254780337

254780337

oxidoreductase protein

GeneID in NCBI database:8209322Locus tag:CLIBASIA_01110
Protein GI in NCBI database:254780337Protein Accession:YP_003064750.1
Gene range:+(232797, 233570)Protein Length:257aa
Gene description:oxidoreductase protein
COG prediction:[I] [Q] [R] Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
KEGG prediction:oxidoreductase protein
SEED prediction:putative short-chain dehydrogenase/reductase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MIDCESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN
ccccccccccEEEEEccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccEEEEEccHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHcccccccccccHHHHHHHHHHHHcccccccccEEEEccccEEEccccc
ccccccHHHHHHHccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccccccHcHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHccccccccHHHHHHHHHHHHccccccccEEEEEcccEEEEccccc
midcesknnseihVNLDNRLALvtgssrgigYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANagilgsispiwqikeksfADVISVNVMANWnimrsfdpwlkkshcgraiilssgaaykcrplwgaysASKAAIEALARTWSKETVNTALRVinidpgptrtsmrakampaedpntvphpqKVAKIISFLCATQkietgklfsvpqnrfvnyltpn
midcesknnseIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIfafdlrdsnALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTwsketvntalrvinidpgptrTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIEtgklfsvpqnrfvnyltpn
MIDCESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN
***************LDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPA****TVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVN*****
********NSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN
***CESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIDCESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN
MIDCESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN
MIDCESKNNSEIHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTPN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target257 oxidoreductase protein [Candidatus Liberibacter asiatic
254780535247 3-ketoacyl-(acyl-carrier-protein) reductase [Candi 8e-14
254780462267 enoyl-(acyl carrier protein) reductase [Candidatus 5e-05
>gi|254780535|ref|YP_003064948.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 247 Back     alignment
 Score = 68.9 bits (167), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 94/191 (49%), Gaps = 2/191 (1%)

Query: 15  NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAF 74
           +L  + ALVTG+S  IG   A  L + GA V   G S  +LEK+      +++ + +F  
Sbjct: 3   DLTGKKALVTGASGSIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFL-LFPA 61

Query: 75  DLRDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNI 134
           +  D  ++E     + +  G +DIL+ NAGI+   S   + + + + DV+SVN+ + + +
Sbjct: 62  NFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRD-SLFMRARYEDWDDVLSVNLTSAFLL 120

Query: 135 MRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVI 194
            R   P + ++  GR I ++S   +        Y A+K+ +    +  ++ET    + V 
Sbjct: 121 TRQLVPLMIRNRFGRVINITSVVGFTGNAGQVNYCAAKSGLTGFTKALAQETGRRNVTVN 180

Query: 195 NIDPGPTRTSM 205
            + PG   + M
Sbjct: 181 CVAPGFIGSDM 191

>gi|254780462|ref|YP_003064875.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 267 Back     alignment
 Score = 39.7 bits (91), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 68/156 (43%), Gaps = 8/156 (5%)

Query: 54  QLEKLKNALQKINKKID---IFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGS-- 108
           Q E +   L+ +   +D   +   ++ D ++++L    I +RW  LD ++ +        
Sbjct: 41  QGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNE 100

Query: 109 -ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGA 167
              P +     +F   + V+  +   I+R     +   H G  I L+ G + +  P + A
Sbjct: 101 LRGPYYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMP--HGGAMITLTYGGSMRVVPNYNA 158

Query: 168 YSASKAAIEALARTWSKETVNTALRVINIDPGPTRT 203
            + +K+A+E+  +  + +     +R+  I  GP RT
Sbjct: 159 MAPAKSALESSTKYLACDYGGMNIRINAISAGPVRT 194

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target257 oxidoreductase protein [Candidatus Liberibacter asiatic
315122237235 oxidoreductase protein [Candidatus Liberibacter solanac 1 1e-108
222085423246 oxidoreductase protein [Agrobacterium radiobacter K84] 1 1e-80
116251311246 short-chain dehydrogenase/reductase [Rhizobium legumino 1 1e-79
241203924246 short-chain dehydrogenase/reductase SDR [Rhizobium legu 1 3e-79
86357065246 oxidoreductase protein [Rhizobium etli CFN 42] Length = 1 5e-79
327187991246 short-chain dehydrogenase/reductase SDR [Rhizobium etli 1 1e-78
209548644246 short-chain dehydrogenase/reductase SDR [Rhizobium legu 1 6e-78
190891112246 oxidoreductase [Rhizobium etli CIAT 652] Length = 246 1 1e-77
325292454246 short-chain dehydrogenase/reductase SDR [Agrobacterium 1 5e-77
150395950250 short-chain dehydrogenase/reductase SDR [Sinorhizobium 1 4e-76
>gi|315122237|ref|YP_004062726.1| oxidoreductase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 235 Back     alignment and organism information
 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/234 (78%), Positives = 210/234 (89%)

