254780344

254780344

7-cyano-7-deazaguanine reductase

GeneID in NCBI database:8209329Locus tag:CLIBASIA_01145
Protein GI in NCBI database:254780344Protein Accession:YP_003064757.1
Gene range:+(240702, 241166)Protein Length:154aa
Gene description:7-cyano-7-deazaguanine reductase
COG prediction:none
KEGG prediction:7-cyano-7-deazaguanine reductase (EC:1.7.1.13); K09457 7-cyano-7-deazaguanine reductase [EC:1.7.1.13]
SEED prediction:NADPH dependent preQ0 reductase
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Queuosine-Archaeosine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MSEITLNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPEGVFLPNQDVPQYRGRG
cccccccccHHccccccccccccHHHHccccccccccEEEEEEEccccccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccEEEEEEEcccccccccccccccccccccc
ccHHHHcccccccccccccccccHHHHHccccccccccEEEEEEccccccccccccccccEEEEEEEccccccEcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccccccccccEccccccccccccc
mseitlnglsilggkakpcddpnealleripsqnknlnYVVRFTipeftslcpvtsqpdfaHMILDyipkdwliESKSLKLFMASFrnhhsfheDCTIYIARRLVTildpkwlrigaywyprggipidifwqtsappegvflpnqdvpqyrgrg
mseitlnglsilggkakpcDDPNEALLEripsqnknLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAppegvflpnqdvpqyrgrg
MSEITLNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPEGVFLPNQDVPQYRGRG
******N***ILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPEGVFLP***********
MSEITLNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPEGVFLPNQDVPQYRGRG
*****LNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPEGVFLPNQDVPQ*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEITLNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPEGVFLPNQDVPQYRGRG
MSEITLNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPEGVFLPNQDVPQYRGRG
MSEITLNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPEGVFLPNQDVPQYRGRG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target154 7-cyano-7-deazaguanine reductase [Candidatus Liberibact
315122232154 7-cyano-7-deazaguanine reductase [Candidatus Liberibact 1 1e-69
218516139155 7-cyano-7-deazaguanine reductase [Rhizobium etli 8C-3] 1 3e-60
327193489154 7-cyano-7-deazaguanine reductase [Rhizobium etli CNPAF5 1 4e-60
190892813155 GTP cyclohydrolase I protein [Rhizobium etli CIAT 652] 1 5e-60
222149392154 7-cyano-7-deazaguanine reductase [Agrobacterium vitis S 1 5e-60
150397493154 7-cyano-7-deazaguanine reductase [Sinorhizobium medicae 1 6e-60
86358673154 7-cyano-7-deazaguanine reductase [Rhizobium etli CFN 42 1 7e-60
15966138154 7-cyano-7-deazaguanine reductase [Sinorhizobium melilot 1 9e-60
116253259155 7-cyano-7-deazaguanine reductase [Rhizobium leguminosar 1 1e-59
110816386154 RecName: Full=NADPH-dependent 7-cyano-7-deazaguanine re 1 1e-59
>gi|315122232|ref|YP_004062721.1| 7-cyano-7-deazaguanine reductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 154 Back     alignment and organism information
 Score =  266 bits (679), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 124/154 (80%), Positives = 142/154 (92%)

Query: 1   MSEITLNGLSILGGKAKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDF 60
           MSEI L+GLSILG KAK  D+P EA LE+IPS +K+ NYVVRFTIPEFTSLCPVTSQPDF
Sbjct: 1   MSEIILDGLSILGRKAKIHDNPKEAPLEKIPSNHKDCNYVVRFTIPEFTSLCPVTSQPDF 60

Query: 61  AHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWY 120
           AH+I+DYIP++WLIESKSLKLF  SFRN+ SFHEDC+IYIA+RLV +L+PKWLRIGAYWY
Sbjct: 61  AHIIIDYIPQNWLIESKSLKLFTTSFRNYPSFHEDCSIYIAKRLVQVLEPKWLRIGAYWY 120

Query: 121 PRGGIPIDIFWQTSAPPEGVFLPNQDVPQYRGRG 154
           PRGG+PIDIFWQTS+PP+G+FLPNQDVPQYRGRG
Sbjct: 121 PRGGMPIDIFWQTSSPPKGIFLPNQDVPQYRGRG 154


