254780343

254780343

probable cation efflux protein

GeneID in NCBI database:8209328Locus tag:CLIBASIA_01140
Protein GI in NCBI database:254780343Protein Accession:YP_003064756.1
Gene range:+(239785, 240720)Protein Length:311aa
Gene description:probable cation efflux protein
COG prediction:[P] Predicted Co/Zn/Cd cation transporters
KEGG prediction:probable cation efflux protein
SEED prediction:Cobalt-zinc-cadmium resistance protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Cobalt-zinc-cadmium resistance;
Glutathione-regulated potassium-efflux system and associated functions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED5 TM-Helix
HMMTOP7 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MKVDDQNNMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEVTHGIHVPLKENKNQCLKSL
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHcccccccHHHHHHHcc
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHcc
MKVDDQNNMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLkyayrpadnthpfghqKAEYIAAVVEGLLMTNIALIILYESwhnmshspsndfsIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIAlnasgsigihdlKIRQAGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHiepanevthgihvplkenknqclksl
MKVDDQNNMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEVTHgihvplkenknqclksl
MKVDDQNNMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEVTHGIHVPLKENKNQCLKSL
***********MALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEVT*************CLK**
MKVDDQNNMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEVTHGIHVPLKENKNQCLKSL
****DQNNMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEVTHGIHVPLKENKNQCLKSL
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVDDQNNMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEVTHGIHVPLKENKNQCLKSL
MKVDDQNNMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEVTHGIHVPLKENKNQCLKSL
MKVDDQNNMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEVTHGIHVPLKENKNQCLKSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target311 probable cation efflux protein [Candidatus Liberibacter
315122233299 probable cation efflux protein [Candidatus Liberibacter 1 1e-128
190892814304 cation efflux protein [Rhizobium etli CIAT 652] Length 1 5e-79
241205775304 cation diffusion facilitator family transporter [Rhizob 1 2e-78
222149391305 cation efflux system protein [Agrobacterium vitis S4] L 1 7e-78
159185136300 cation efflux system protein [Agrobacterium tumefaciens 1 2e-77
222086644304 cation efflux protein [Agrobacterium radiobacter K84] L 1 6e-77
209550388304 cation diffusion facilitator family transporter [Rhizob 1 2e-74
116253260304 transmembrane cation efflux pump [Rhizobium leguminosar 1 3e-74
86358674304 cation efflux protein [Rhizobium etli CFN 42] Length = 1 1e-73
15966139306 hypothetical protein SMc02724 [Sinorhizobium meliloti 1 1 9e-73
>gi|315122233|ref|YP_004062722.1| probable cation efflux protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 299 Back     alignment and organism information
 Score =  461 bits (1186), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 229/294 (77%), Positives = 258/294 (87%), Gaps = 2/294 (0%)

Query: 8   NMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPA 67
           NM++MALWGI IS AIT+LKI AWY+TGF+SLLSDGLESIVNIITAIIS+FT+KYA RPA
Sbjct: 7   NMLQMALWGILISIAITSLKIFAWYITGFVSLLSDGLESIVNIITAIISFFTIKYASRPA 66

Query: 68  DNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSP-SNDFSIMGLFIGFMANI 126
           D THPFGHQKAEYIAAVVEGLLM NIALI LYESW+N S+SP SND SI+GL I   A+ 
Sbjct: 67  DKTHPFGHQKAEYIAAVVEGLLMVNIALIALYESWNN-SYSPLSNDISIVGLLISLTAST 125

Query: 127 ISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACF 186
           ISLFWGKWLIY GEK HSA+ KANG+HF++DV+MS GV CGL L LIT+YT LDSI+A  
Sbjct: 126 ISLFWGKWLIYYGEKKHSASLKANGKHFISDVIMSIGVFCGLCLTLITQYTSLDSIMAIL 185

Query: 187 MACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFF 246
           +A N+LYQG KVIS SIKNLMD AV+PE+LEKIKNIIALNASGS+GIHDLK+RQAGATFF
Sbjct: 186 IALNMLYQGWKVISFSIKNLMDGAVQPEYLEKIKNIIALNASGSLGIHDLKVRQAGATFF 245

Query: 247 INFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEVTHGIHVPL 300
           INFHLVVDS+M VL+AHKICN LE+S+EE+I QAIITIHIEP NE  HGIHV L
Sbjct: 246 INFHLVVDSNMTVLNAHKICNHLEKSIEEDINQAIITIHIEPENERVHGIHVQL 299