Query: 23  VTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNAL 82
           +TGSSRGIGYYTALELA++GA+VIAC R++SQLE+LKN LQK  K IDI +FDLRD+ AL
Sbjct: 1   MTGSSRGIGYYTALELAKAGAHVIACARNVSQLEELKNTLQKTKKSIDIMSFDLRDNKAL 60

Query: 83  ELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWL 142
           ELTKTYIAKRWGKLDILIANAGILG I+PIWQI+EK+F DV+S+NV AN N+MR+FDPWL
Sbjct: 61  ELTKTYIAKRWGKLDILIANAGILGPITPIWQIREKNFEDVMSLNVSANLNLMRTFDPWL 120

Query: 143 KKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEALARTWSKETVNTALRVINIDPGPTR 202
           KKSH GRAIILSSGAA+KCRP WGAYS SKAA+EALARTW+KET NT LR+INIDPGPTR
Sbjct: 121 KKSHYGRAIILSSGAAHKCRPFWGAYSTSKAAVEALARTWAKETSNTNLRIINIDPGPTR 180

Query: 203 TSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQKIETGKLFSVPQNRFVNYLTP 256
           TSMRA+AMP EDPNT+PHPQK+AKIIS LC++Q IETGKLFSV + RFV Y  P
Sbjct: 181 TSMRAQAMPREDPNTIPHPQKIAKIISLLCSSQTIETGKLFSVSKERFVEYSLP 234