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218516139|ref|ZP_03512979.1| 7-cyano-7-deazaguanine reductase [Rhizobium etli 8C-3] Length = 155 Back     alignment and organism information
>gi|327193489|gb|EGE60384.1| 7-cyano-7-deazaguanine reductase [Rhizobium etli CNPAF512] Length = 154 Back     alignment and organism information
>gi|190892813|ref|YP_001979355.1| GTP cyclohydrolase I protein [Rhizobium etli CIAT 652] Length = 155 Back     alignment and organism information
>gi|222149392|ref|YP_002550349.1| 7-cyano-7-deazaguanine reductase [Agrobacterium vitis S4] Length = 154 Back     alignment and organism information
>gi|150397493|ref|YP_001327960.1| 7-cyano-7-deazaguanine reductase [Sinorhizobium medicae WSM419] Length = 154 Back     alignment and organism information
>gi|86358673|ref|YP_470565.1| 7-cyano-7-deazaguanine reductase [Rhizobium etli CFN 42] Length = 154 Back     alignment and organism information
>gi|15966138|ref|NP_386491.1| 7-cyano-7-deazaguanine reductase [Sinorhizobium meliloti 1021] Length = 154 Back     alignment and organism information
>gi|116253259|ref|YP_769097.1| 7-cyano-7-deazaguanine reductase [Rhizobium leguminosarum bv. viciae 3841] Length = 155 Back     alignment and organism information
>gi|110816386|sp|Q1MDH2|QUEF_RHIL3 RecName: Full=NADPH-dependent 7-cyano-7-deazaguanine reductase; AltName: Full=7-cyano-7-carbaguanine reductase; AltName: Full=NADPH-dependent nitrile oxidoreductase; AltName: Full=PreQ(0) reductase Length = 154 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target154 7-cyano-7-deazaguanine reductase [Candidatus Liberibact
PRK13258115 PRK13258, PRK13258, 7-cyano-7-deazaguanine reductase; P 1e-54
TIGR03139115 TIGR03139, QueF-II, 7-cyano-7-deazaguanine reductase 8e-41
TIGR03138275 TIGR03138, QueF, 7-cyano-7-deazaguanine reductase 2e-09
PRK11792273 PRK11792, queF, 7-cyano-7-deazaguanine reductase; Provi 5e-06
TIGR00063180 TIGR00063, folE, GTP cyclohydrolase I 0.004
COG0780149 COG0780, COG0780, Enzyme related to GTP cyclohydrolase 9e-42
pfam0122786 pfam01227, GTP_cyclohydroI, GTP cyclohydrolase I 3e-19
>gnl|CDD|183924 PRK13258, PRK13258, 7-cyano-7-deazaguanine reductase; Provisional Back     alignment and domain information
>gnl|CDD|132183 TIGR03139, QueF-II, 7-cyano-7-deazaguanine reductase Back     alignment and domain information
>gnl|CDD|163150 TIGR03138, QueF, 7-cyano-7-deazaguanine reductase Back     alignment and domain information
>gnl|CDD|183317 PRK11792, queF, 7-cyano-7-deazaguanine reductase; Provisional Back     alignment and domain information
>gnl|CDD|129173 TIGR00063, folE, GTP cyclohydrolase I Back     alignment and domain information
>gnl|CDD|31123 COG0780, COG0780, Enzyme related to GTP cyclohydrolase I [General function prediction only] Back     alignment and domain information
>gnl|CDD|144718 pfam01227, GTP_cyclohydroI, GTP cyclohydrolase I Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 154 7-cyano-7-deazaguanine reductase [Candidatus Liberibact
PRK13258127 7-cyano-7-deazaguanine reductase; Provisional 100.0
TIGR03139115 QueF-II 7-cyano-7-deazaguanine reductase. The enzymatic 100.0
COG0780149 Enzyme related to GTP cyclohydrolase I [General functio 100.0
PRK11792274 queF 7-cyano-7-deazaguanine reductase; Provisional 100.0
COG2904137 Uncharacterized protein conserved in bacteria [Function 99.82
TIGR03138 275 QueF 7-cyano-7-deazaguanine reductase. The enzymatic st 99.56
PRK09347186 folE GTP cyclohydrolase I; Provisional 97.24
TIGR03138275 QueF 7-cyano-7-deazaguanine reductase. The enzymatic st 100.0
pfam0122786 GTP_cyclohydroI GTP cyclohydrolase I. This family inclu 99.51
PRK11792 274 queF 7-cyano-7-deazaguanine reductase; Provisional 99.89
cd00642185 GTP_cyclohydro1 GTP cyclohydrolase I (GTP-CH-I) catalyz 97.45
PRK12606185 GTP cyclohydrolase I; Reviewed 97.07
COG0302195 FolE GTP cyclohydrolase I [Coenzyme metabolism] 96.56
TIGR00063183 folE GTP cyclohydrolase I; InterPro: IPR001474 GTP cycl 95.51
KOG2698247 consensus 93.14
>PRK13258 7-cyano-7-deazaguanine reductase; Provisional Back     alignment and domain information
>TIGR03139 QueF-II 7-cyano-7-deazaguanine reductase Back     alignment and domain information
>COG0780 Enzyme related to GTP cyclohydrolase I [General function prediction only] Back     alignment and domain information
>PRK11792 queF 7-cyano-7-deazaguanine reductase; Provisional Back     alignment and domain information
>COG2904 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03138 QueF 7-cyano-7-deazaguanine reductase Back     alignment and domain information
>PRK09347 folE GTP cyclohydrolase I; Provisional Back     alignment and domain information
>TIGR03138 QueF 7-cyano-7-deazaguanine reductase Back     alignment and domain information
>pfam01227 GTP_cyclohydroI GTP cyclohydrolase I Back     alignment and domain information
>PRK11792 queF 7-cyano-7-deazaguanine reductase; Provisional Back     alignment and domain information
>cd00642 GTP_cyclohydro1 GTP cyclohydrolase I (GTP-CH-I) catalyzes the conversion of GTP into dihydroneopterin triphosphate Back     alignment and domain information
>PRK12606 GTP cyclohydrolase I; Reviewed Back     alignment and domain information
>COG0302 FolE GTP cyclohydrolase I [Coenzyme metabolism] Back     alignment and domain information
>TIGR00063 folE GTP cyclohydrolase I; InterPro: IPR001474 GTP cyclohydrolase I (3 Back     alignment and domain information
>KOG2698 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target154 7-cyano-7-deazaguanine reductase [Candidatus Liberibact
3bp1_A290 Crystal Structure Of Putative 7-Cyano-7-Deazaguanin 1e-27
3bp1_A 290 Crystal Structure Of Putative 7-Cyano-7-Deazaguanin 4e-14
>gi|164519587|pdb|3BP1|A Chain A, Crystal Structure Of Putative 7-Cyano-7-Deazaguanine Reductase Quef From Vibrio Cholerae O1 Biovar Eltor Length = 290 Back     alignment and structure
 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 2/96 (2%)