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190892814|ref|YP_001979356.1| cation efflux protein [Rhizobium etli CIAT 652] Length = 304 Back     alignment and organism information
>gi|241205775|ref|YP_002976871.1| cation diffusion facilitator family transporter [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 304 Back     alignment and organism information
>gi|222149391|ref|YP_002550348.1| cation efflux system protein [Agrobacterium vitis S4] Length = 305 Back     alignment and organism information
>gi|159185136|ref|NP_355230.2| cation efflux system protein [Agrobacterium tumefaciens str. C58] Length = 300 Back     alignment and organism information
>gi|222086644|ref|YP_002545178.1| cation efflux protein [Agrobacterium radiobacter K84] Length = 304 Back     alignment and organism information
>gi|209550388|ref|YP_002282305.1| cation diffusion facilitator family transporter [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 304 Back     alignment and organism information
>gi|116253260|ref|YP_769098.1| transmembrane cation efflux pump [Rhizobium leguminosarum bv. viciae 3841] Length = 304 Back     alignment and organism information
>gi|86358674|ref|YP_470566.1| cation efflux protein [Rhizobium etli CFN 42] Length = 304 Back     alignment and organism information
>gi|15966139|ref|NP_386492.1| hypothetical protein SMc02724 [Sinorhizobium meliloti 1021] Length = 306 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target311 probable cation efflux protein [Candidatus Liberibacter
pfam01545273 pfam01545, Cation_efflux, Cation efflux family 2e-44
TIGR01297268 TIGR01297, CDF, cation diffusion facilitator family tra 2e-44
PRK09509299 PRK09509, fieF, ferrous iron efflux protein F; Reviewed 9e-35
COG1230296 COG1230, CzcD, Co/Zn/Cd efflux system component [Inorga 7e-25
KOG1485412 KOG1485, KOG1485, KOG1485, Mitochondrial Fe2+ transport 2e-20
KOG1482379 KOG1482, KOG1482, KOG1482, Zn2+ transporter [Inorganic 1e-11
KOG1484354 KOG1484, KOG1484, KOG1484, Putative Zn2+ transporter MS 7e-04
COG0053304 COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [ 1e-55
PRK03557312 PRK03557, PRK03557, zinc transporter ZitB; Provisional 2e-11
KOG1483404 KOG1483, KOG1483, KOG1483, Zn2+ transporter ZNT1 and re 5e-04
>gnl|CDD|144949 pfam01545, Cation_efflux, Cation efflux family Back     alignment and domain information
>gnl|CDD|162291 TIGR01297, CDF, cation diffusion facilitator family transporter Back     alignment and domain information
>gnl|CDD|181919 PRK09509, fieF, ferrous iron efflux protein F; Reviewed Back     alignment and domain information
>gnl|CDD|31423 COG1230, CzcD, Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|36698 KOG1485, KOG1485, KOG1485, Mitochondrial Fe2+ transporter MMT1 and related transporters (cation diffusion facilitator superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|36695 KOG1482, KOG1482, KOG1482, Zn2+ transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|36697 KOG1484, KOG1484, KOG1484, Putative Zn2+ transporter MSC2 (cation diffusion facilitator superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|30402 COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|179593 PRK03557, PRK03557, zinc transporter ZitB; Provisional Back     alignment and domain information
>gnl|CDD|36696 KOG1483, KOG1483, KOG1483, Zn2+ transporter ZNT1 and related Cd2+/Zn2+ transporters (cation diffusion facilitator superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 311 probable cation efflux protein [Candidatus Liberibacter
PRK09509300 fieF ferrous iron efflux protein F; Reviewed 100.0
COG0053304 MMT1 Predicted Co/Zn/Cd cation transporters [Inorganic 100.0
PRK03557312 zinc transporter ZitB; Provisional 100.0