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085423|ref|YP_002543953.1| oxidoreductase protein [Agrobacterium radiobacter K84] Length = 246 Back     alignment and organism information
>gi|116251311|ref|YP_767149.1| short-chain dehydrogenase/reductase [Rhizobium leguminosarum bv. viciae 3841] Length = 246 Back     alignment and organism information
>gi|241203924|ref|YP_002975020.1| short-chain dehydrogenase/reductase SDR [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 246 Back     alignment and organism information
>gi|86357065|ref|YP_468957.1| oxidoreductase protein [Rhizobium etli CFN 42] Length = 246 Back     alignment and organism information
>gi|327187991|gb|EGE55221.1| short-chain dehydrogenase/reductase SDR [Rhizobium etli CNPAF512] Length = 246 Back     alignment and organism information
>gi|209548644|ref|YP_002280561.1| short-chain dehydrogenase/reductase SDR [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 246 Back     alignment and organism information
>gi|190891112|ref|YP_001977654.1| oxidoreductase [Rhizobium etli CIAT 652] Length = 246 Back     alignment and organism information
>gi|325292454|ref|YP_004278318.1| short-chain dehydrogenase/reductase SDR [Agrobacterium sp. H13-3] Length = 246 Back     alignment and organism information
>gi|150395950|ref|YP_001326417.1| short-chain dehydrogenase/reductase SDR [Sinorhizobium medicae WSM419] Length = 250 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target257 oxidoreductase protein [Candidatus Liberibacter asiatic
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier prot 4e-44
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 2e-34
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) r 5e-34
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 2e-31
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenase of 1e-30
KOG0725270 KOG0725, KOG0725, KOG0725, Reductases with broad range 6e-30
KOG1205282 KOG1205, KOG1205, KOG1205, Predicted dehydrogenase [Sec 8e-29
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Provisio 2e-28
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Provisio 4e-28
COG0300265 COG0300, DltE, Short-chain dehydrogenases of various su 5e-28
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 3e-27
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Provisio 6e-26
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 1e-23
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-prot 1e-23
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Provisio 2e-23
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 1e-22
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provisional 2e-22
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Validate 9e-22
KOG1208314 KOG1208, KOG1208, KOG1208, Dehydrogenases with differen 2e-21
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Provisio 2e-21
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisio 3e-21
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisio 5e-21
KOG1209289 KOG1209, KOG1209, KOG1209, 1-Acyl dihydroxyacetone phos 7e-21
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Pr 8e-21
PRK06500249 PRK06500, PRK06500, short chain dehydrogenase; Provisio 9e-21
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 2e-20
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Provisio 8e-20
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 2e-19
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Provisio 2e-19
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydroge 7e-19
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Provisio 8e-19
PRK07775274 PRK07775, PRK07775, short chain dehydrogenase; Provisio 2e-18
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Provisio 2e-18
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Pr 2e-18
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Provisio 3e-18
PRK09291257 PRK09291, PRK09291, short chain dehydrogenase; Provisio 1e-17
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Provisio 1e-17
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 1e-17
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisio 2e-17
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Provisio 2e-17
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Provisio 2e-17
KOG1201300 KOG1201, KOG1201, KOG1201, Hydroxysteroid 17-beta dehyd 3e-17
PRK06924251 PRK06924, PRK06924, short chain dehydrogenase; Provisio 4e-17
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Provisio 5e-17
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Provisio 5e-17
PRK08703239 PRK08703, PRK08703, short chain dehydrogenase; Provisio 5e-17
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Provisio 7e-17
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Provisio 7e-17
PRK07856252 PRK07856, PRK07856, short chain dehydrogenase; Provisio 8e-17
PRK06125259 PRK06125, PRK06125, short chain dehydrogenase; Provisio 4e-16
PRK12745256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) r 4e-16
PRK07523255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisio 6e-16
KOG1210331 KOG1210, KOG1210, KOG1210, Predicted 3-ketosphinganine 8e-16
KOG1204253 KOG1204, KOG1204, KOG1204, Predicted dehydrogenase [Sec 9e-16
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) reduct 1e-15
PRK07024257 PRK07024, PRK07024, short chain dehydrogenase; Provisio 1e-15
KOG1610322 KOG1610, KOG1610, KOG1610, Corticosteroid 11-beta-dehyd 2e-15
PRK06101240 PRK06101, PRK06101, short chain dehydrogenase; Provisio 2e-15
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenas 2e-15
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Provisio 3e-15
PRK08277278 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisi 3e-15
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 4e-15
PRK05993277 PRK05993, PRK05993, short chain dehydrogenase; Provisio 4e-15
PRK07062265 PRK07062, PRK07062, short chain dehydrogenase; Provisio 9e-15
PRK07576264 PRK07576, PRK07576, short chain dehydrogenase; Provisio 1e-14
KOG1200256 KOG1200, KOG1200, KOG1200, Mitochondrial/plastidial bet 2e-14
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Validate 2e-14
PRK07814263 PRK07814, PRK07814, short chain dehydrogenase; Provisio 2e-14
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase 3e-14
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved in D- 4e-14
PRK07677252 PRK07677, PRK07677, short chain dehydrogenase; Provisio 4e-14
PRK07067257 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional 5e-14
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Provisio 5e-14
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Provisio 5e-14