Query: 44  TIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARR 103
                 S C +T+QPD+  + + Y       E+  L  ++ SFR H+ FHE C   I   
Sbjct: 189 HSHLLKSNCLITNQPDWGSVEIAYHGAKXNREA--LLRYLVSFREHNEFHEQCVERIFTD 246

Query: 104 LVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAPPEG 139
           +     P+ L + A +  RGG+ I+ F  +      
Sbjct: 247 IXRYCQPQSLTVYARYTRRGGLDINPFRSSHQSAPN 282


>gi|164519587|pdb|3BP1|A Chain A, Crystal Structure Of Putative 7-Cyano-7-Deazaguanine Reductase Quef From Vibrio Cholerae O1 Biovar Eltor Length = 290 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target154 7-cyano-7-deazaguanine reductase [Candidatus Liberibact
3bp1_A290 NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha 4e-30
>3bp1_A NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha-beta structure, structural genomics, PSI-2; HET: MSE GUN; 1.53A {Vibrio cholerae o1 biovar eltor str} Length = 290 Back     alignment and structure
 Score =  125 bits (315), Expect = 4e-30
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 7/127 (5%)

Query: 21  DPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLK 80
           + ++ALL+   +Q + ++ V+        S C +T+QPD+  + + Y      +  ++L 
Sbjct: 169 EFDDALLQG-AAQGEEVSEVLHS--HLLKSNCLITNQPDWGSVEIAYHGAK--MNREALL 223

Query: 81  LFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTS--APPE 138
            ++ SFR H+ FHE C   I   ++    P+ L + A +  RGG+ I+ F  +   AP  
Sbjct: 224 RYLVSFREHNEFHEQCVERIFTDIMRYCQPQSLTVYARYTRRGGLDINPFRSSHQSAPNH 283