pfam01545273 Cation_efflux Cation efflux family. Members of this fam 100.0
COG1230296 CzcD Co/Zn/Cd efflux system component [Inorganic ion tr 100.0
KOG1485412 consensus 100.0
TIGR01297294 CDF cation diffusion facilitator family transporter; In 100.0
KOG1482379 consensus 100.0
KOG1484354 consensus 100.0
KOG1483404 consensus 100.0
COG3965314 Predicted Co/Zn/Cd cation transporters [Inorganic ion t 99.98
KOG2802503 consensus 99.91
COG0053304 MMT1 Predicted Co/Zn/Cd cation transporters [Inorganic 98.4
pfam01545273 Cation_efflux Cation efflux family. Members of this fam 97.3
TIGR01297294 CDF cation diffusion facilitator family transporter; In 96.3
PRK09509300 fieF ferrous iron efflux protein F; Reviewed 98.34
PRK03557312 zinc transporter ZitB; Provisional 97.77
COG1230296 CzcD Co/Zn/Cd efflux system component [Inorganic ion tr 97.23
KOG1485412 consensus 97.18
KOG1484 354 consensus 95.21
COG4956 356 Integral membrane protein (PIN domain superfamily) [Gen 93.93
COG4858226 Uncharacterized membrane-bound protein conserved in bac 93.23
>PRK09509 fieF ferrous iron efflux protein F; Reviewed Back     alignment and domain information
>COG0053 MMT1 Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03557 zinc transporter ZitB; Provisional Back     alignment and domain information
>pfam01545 Cation_efflux Cation efflux family Back     alignment and domain information
>COG1230 CzcD Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1485 consensus Back     alignment and domain information
>TIGR01297 CDF cation diffusion facilitator family transporter; InterPro: IPR002524 Members of this family are integral membrane proteins, that are found to increase tolerance to divalent metal ions such as cadmium, zinc, and cobalt Back     alignment and domain information
>KOG1482 consensus Back     alignment and domain information
>KOG1484 consensus Back     alignment and domain information
>KOG1483 consensus Back     alignment and domain information
>COG3965 Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2802 consensus Back     alignment and domain information
>COG0053 MMT1 Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam01545 Cation_efflux Cation efflux family Back     alignment and domain information
>TIGR01297 CDF cation diffusion facilitator family transporter; InterPro: IPR002524 Members of this family are integral membrane proteins, that are found to increase tolerance to divalent metal ions such as cadmium, zinc, and cobalt Back     alignment and domain information
>PRK09509 fieF ferrous iron efflux protein F; Reviewed Back     alignment and domain information
>PRK03557 zinc transporter ZitB; Provisional Back     alignment and domain information
>COG1230 CzcD Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1485 consensus Back     alignment and domain information
>KOG1484 consensus Back     alignment and domain information
>COG4956 Integral membrane protein (PIN domain superfamily) [General function prediction only] Back     alignment and domain information
>COG4858 Uncharacterized membrane-bound protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target311 probable cation efflux protein [Candidatus Liberibacter
2qfi_A300 Structure Of The Zinc Transporter Yiip Length = 300 1e-41
3h90_A283 Structural Basis For The Autoregulation Of The Zinc 2e-40
3byp_A94 Mode Of Action Of A Putative Zinc Transporter Czrb 8e-13
2zzt_A107 Crystal Structure Of The Cytosolic Domain Of The Ca 1e-10
gi|158430180|pdb|2QFI|A Chain A, Structure Of The Zinc Transporter Yiip Length = 300 Back     alignment and structure
 Score =  174 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 73/293 (24%), Positives = 155/293 (52%), Gaps = 2/293 (0%)