KOG1207245 KOG1207, KOG1207, KOG1207, Diacetyl reductase/L-xylulos 7e-14
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Provisio 7e-14
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Provisio 9e-14
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 2e-13
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provisional 2e-13
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Validate 2e-13
PRK07985294 PRK07985, PRK07985, oxidoreductase; Provisional 2e-13
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validated 2e-13
KOG4169261 KOG4169, KOG4169, KOG4169, 15-hydroxyprostaglandin dehy 3e-13
TIGR01500256 TIGR01500, sepiapter_red, sepiapterin reductase 3e-13
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisio 3e-13
PRK12743256 PRK12743, PRK12743, oxidoreductase; Provisional 3e-13
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Validate 5e-13
PRK05875276 PRK05875, PRK05875, short chain dehydrogenase; Provisio 5e-13
PRK12748256 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) r 5e-13
PRK12747252 PRK12747, PRK12747, short chain dehydrogenase; Provisio 6e-13
PRK09730247 PRK09730, PRK09730, putative NAD(P)-binding oxidoreduct 8e-13
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Provisio 1e-12
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisio 1e-12
PRK06182273 PRK06182, PRK06182, short chain dehydrogenase; Validate 1e-12
PRK05866293 PRK05866, PRK05866, short chain dehydrogenase; Provisio 1e-12
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Provisio 2e-12
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Provisio 3e-12
PRK08628258 PRK08628, PRK08628, short chain dehydrogenase; Provisio 3e-12
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisio 3e-12
KOG1611249 KOG1611, KOG1611, KOG1611, Predicted short chain-type d 4e-12
PRK08177225 PRK08177, PRK08177, short chain dehydrogenase; Provisio 4e-12
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 4e-12
PRK05786238 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 4e-12
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase 5e-12
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Provisio 8e-12
PRK10538248 PRK10538, PRK10538, malonic semialdehyde reductase; Pro 1e-11
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) r 1e-11
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase 1e-11
PRK08261450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 1e-11
TIGR03206250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA 1e-11
PRK07023243 PRK07023, PRK07023, short chain dehydrogenase; Provisio 2e-11
PRK08017256 PRK08017, PRK08017, oxidoreductase; Provisional 2e-11
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase 2e-11
PRK12859256 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) r 3e-11
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Provisio 3e-11
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Provisio 4e-11
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Provisio 7e-11
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Provisio 7e-11
PRK07791286 PRK07791, PRK07791, short chain dehydrogenase; Provisio 9e-11
PRK08251248 PRK08251, PRK08251, short chain dehydrogenase; Provisio 2e-10
PRK06482276 PRK06482, PRK06482, short chain dehydrogenase; Provisio 2e-10
PRK07792306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 2e-10
PRK06200263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylprop 3e-10
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenas 4e-10
TIGR02632676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldol 6e-10
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Provisio 8e-10
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 8e-10
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 1e-09
KOG1199260 KOG1199, KOG1199, KOG1199, Short-chain alcohol dehydrog 2e-09
PRK08339263 PRK08339, PRK08339, short chain dehydrogenase; Provisio 2e-09
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 2e-09
PRK05717255 PRK05717, PRK05717, oxidoreductase; Validated 3e-09
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Provisio 3e-09
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisiona 3e-09
PRK05876275 PRK05876, PRK05876, short chain dehydrogenase; Provisio 4e-09
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase 5e-09
TIGR01831239 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) r 9e-09
PRK12742237 PRK12742, PRK12742, oxidoreductase; Provisional 1e-08
TIGR03325262 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol 1e-08
PLN02780320 PLN02780, PLN02780, ketoreductase/ oxidoreductase 2e-08
PRK08936261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisiona 3e-08
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Provisio 7e-08
COG0623259 COG0623, FabI, Enoyl-[acyl-carrier-protein] 8e-08
PRK12938246 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisio 1e-07
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases 2e-07
PRK12744257 PRK12744, PRK12744, short chain dehydrogenase; Provisio 2e-07
PRK09186256 PRK09186, PRK09186, flagellin modification protein A; P 5e-07
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Provisio 6e-07
PRK07370258 PRK07370, PRK07370, enoyl-(acyl carrier protein) reduct 1e-06
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisional 1e-06
PRK12823260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carb 1e-06
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Provisio 2e-06
PRK09134258 PRK09134, PRK09134, short chain dehydrogenase; Provisio 2e-06
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 2e-06
PRK06953222 PRK06953, PRK06953, short chain dehydrogenase; Provisio 3e-06
PRK08416260 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenas 4e-05
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc 9e-05
PRK06057255 PRK06057, PRK06057, short chain dehydrogenase; Provisio 1e-04
pfam08659181 pfam08659, KR, KR domain 2e-04
PRK07831262 PRK07831, PRK07831, short chain dehydrogenase; Provisio 5e-04
PRK07041230 PRK07041, PRK07041, short chain dehydrogenase; Provisio 7e-04
PRK07102243 PRK07102, PRK07102, short chain dehydrogenase; Provisio 0.003
COG1028251 COG1028, FabG, Dehydrogenases with different specificit 6e-33
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Provisio 9e-24
KOG1014312 KOG1014, KOG1014, KOG1014, 17 beta-hydroxysteroid dehyd 2e-17
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Provisio 8e-16
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Provisio 2e-22
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 1e-21
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Validate 3e-15
PRK06949258 PRK06949, PRK06949, short chain dehydrogenase; Provisio 2e-13