Query: 139 GVFLPNQ 145
              +  Q
Sbjct: 284 NQRMARQ 290


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target154 7-cyano-7-deazaguanine reductase [Candidatus Liberibact
3bp1_A290 NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha 100.0
3bp1_A 290 NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha 99.7
1wur_A220 GTP cyclohydrolase I; beta barrel, protein-inhibitor co 97.22
1is8_A230 GTP cyclohydrolase I; enzyme-regulatory protein complex 97.06
1a8r_A221 GTP cyclohydrolase I; purine hydrolysis, pterine synthe 96.9
>3bp1_A NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha-beta structure, structural genomics, PSI-2; HET: MSE GUN; 1.53A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
Probab=100.00  E-value=2.5e-41  Score=267.97  Aligned_cols=101  Identities=26%  Similarity=0.476  Sum_probs=89.6

Q ss_pred             EECCEEEEECCCCCCCEEEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEEECC
Q ss_conf             96141685268995775899999976986766989999999997304523899999999999986188289999998517
Q gi|254780344|r   43 FTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPR  122 (154)
Q Consensus        43 ~~~~EftslCpvtgqPD~a~i~I~y~~~~~~vEskSLklYL~Sfrn~~~fhE~~v~~I~~dL~~~~~P~~l~V~~~f~~R  122 (154)
                      +.+..|||+||||||||||+|+|.|.+.+  ++.+|||+||.|||||++|||+|+|+||.||+++|+|.||+|+|+|+||
T Consensus       188 l~S~lfrS~CPvT~QPD~a~i~I~y~~~~--~~~~sL~~Yl~SfR~~~~FhE~~ve~If~dl~~~~~p~~l~V~~~~~rR  265 (290)
T 3bp1_A          188 LHSHLLKSNCLITNQPDWGSVEIAYHGAK--MNREALLRYLVSFREHNEFHEQCVERIFTDIMRYCQPQSLTVYARYTRR  265 (290)
T ss_dssp             EEEEEEEEC------CEEEEEEEEEEEEE--ECHHHHHHHHHTTTTCCCCHHHHHHHHHHHHHHHHCCSEEEEEEEECCB
T ss_pred             EEECCEECCCCCCCCCCEEEEEEEECCCC--CCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECC
T ss_conf             98347132698989986069999981752--4899999999999722757999999999999985497589999998667


Q ss_pred             CCCCCCEEEECCCC--CCCCCCCCC
Q ss_conf             98313504007999--976526888
Q gi|254780344|r  123 GGIPIDIFWQTSAP--PEGVFLPNQ  145 (154)
Q Consensus       123 GGI~i~~~~~~~~~--p~~~~~p~~  145 (154)
                      |||||||+|.+...  +.+..+.+|
T Consensus       266 GGidInp~Rs~~~~~~~~~~Rl~RQ  290 (290)
T 3bp1_A          266 GGLDINPFRSSHQSAPNHNQRMARQ  290 (290)
T ss_dssp             TTEEEEEEEESSCCCCSCCCCBTTC
T ss_pred             CCCCCCEECCCCCCCCCCCCCCCCC
T ss_conf             8831765745898899876421269



>3bp1_A NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha-beta structure, structural genomics, PSI-2; HET: MSE GUN; 1.53A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
>1wur_A GTP cyclohydrolase I; beta barrel, protein-inhibitor complex, pteridine, tetrahydrobiopterin, structural genomics; HET: 8DG; 1.82A {Thermus thermophilus} SCOP: d.96.1.1 PDB: 1wm9_A* 1wuq_A* Back     alignment and structure
>1is8_A GTP cyclohydrolase I; enzyme-regulatory protein complex, hydrolase/protein binding complex; HET: PHE; 2.70A {Rattus norvegicus} SCOP: d.96.1.1 PDB: 1is7_A* 1wpl_A* 1fb1_A Back     alignment and structure
>1a8r_A GTP cyclohydrolase I; purine hydrolysis, pterine synthesis; HET: GTP; 2.10A {Escherichia coli} SCOP: d.96.1.1 PDB: 1n3r_A* 1fbx_A 1gtp_A 1n3s_A* 1n3t_F* 1a9c_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target154 7-cyano-7-deazaguanine reductase [Candidatus Liberibact
d1wpla_194 GTP cyclohydrolase I {Rat (Rattus norvegicus) [TaxId: 1 97.09
d1a8ra_221 GTP cyclohydrolase I {Escherichia coli [TaxId: 562]} 97.06
d1wura1185 GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274] 97.06
>d1wpla_ d.96.1.1 (A:) GTP cyclohydrolase I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: T-fold
superfamily: Tetrahydrobiopterin biosynthesis enzymes-like
family: GTP cyclohydrolase I
domain: GTP cyclohydrolase I
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=97.09  E-value=0.0029  Score=37.51  Aligned_cols=80  Identities=16%  Similarity=0.207  Sum_probs=70.4

