G           L  LQHRGQ+A GII+ + N  F   +  GLV D F +   
Sbjct: 1   CGIVGIAGVMPVNQSIYDALTVLQHRGQDAAGIITIDANNCFRLRKANGLVSDVF-EARH 59

Query: 74  LSLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISS- 132
           +  L GNM IGHVRY T G       QP + +    GI +AHNGN TN   LRKKL    
Sbjct: 60  MQRLQGNMGIGHVRYPTAGSSSASEAQPFYVNSP-YGITLAHNGNLTNAHELRKKLFEEK 118

Query: 133 GAIFQSTSDTEVILHLIARSQKNGSC---------DRFIDSLRHVQGAYAMLA-LTRTKL 182
                +TSD+E++L++ A    N                 + R ++GAYA +A +    +
Sbjct: 119 RRHINTTSDSEILLNIFASELDNFRHYPLEADNIFAAIAATNRLIRGAYACVAMIIGHGM 178

Query: 183 IATRDPIGIRPLIMGEL-----HGKPIFCSETCALEITGAKYIRDVENGETIVCELQEDG 237
           +A RDP GIRPL++G+        + +  SE+ AL+  G  ++RDV  GE I   + E+G
Sbjct: 179 VAFRDPNGIRPLVLGKRDIDENRTEYMVASESVALDTLGFDFLRDVAPGEAIY--ITEEG 236

Query: 238 FISIDSYKNPSTSPERMCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKE-----SPVI 292
            +   + +         C+FEYVYFARPDS I   S+Y +R NMG  L ++       + 
Sbjct: 237 QLF--TRQCADNPVSNPCLFEYVYFARPDSFIDKISVYSARVNMGTKLGEKIAREWEDLD 294

Query: 293 ADIVVPIPDGGVPAAIGYAKESGIPFEQGIIRNHYVGRTFIEPSHHIRAFGVKLKHSANR 352
            D+V+PIP+     A+  A+  G P+ QG ++N YVGRTFI P   +R   V+ K +ANR
Sbjct: 295 IDVVIPIPETSCDIALEIARILGKPYRQGFVKNRYVGRTFIMPGQQLRRKSVRRKLNANR 354

Query: 353 TILAGKRVVLIDDSIVRGTTSVKIVQMIRSAGASEVHLRVASPMVLYPDFYGIDIPDPTA 412
                K V+L+DDSIVRGTTS +I++M R AGA +V+L  A+P + +P+ YGID+P  T 
Sbjct: 355 AEFRDKNVLLVDDSIVRGTTSEQIIEMAREAGAKKVYLASAAPEIRFPNVYGIDMPSATE 414

Query: 413 LLANKCSSPQEMCNFIGVDSLGFLSVDGLYNAICGIPRDPQNPAFADHCFTGDYPTPLVD 472
           L+A+      E+   IG D L F  ++ L +A+     +P    F    F G Y T  VD
Sbjct: 415 LIAHG-REVDEIRQIIGADGLIFQDLNDLIDAVRA--ENPDIQQFECSVFNGVYVTKDVD 471

Query: 473 KQSQHNDEEL 482
           +      + L
Sbjct: 472 QGYLDFLDTL 481


>1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Length = 459 Back     alignment and structure
>2bpl_A Glucosamine--fructose-6-phosphate aminotransferase [isomerizing]; amidotransferase, ammonia channeling, glucosamine 6- phosphate synthase; HET: F6R; 2.05A {Escherichia coli} SCOP: c.80.1.1 d.153.1.1 PDB: 1jxa_A* 2j6h_A* 2vf4_X 2vf5_X* Length = 608 Back     alignment and structure
>1xff_A D-fructose-6-, glucosamine--fructose-6-phosphate aminotransferase [isomerizing]; complex (transferase/inhibitor), glutamine amidotransferase; HET: GLU; 1.80A {Escherichia coli} SCOP: d.153.1.1 PDB: 1xfg_A* Length = 240 Back     alignment and structure
>1te5_A Conserved hypothetical protein; glutamine amidotransferase, amidotransferase, structural genomics, PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa PAO1} SCOP: d.153.1.1 Length = 257 Back     alignment and structure
>3mdn_A Glutamine amidotransferases class-II domain prote; structural genomics, PSI-2, protein structure initiative; 2.09A {Ruegeria pomeroyi} Length = 274 Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Length = 291 Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Length = 208 Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Length = 175 Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Length = 205 Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, structural genomics, PSI, protein structure initative; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Length = 197 Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Length = 153 Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Length = 152 Back     alignment and structure
>2jky_A Hypoxanthine-guanine phosphoribosyltransferase; nucleus, cytoplasm, magnesium, GMP complex, FLIP peptide-plane, glycosyltransferase; HET: 5GP; 2.3A {Saccharomyces cerevisiae} PDB: 2jkz_A* Length = 213 Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Length = 186 Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Length = 183 Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Length = 236 Back     alignment and structure
>1j7j_A HPRT, hypoxanthine phosphoribosyltransferase; glycosyltransferase, nucleotide metabolism, purine salvage; 2.30A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A Length = 178 Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} Length = 186 Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Length = 211 Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Length = 177 Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxantine-guanine phosphoribosyltransferase, 2-(N- morpholino)ethanesulfonic acid (MES); HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Length = 204 Back     alignment and structure
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Length = 201 Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis MB4} SCOP: c.61.1.1 PDB: 1r3u_A* Length = 205 Back     alignment and structure
>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic acid, AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A* Length = 513 Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} Length = 319 Back     alignment and structure
>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1 Length = 553 Back     alignment and structure
>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A* Length = 503 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target488 amidophosphoribosyltransferase [Candidatus Liberibacter
1ecf_A504 Glutamine phosphoribosylpyrophosphate amidotransferase; 100.0
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransferase; 100.0
2bpl_A 608 Glucosamine--fructose-6-phosphate aminotransferase [iso 100.0
1xff_A240 D-fructose-6-, glucosamine--fructose-6-phosphate aminot 100.0
3mdn_A