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Provisio 1e-12
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Provisio 2e-12
PRK07109334 PRK07109, PRK07109, short chain dehydrogenase; Provisio 3e-12
PRK05855582 PRK05855, PRK05855, short chain dehydrogenase; Validate 2e-11
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Validate 5e-10
PRK07832272 PRK07832, PRK07832, short chain dehydrogenase; Provisio 4e-09
PRK06196315 PRK06196, PRK06196, oxidoreductase; Provisional 4e-09
PRK12384259 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; 3e-08
PRK06139330 PRK06139, PRK06139, short chain dehydrogenase; Provisio 1e-06
pfam01370235 pfam01370, Epimerase, NAD dependent epimerase/dehydrata 3e-06
smart00822180 smart00822, PKS_KR, This enzymatic domain is part of ba 2e-04
PRK07806248 PRK07806, PRK07806, short chain dehydrogenase; Provisio 2e-08
PRK06197306 PRK06197, PRK06197, short chain dehydrogenase; Provisio 5e-08
PRK08340259 PRK08340, PRK08340, glucose-1-dehydrogenase; Provisiona 5e-08
PRK07453322 PRK07453, PRK07453, protochlorophyllide oxidoreductase; 2e-04
PLN00015308 PLN00015, PLN00015, protochlorophyllide reductase 0.002
cd01078194 cd01078, NAD_bind_H4MPT_DH, NADP binding domain of meth 0.003
PRK05854313 PRK05854, PRK05854, short chain dehydrogenase; Provisio 0.003
PRK08278273 PRK08278, PRK08278, short chain dehydrogenase; Provisio 2e-06
PRK08303305 PRK08303, PRK08303, short chain dehydrogenase; Provisio 8e-05
cd08270305 cd08270, MDR4, Medium chain dehydrogenases/reductase (M 3e-04
PRK07904253 PRK07904, PRK07904, short chain dehydrogenase; Provisio 6e-04
>gnl|CDD|181591 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180183 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|180126 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|33946 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|35944 KOG0725, KOG0725, KOG0725, Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|36419 KOG1205, KOG1205, KOG1205, Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|183777 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|30648 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|183774 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181073 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|162551 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|181638 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180133 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|36422 KOG1208, KOG1208, KOG1208, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|183776 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|180412 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36423 KOG1209, KOG1209, KOG1209, 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|183525 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180593 PRK06500, PRK06500, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180897 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|162628 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181299 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180930 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181113 PRK07775, PRK07775, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|102201 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180447 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36415 KOG1201, KOG1201, KOG1201, Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|180753 PRK06924, PRK06924, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169556 PRK08703, PRK08703, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180879 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181148 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168407 PRK06125, PRK06125, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183717 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|168990 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36424 KOG1210, KOG1210, KOG1210, Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|36418 KOG1204, KOG1204, KOG1204, Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|181217 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180797 PRK07024, PRK07024, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36823 KOG1610, KOG1610, KOG1610, Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism, General function prediction only] Back     alignment and domain information
>gnl|CDD|180399 PRK06101, PRK06101, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181348 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181043 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36414 KOG1200, KOG1200, KOG1200, Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130891 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|33748 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180821 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36421 KOG1207, KOG1207, KOG1207, Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180445 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180553 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|39371 KOG4169, KOG4169, KOG4169, 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism, General function prediction only] Back     alignment and domain information
>gnl|CDD|162393 TIGR01500, sepiapter_red, sepiapterin reductase Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183715 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183720 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180836 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|168279 PRK05866, PRK05866, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181338 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|36824 KOG1611, KOG1611, KOG1611, Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|169257 PRK08177, PRK08177, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|180258 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|162550 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|180661 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181332 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|180796 PRK07023, PRK07023, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181112 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181119 PRK07791, PRK07791, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180585 PRK06482, PRK06482, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180464 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|36413 KOG1199, KOG1199, KOG1199, Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|169389 PRK08339, PRK08339, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168382 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|181336 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130890 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>gnl|CDD|166421 PLN02780, PLN02780, ketoreductase/ oxidoreductase Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180819 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|30968 COG0623, FabI, Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|30800 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|183716 PRK12744, PRK12744, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169699 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180949 PRK07370, PRK07370, enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181667 PRK09134, PRK09134, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|180774 PRK06953, PRK06953, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|149646 pfam08659, KR, KR domain Back     alignment and domain information