Q ss_pred             EEEEECCEEEEECCCCCCCEEEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             99996141685268995775899999976986766989999999997304523899999999999986188289999998
Q gi|254780344|r   40 VVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYW  119 (154)
Q Consensus        40 ~i~~~~~EftslCpvtgqPD~a~i~I~y~~~~~~vEskSLklYL~Sfrn~~~fhE~~v~~I~~dL~~~~~P~~l~V~~~f  119 (154)
                      .+....=.|.|+|.-.=+|=+|.+.|-|.|+++++-...|.....-|--.---+|..+..|.+.|.+.++|.-+.|...=
T Consensus        73 ~Vv~~~I~f~S~CEHHllPf~G~~~IaYiP~~~viGlSKl~Riv~~~arRlQ~QErlt~qIa~~l~~~l~~~gv~V~i~A  152 (194)
T d1wpla_          73 MVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEA  152 (194)
T ss_dssp             EEEEEEEEEEEEETTTCCEEEEEEEEEEECSSEECCHHHHHHHHHHHHSSEECHHHHHHHHHHHHHHHHCCSEEEEEEEE
T ss_pred             EEEEECCEEEEECCCCEEEEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             69981766874237650256137999998489624566799999999873130779999999999986787866999999



>d1a8ra_ d.96.1.1 (A:) GTP cyclohydrolase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wura1 d.96.1.1 (A:32-216) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 154 7-cyano-7-deazaguanine reductase [Candidatus Liber
3bp1_A_290 (A:) NADPH-dependent 7-cyano-7-deazaguanine reduct 9e-36
3bp1_A_ 290 (A:) NADPH-dependent 7-cyano-7-deazaguanine reduct 5e-26
1is8_A_94-230137 (A:94-230) GTP cyclohydrolase I; enzyme-regulatory 6e-22
>3bp1_A (A:) NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha-beta structure, structural genomics, PSI-2; HET: MSE GUN; 1.53A {Vibrio cholerae o1 biovar eltor str}Length = 290 Back     alignment and structure
 Score =  143 bits (363), Expect = 9e-36
 Identities = 30/137 (21%), Positives = 52/137 (37%), Gaps = 15/137 (10%)

Query: 17  KPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIES 76
               + ++ALL+                     S C +T+QPD+  + + Y         
Sbjct: 165 IANYEFDDALLQGAAQGE---EVSEVLHSHLLKSNCLITNQPDWGSVEIAYHGAKX--NR 219

Query: 77  KSLKLFMASFRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAP 136
           ++L  ++ SFR H+ FHE C   I   +     P+ L + A +  RGG+ I+ F  +   
Sbjct: 220 EALLRYLVSFREHNEFHEQCVERIFTDIXRYCQPQSLTVYARYTRRGGLDINPFRSSHQS 279

Query: 137 PEGVFLPNQDVPQYRGR 153
                      P +  R
Sbjct: 280 A----------PNHNQR 286


>3bp1_A (A:) NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha-beta structure, structural genomics, PSI-2; HET: MSE GUN; 1.53A {Vibrio cholerae o1 biovar eltor str}Length = 290 Back     alignment and structure
>1is8_A (A:94-230) GTP cyclohydrolase I; enzyme-regulatory protein complex, hydrolase/protein binding complex; HET: PHE; 2.70A {Rattus norvegicus}Length = 137 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target154 7-cyano-7-deazaguanine reductase [Candidatus Liberibact
3bp1_A_290 NADPH-dependent 7-cyano-7-deazaguanine reductase; 100.0
3bp1_A_ 290 NADPH-dependent 7-cyano-7-deazaguanine reductase; 100.0
1is8_A_94-230137 GTP cyclohydrolase I; enzyme-regulatory protein co 99.79
1wur_A_81-220140 GTP cyclohydrolase I; beta barrel, protein-inhibit 97.31
1a8r_A_80-221142 GTP cyclohydrolase I; purine hydrolysis, pterine s 96.82
>3bp1_A (A:) NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha-beta structure, structural genomics, PSI-2; HET: MSE GUN; 1.53A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
Probab=100.00  E-value=3.9e-43  Score=279.77  Aligned_cols=134  Identities=23%  Similarity=0.360  Sum_probs=114.9