>gnl|CDD|181138 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180804 PRK07041, PRK07041, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180838 PRK07102, PRK07102, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|31231 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|36232 KOG1014, KOG1014, KOG1014, 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180299 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143883 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|181389 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168153 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180844 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180292 PRK05855, PRK05855, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180460 PRK06196, PRK06196, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168417 PRK06139, PRK06139, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|144821 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|129055 smart00822, PKS_KR, This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>gnl|CDD|181126 PRK07806, PRK07806, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180461 PRK06197, PRK06197, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169390 PRK08340, PRK08340, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180983 PRK07453, PRK07453, protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|177654 PLN00015, PLN00015, protochlorophyllide reductase Back     alignment and domain information
>gnl|CDD|133446 cd01078, NAD_bind_H4MPT_DH, NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>gnl|CDD|180291 PRK05854, PRK05854, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181368 PRK08303, PRK08303, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|181162 PRK07904, PRK07904, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 257 oxidoreductase protein [Candidatus Liberibacter asiatic
TIGR01830238 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta 100.0
PRK06172253 short chain dehydrogenase; Provisional 100.0
PRK07478254 short chain dehydrogenase; Provisional 100.0
PRK07063259 short chain dehydrogenase; Provisional 100.0
PRK06841255 short chain dehydrogenase; Provisional 100.0
PRK06227256 consensus 100.0
PRK06138252 short chain dehydrogenase; Provisional 100.0
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK07067256 sorbitol dehydrogenase; Provisional 100.0
PRK12939250 short chain dehydrogenase; Provisional 100.0
PRK12935247 acetoacetyl-CoA reductase; Provisional 100.0
PRK12829264 short chain dehydrogenase; Provisional 100.0
PRK06346251 consensus 100.0
PRK06124259 gluconate 5-dehydrogenase; Provisional 100.0
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 100.0
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK08085254 gluconate 5-dehydrogenase; Provisional 100.0
PRK07523251 gluconate 5-dehydrogenase; Provisional 100.0
PRK08226263 short chain dehydrogenase; Provisional 100.0
PRK12828239 short chain dehydrogenase; Provisional 100.0
PRK08213259 gluconate 5-dehydrogenase; Provisional 100.0
PRK08277278 D-mannonate oxidoreductase; Provisional 100.0
PRK07097265 gluconate 5-dehydrogenase; Provisional 100.0
PRK08589272 short chain dehydrogenase; Validated 100.0
PRK07062265 short chain dehydrogenase; Provisional 100.0
PRK06114262 short chain dehydrogenase; Provisional 100.0
PRK06057255 short chain dehydrogenase; Provisional 100.0
PRK05875277 short chain dehydrogenase; Provisional 100.0
PRK07890258 short chain dehydrogenase; Provisional 100.0
TIGR01963258 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR01 100.0
PRK06949258 short chain dehydrogenase; Provisional 100.0
PRK12827251 short chain dehydrogenase; Provisional 100.0
PRK05867253 short chain dehydrogenase; Provisional 100.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 100.0
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 100.0
PRK06198268 short chain dehydrogenase; Provisional 100.0
PRK07479252 consensus 100.0
PRK06484530 short chain dehydrogenase; Validated 100.0
PRK08936261 glucose-1-dehydrogenase; Provisional 100.0
PRK09242258 tropinone reductase; Provisional 100.0
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 100.0
PRK08643256 acetoin reductase; Validated 100.0
PRK07454241 short chain dehydrogenase; Provisional 100.0
PRK06128300 oxidoreductase; Provisional 100.0
PRK07814263 short chain dehydrogenase; Provisional 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
PRK07576260 short chain dehydrogenase; Provisional 100.0
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 100.0
PRK07776252 consensus 100.0
TIGR01829244 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR 100.0
PRK07774250 short chain dehydrogenase; Provisional 100.0
PRK06484 530 short chain dehydrogenase; Validated 100.0
PRK06701289 short chain dehydrogenase; Provisional 100.0
PRK12824245 acetoacetyl-CoA reductase; Provisional 100.0
PRK12938246 acetyacetyl-CoA reductase; Provisional 100.0
PRK07831261 short chain dehydrogenase; Provisional 100.0
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 100.0
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK09135249 pteridine reductase; Provisional 100.0
PRK07035252 short chain dehydrogenase; Provisional 100.0
PRK08265261 short chain dehydrogenase; Provisional 100.0
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07677254 short chain dehydrogenase; Provisional 100.0
PRK09134256 short chain dehydrogenase; Provisional 100.0
PRK06947252 glucose-1-dehydrogenase; Provisional 100.0
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK12743253 acetoin dehydrogenase; Provisional 100.0
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 100.0
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK06398256 aldose dehydrogenase; Validated 100.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 100.0
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK06125259 short chain dehydrogenase; Provisional 100.0
PRK06500249 short chain dehydrogenase; Provisional 100.0
PRK12746254 short chain dehydrogenase; Provisional 100.0
PRK12937245 short chain dehydrogenase; Provisional 100.0
PRK08628258 short chain dehydrogenase; Provisional 100.0
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 100.0
PRK06123249 short chain dehydrogenase; Provisional 100.0
PRK07985294 oxidoreductase; Provisional 100.0
PRK07791285 short chain dehydrogenase; Provisional 100.0
PRK07856254 short chain dehydrogenase; Provisional 100.0
PRK08945245 short chain dehydrogenase; Provisional 100.0
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 100.0
PRK07060245 short chain dehydrogenase; Provisional 100.0
PRK08278273 short chain dehydrogenase; Provisional 100.0
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 100.0
PRK09730247 hypothetical protein; Provisional 100.0
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 100.0
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK12747252 short chain dehydrogenase; Provisional 100.0
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 100.0
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07074256 short chain dehydrogenase; Provisional 100.0
PRK07069251 short chain dehydrogenase; Validated 100.0
PRK05717255 oxidoreductase; Validated 100.0
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK12744257 short chain dehydrogenase; Provisional 100.0
PRK06523260 short chain dehydrogenase; Provisional 100.0
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07775275 short chain dehydrogenase; Provisional 100.0
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 100.0
PRK08324676 short chain dehydrogenase; Validated 100.0
PRK08261447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK09186255 flagellin modification protein A; Provisional 100.0
PRK07326235 short chain dehydrogenase; Provisional 100.0
TIGR02415258 23BDH acetoin reductases; InterPro: IPR014007 One membe 100.0
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 100.0
PRK08303305 short chain dehydrogenase; Provisional 100.0
PRK08703239 short chain dehydrogenase; Provisional 100.0
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 100.0
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 100.0
PRK07577234 short chain dehydrogenase; Provisional 100.0
PRK07707239 consensus 100.0
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK06139324 short chain dehydrogenase; Provisional 100.0
PRK08340259 glucose-1-dehydrogenase; Provisional 100.0
PRK07041240 short chain dehydrogenase; Provisional 100.0
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK05855582 short chain dehydrogenase; Validated 100.0
PRK07825273 short chain dehydrogenase; Provisional 100.0
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 100.0
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK12742237 oxidoreductase; Provisional 100.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK07109338 short chain dehydrogenase; Provisional 100.0
PRK06924251 short chain dehydrogenase; Provisional 100.0
PRK07806248 short chain dehydrogenase; Provisional 100.0
PRK05872296 short chain dehydrogenase; Provisional 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK07201663 short chain dehydrogenase; Provisional 100.0
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK06181263 short chain dehydrogenase; Provisional 100.0
PRK06300298 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK05866290 short chain dehydrogenase; Provisional 100.0
PRK06194301 hypothetical protein; Provisional 100.0
TIGR01832249 kduD 2-deoxy-D-gluconate 3-dehydrogenase; InterPro: IPR 100.0
PRK05876275 short chain dehydrogenase; Provisional 100.0
PRK08267258 short chain dehydrogenase; Provisional 100.0
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK06914280 short chain dehydrogenase; Provisional 100.0
PRK09072262 short chain dehydrogenase; Provisional 100.0
PRK08263275 short chain dehydrogenase; Provisional 100.0
PRK06483236 short chain dehydrogenase; Provisional 100.0
PRK05650270 short chain dehydrogenase; Provisional 100.0
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 100.0
PRK07832272 short chain dehydrogenase; Provisional 100.0
PRK06182273 short chain dehydrogenase; Validated 100.0
PRK06180277 short chain dehydrogenase; Provisional 100.0
PRK06179270 short chain dehydrogenase; Provisional 100.0
KOG0725270 consensus 100.0
PRK08219226 short chain dehydrogenase; Provisional 100.0
KOG1200256 consensus 100.0
PRK07023243 short chain dehydrogenase; Provisional 100.0
PRK09291257 short chain dehydrogenase; Provisional 100.0
PRK08862227 short chain dehydrogenase; Provisional 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 100.0
PRK06482276 short chain dehydrogenase; Provisional 100.0
PRK06940277 short chain dehydrogenase; Provisional 100.0
PRK08251248 short chain dehydrogenase; Provisional 100.0
PRK07024256 short chain dehydrogenase; Provisional 100.0
PRK08264235 short chain dehydrogenase; Validated 100.0
PRK05993277 short chain dehydrogenase; Provisional 100.0
PRK05693274 short chain dehydrogenase; Provisional 100.0
PRK09009235 C factor cell-cell signaling protein; Provisional 100.0
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 100.0
PRK07102243 short chain dehydrogenase; Provisional 100.0
PRK08017256 short chain dehydrogenase; Provisional 100.0
PRK07578199 short chain dehydrogenase; Provisional 100.0
KOG1205282 consensus 100.0
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 100.0
PRK05884223 short chain dehydrogenase; Provisional 100.0
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK05599246 hypothetical protein; Provisional 100.0
KOG1201300 consensus 100.0
PRK07904253 short chain dehydrogenase; Provisional 100.0
PRK06101241 short chain dehydrogenase; Provisional 100.0
COG1028251 FabG Dehydrogenases with different specificities (relat 100.0
PRK08177225 short chain dehydrogenase; Provisional 100.0
PRK06953222 short chain dehydrogenase; Provisional 100.0
PRK06196316 oxidoreductase; Provisional 100.0
KOG1207245 consensus 100.0
PRK05854314 short chain dehydrogenase; Provisional 100.0
PRK06197306 short chain dehydrogenase; Provisional 100.0
KOG4169261 consensus 100.0
COG3967245 DltE Short-chain dehydrogenase involved in D-alanine es 100.0
TIGR02685283 pter_reduc_Leis pteridine reductase; InterPro: IPR01405 100.0
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, pu 100.0
PRK07453322 protochlorophyllide oxidoreductase; Validated 100.0
KOG1199260 consensus 100.0