Q ss_pred             HCCHHCCCC-CCCCCCCCHHHHHCCCCCCCCCCEEEEEECCEEEEECCCCCCCEEEEEEEEECCCCCCCCHHHHHHHHHH
Q ss_conf             120103765-5577788986820013777886479999614168526899577589999997698676698999999999
Q gi|254780344|r    7 NGLSILGGK-AKPCDDPNEALLERIPSQNKNLNYVVRFTIPEFTSLCPVTSQPDFAHMILDYIPKDWLIESKSLKLFMAS   85 (154)
Q Consensus         7 ~~lt~LG~~-t~~p~~p~~~lLe~i~~~~~~~~~~i~~~~~EftslCpvtgqPD~a~i~I~y~~~~~~vEskSLklYL~S   85 (154)
                      .+....+.+ +....+|++++|++++++.   +|++.++++||+|+||||||||||+|+|+|.|.+.  +.+|||+||+|
T Consensus       154 ~G~~id~lDiei~~y~~~~~~Le~~~~~~---~~~~~l~s~ef~s~CPvTgqPD~~ti~I~Y~p~~~--~~esLk~Yl~S  228 (290)
T 3bp1_A          154 QGECIDDQDIEIANYEFDDALLQGAAQGE---EVSEVLHSHLLKSNCLITNQPDWGSVEIAYHGAKX--NREALLRYLVS  228 (290)
T ss_dssp             SSEECCCCCCCCCCCSCCGGGGTTCEEEE---EEEEEEEEEEEEEC------CEEEEEEEEEEEEEE--CHHHHHHHHHT
T ss_pred             CCCCCCCCCCEECCCCCCHHHHHCCCCCC---CCCEEEEECCEEECCCCCCCCCCEEEEEEECCCCC--CHHHHHHHHHH
T ss_conf             64435533531114557868851354577---63148984463534877799861489999867642--89999999999


Q ss_pred             HHHCCCHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCCCCCCEEEECCCC--CCCCCCCCC
Q ss_conf             730452389999999999998618828999999851798313504007999--976526888
Q gi|254780344|r   86 FRNHHSFHEDCTIYIARRLVTILDPKWLRIGAYWYPRGGIPIDIFWQTSAP--PEGVFLPNQ  145 (154)
Q Consensus        86 frn~~~fhE~~v~~I~~dL~~~~~P~~l~V~~~f~~RGGI~i~~~~~~~~~--p~~~~~p~~  145 (154)
                      ||||++|||+|||+||.||+++|+|+||+|.|+|+|||||+|+|++.++..  |.+..+.+|
T Consensus       229 fRn~~~fHE~~v~rI~~Dl~~~~~P~~l~V~a~y~~RGGi~i~p~r~~~~~~~~~~~R~~Rq  290 (290)
T 3bp1_A          229 FREHNEFHEQCVERIFTDIXRYCQPQSLTVYARYTRRGGLDINPFRSSHQSAPNHNQRXARQ  290 (290)
T ss_dssp             TTTCCCCHHHHHHHHHHHHHHHHCCSEEEEEEEECCBTTEEEEEEEESSCCCCSCCCCBTTC
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEEECCCCCCCCEECCCCCCCCCCCCCCCCC
T ss_conf             87126259999999999999854975899999985578730764735898898776542369



>3bp1_A (A:) NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha-beta structure, structural genomics, PSI-2; HET: MSE GUN; 1.53A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure
>1is8_A (A:94-230) GTP cyclohydrolase I; enzyme-regulatory protein complex, hydrolase/protein binding complex; HET: PHE; 2.70A {Rattus norvegicus} Back     alignment and structure
>1wur_A (A:81-220) GTP cyclohydrolase I; beta barrel, protein-inhibitor complex, pteridine, tetrahydrobiopterin, structural genomics; HET: 8DG; 1.82A {Thermus thermophilus} Back     alignment and structure
>1a8r_A (A:80-221) GTP cyclohydrolase I; purine hydrolysis, pterine synthesis; HET: GTP; 2.10A {Escherichia coli} Back     alignment and structure