KOG1014312 consensus 100.0
KOG1208314 consensus 100.0
KOG1210331 consensus 100.0
COG0623259 FabI Enoyl-[acyl-carrier-protein] 100.0
KOG1611249 consensus 100.0
KOG1204253 consensus 99.97
TIGR01500267 sepiapter_red sepiapterin reductase; InterPro: IPR00639 99.96
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 99.79
pfam02719280 Polysacc_synt_2 Polysaccharide biosynthesis protein. Th 99.68
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 99.65
PRK12367250 short chain dehydrogenase; Provisional 99.63
COG1086588 Predicted nucleoside-diphosphate sugar epimerases [Cell 99.61
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 99.6
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.58
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 99.57
pfam01073280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 99.56
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.55
KOG1502327 consensus 99.55
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 99.53
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.47
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 99.42
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 99.37
CHL00194 319 ycf39 Ycf39; Provisional 99.36
KOG4022236 consensus 99.24
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biog 99.2
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 99.18
TIGR01181340 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: 99.13
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisio 99.13
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 99.08
COG4982 866 3-oxoacyl-[acyl-carrier protein] 99.04
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 98.98
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 98.86
TIGR01746 405 Thioester-redct thioester reductase domain; InterPro: I 98.8
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase 98.76
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 98.76
KOG1430 361 consensus 98.71
PRK07201 663 short chain dehydrogenase; Provisional 98.66
TIGR01777307 yfcH conserved hypothetical protein TIGR01777; InterPro 98.54
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [Gener 98.34
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis 98.34
PRK08309182 short chain dehydrogenase; Provisional 98.26
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 98.15
TIGR01472365 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 Th 97.87
TIGR02197353 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; 97.75
KOG2865 391 consensus 97.72
PRK13771332 putative alcohol dehydrogenase; Provisional 97.38
KOG0747331 consensus 97.26
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.07
TIGR02824334 quinone_pig3 putative NAD(P)H quinone oxidoreductase, P 96.92
KOG1431315 consensus 96.78
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.64
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 95.94
KOG1372376 consensus 95.73
COG2910211 Putative NADH-flavin reductase [General function predic 95.61
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 95.25
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 94.13
PRK07574385 formate dehydrogenase; Provisional 94.02
KOG1196343 consensus 93.84
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.29
KOG2774366 consensus 93.16
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 92.24
pfam08659181 KR KR domain. This enzymatic domain is part of bacteria 100.0
pfam00106167 adh_short short chain dehydrogenase. This family contai 100.0
smart00822180 PKS_KR This enzymatic domain is part of bacterial polyk 100.0
KOG1610322 consensus 100.0
KOG1209289 consensus 100.0
pfam08643296 DUF1776 Fungal family of unknown function (DUF1776). Th 99.97
TIGR01289321 LPOR light-dependent protochlorophyllide reductase; Int 99.86
KOG1478341 consensus 99.83
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 99.25
pfam07993245 NAD_binding_4 Male sterility protein. This family repre 99.22
KOG1371 343 consensus 99.1
TIGR01179 341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 99.1
TIGR02622 361 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: I 99.09
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 99.03
COG3320 382 Putative dehydrogenase domain of multifunctional non-ri 98.52
KOG1202 2376 consensus 98.42
KOG1221 467 consensus 98.06
KOG1203 411 consensus 97.94
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 96.89
COG3268 382 Uncharacterized conserved protein [Function unknown] 96.82
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.73
PRK13656400 trans-2-enoyl-CoA reductase; Provisional 96.63
KOG1429350 consensus 96.49
COG3007398 Uncharacterized paraquat-inducible protein B [Function 95.28
PRK05442325 malate dehydrogenase; Provisional 94.33
KOG0069336 consensus 94.2
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehydroge 93.87
PRK10792288 bifunctional 5,10-methylene-tetrahydrofolate dehydrogen 93.82
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Mal 93.72
PRK03562615 glutathione-regulated potassium-efflux system protein K 93.63
cd00755231 YgdL_like Family of activating enzymes (E1) of ubiquiti 93.47
PRK06487317 glycerate dehydrogenase; Provisional 93.43
TIGR02734 526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 93.43
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is 92.32
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 92.16
KOG4039238 consensus 90.88
PRK06720169 hypothetical protein; Provisional 100.0
PRK12320 699 hypothetical protein; Provisional 97.69
PRK05865 854 hypothetical protein; Provisional 97.51
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 97.43
COG0604326 Qor NADPH:quinone reductase and related Zn-dependent ox 97.18
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 96.95
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 96.95
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 96.94
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 96.8
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 96.8
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 96.7
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 96.36
PRK09880343 L-idonate 5-dehydrogenase; Provisional 96.33
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 96.32
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 96.13
PRK06223312 malate dehydrogenase; Reviewed 95.79
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 95.3
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 94.9
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 94.88
KOG0025354 consensus 94.68
COG2130340 Putative NADP-dependent oxidoreductases [General functi 94.6
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s