Query: 1   MKVDDQNNMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTL 60
           M       + R A+    +++ +  +KI AW+ TG +S+L+  ++S+V+I  ++ +   +
Sbjct: 1   MNQSYGRLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVV 60

Query: 61  KYAYRPADNTHPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFI 120
           +Y+ +PAD+ H FGH KAE +AA+ + + ++  AL +      ++          +G+ +
Sbjct: 61  RYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIV 120

Query: 121 GFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLD 180
             +A I ++    +  +   +  S A +A+  H+ +DV+M+  +L  L L     +   D
Sbjct: 121 TIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSW-YGWHRAD 179

Query: 181 SIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQ 240
           ++ A  +   ILY   ++   ++++L+D A+  E  ++I +I   +  G  G HDL+ RQ
Sbjct: 180 ALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDI-VTSWPGVSGAHDLRTRQ 238

Query: 241 AGATFFINFHLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEVT 293
           +G T FI  HL ++  + ++ AH + +++E+++      + + IH +P + V 
Sbjct: 239 SGPTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVVP 291


>gi|257471895|pdb|3H90|A Chain A, Structural Basis For The Autoregulation Of The Zinc Transporter Yiip Length = 283 Back     alignment and structure
>gi|206581889|pdb|3BYP|A Chain A, Mode Of Action Of A Putative Zinc Transporter Czrb Length = 94 Back     alignment and structure
>gi|256032320|pdb|2ZZT|A Chain A, Crystal Structure Of The Cytosolic Domain Of The Cation Diffusion Facilitator Family Protein Length = 107 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target311 probable cation efflux protein [Candidatus Liberibacter
3h90_A283 Ferrous-iron efflux pump FIEF; membrane protein, zinc t 4e-36
3byp_A94 CZRB protein; membrane protein, zinc transporter, trans 4e-20
2zzt_A107 Putative uncharacterized protein; cation diffusion faci 9e-14
>3h90_A Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Length = 283 Back     alignment and structure
 Score =  146 bits (370), Expect = 4e-36
 Identities = 72/282 (25%), Positives = 154/282 (54%), Gaps = 2/282 (0%)

Query: 11  RMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNT 70
           R A+    +++ +  +KI AW+ TG +S+L+  ++S+V+I  ++ +   ++Y+ +PAD+ 
Sbjct: 4   RAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSLQPADDN 63

Query: 71  HPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLF 130
           H FGH KAE +AA+ + + ++  AL +      ++          +G+ +  +A I ++ 
Sbjct: 64  HSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTII 123

Query: 131 WGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACN 190
              +  +   +  S A +A+  H+ +DV+M+  +L  L L     +   D++ A  +   
Sbjct: 124 LVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSW-YGWHRADALFALGIGIY 182

Query: 191 ILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFFINFH 250
           ILY   ++   ++++L+D A+  E  ++I +I+  +  G  G HDL+ RQ+G T FI  H
Sbjct: 183 ILYSALRMGYEAVQSLLDRALPDEERQEIIDIV-TSWPGVSGAHDLRTRQSGPTRFIQIH 241

Query: 251 LVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANEV 292
           L ++  + ++ AH + +++E+++      + + IH +P + V
Sbjct: 242 LEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVV 283


>3byp_A CZRB protein; membrane protein, zinc transporter, transport protein; 1.70A {Thermus thermophilus} SCOP: d.52.9.1 PDB: 3byr_A Length = 94 Back     alignment and structure
>2zzt_A Putative uncharacterized protein; cation diffusion facilitator (CDF), transporter, zinc, membrane protein, cytosolic domain; 2.84A {Thermotoga maritima} Length = 107 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target311 probable cation efflux protein [Candidatus Liberibacter
3h90_A283 Ferrous-iron efflux pump FIEF; membrane protein, zinc t 100.0
3byp_A94 CZRB protein; membrane protein, zinc transporter, trans 99.73
2zzt_A107 Putative uncharacterized protein; cation diffusion faci 99.65
3h90_A283 Ferrous-iron efflux pump FIEF; membrane protein, zinc t 97.45
>3h90_A Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Back     alignment and structure
Probab=100.00  E-value=0  Score=423.24  Aligned_cols=280  Identities=25%  Similarity=0.461  Sum_probs=269.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999972799999999999999999999999999548998668724146779999896889
Q gi|254780343|r   10 IRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLL   89 (311)
Q Consensus        10 ~r~~~~~~~~n~~~~~~k~~~g~~t~S~allada~~s~~D~~~~~~~l~~~~~s~k~~d~~~pyG~~r~E~l~~l~~~~~   89 (311)
                      .|.+++++.+|.+++++|+++|++|||.||+||++||+.|++++++++++.+.++||||++|||||+|+|++++++++++
T Consensus         3 ~r~~~~~~~~n~~l~~~k~~~g~~tgS~allaDa~hs~~D~~~~~i~l~~~~~s~r~~d~~~pyG~~r~E~l~~l~~~~~   82 (283)
T 3h90_A            3 SRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSLQPADDNHSFGHGKAESLAALAQSMF   82 (283)
T ss_dssp             CTHHHHHHHHHHTTHHHHHHSSCSSSSSCCCSTTTHHHHHHHHHHHHHHHHHHHTCCCCSSCSSCSTTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             78999999999999999999999980799999999999999999999999998269987569984034507999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99988999999999986300223221026788887201246799999874103305778759986653788788888776
Q gi|254780343|r   90 MTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLL  169 (311)
Q Consensus        90 l~~~~~~i~~es~~~l~~~~~~~~~~~~~~i~~~~~~v~~~~~~~~~~~~~~~~s~~l~a~~~~~~~D~~~s~~vii~~~  169 (311)
                      +++.++++++|+++++++|++.....+++.+.+++.+++.+++++..+.+++.+|++++++++|+++|+++|+++++|.+
T Consensus        83 l~~~~~~~~~~ai~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~a~~~~~~~D~~~s~~vl~~~~  162 (283)
T 3h90_A           83 ISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALG  162 (283)
T ss_dssp             HHHHHHHHHHHHHHTSSSSCCCCCCCCCTHHHHHHHHHHHHHHHHHHHHHHHSCCHHHHHHHHHHHHHHCCCSCSCSSSC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999985233466776444787642232689999887652135786677778887536987759999999


Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEEEEEEEECCEEEEEE
Q ss_conf             53027722468766899999999998999999899740445551458999998641588831151576475579079999
Q gi|254780343|r  170 LVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLKIRQAGATFFINF  249 (311)
Q Consensus       170 ~~~~~~~~~~D~i~ai~i~~~i~~~~~~~~~~~~~~Ll~~s~~~~~~~~i~~~i~~~~~~V~~v~~l~~~~~G~~~~v~~  249 (311)
                      +.+ ++|+|+||++++++++++++.+++++|++.+.|+|.+||+++.+++++.+ .+.|++.++|++|+|+.|++.++++
T Consensus       163 ~~~-~~~~~~D~i~~l~i~l~i~~~~~~~~~~~~~~Ll~~s~~~~~~~~i~~~i-~~~~~v~~v~~l~~~~~G~~~~v~v  240 (283)
T 3h90_A          163 LSW-YGWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIV-TSWPGVSGAHDLRTRQSGPTRFIQI  240 (283)
T ss_dssp             SCS-TTSCCSTHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHH-HHSSSCSEEEEEEEEEETTEEEEEE
T ss_pred             HHH-HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH-HCCCCCCEEEEEEEEEECCCEEEEE
T ss_conf             999-49520008999999999999999999999999817899867899999999-7689973058899999889699999


Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC
Q ss_conf             999887999899999999999999987798689999605887
Q gi|254780343|r  250 HLVVDSHMIVLDAHKICNKLERSLEENIGQAIITIHIEPANE  291 (311)
Q Consensus       250 ~i~v~~~~~~~eah~i~~~ie~~l~~~~~~~~v~ih~ep~~~  291 (311)
                      |+++|+++|++|+|++++++|+.++++++..+++||+|||+.
T Consensus       241 ~i~v~~~~~~~~~~~i~~~ie~~l~~~~~~~~v~Ih~eP~~~  282 (283)
T 3h90_A          241 HLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSV  282 (283)
T ss_dssp             EEECCTTCBHHHHHHHHHHHHHHHHHHSTTCEEEEEEECSCC
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCC
T ss_conf             999898998999999999999999976799869999478646



>3byp_A CZRB protein; membrane protein, zinc transporter, transport protein; 1.70A {Thermus thermophilus} SCOP: d.52.9.1 PDB: 3byr_A Back     alignment and structure
>2zzt_A Putative uncharacterized protein; cation diffusion facilitator (CDF), transporter, zinc, membrane protein, cytosolic domain; 2.84A {Thermotoga maritima} Back     alignment and structure
>3h90_A Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 311 probable cation efflux protein [Candidatus Liberibacter
d2qfia2204 f.59.1.1 (A:5-208) Ferrous-iron efflux pump FieF {Esche 8e-23
d3bypa182 d.52.9.1 (A:6-87) Putative Zinc transporter CzrB {Therm 2e-17
d2qfia182 d.52.9.1 (A:209-290) Ferrous-iron efflux pump FieF (Yii 2e-16
>d2qfia2 f.59.1.1 (A:5-208) Ferrous-iron efflux pump FieF {Escherichia coli [TaxId: 562]} Length = 204 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Cation efflux protein transmembrane domain-like
superfamily: Cation efflux protein transmembrane domain-like
family: Cation efflux protein transmembrane domain-like
domain: Ferrous-iron efflux pump FieF
species: Escherichia coli [TaxId: 562]
 Score =  101 bits (252), Expect = 8e-23
 Identities = 48/198 (24%), Positives = 106/198 (53%), Gaps = 1/198 (0%)

Query: 11  RMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNT 70
           R A+    +++ +  +KI AW+ TG +S+L+  ++S+V+I  ++ +   ++Y+ +PAD+ 
Sbjct: 7   RAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSLQPADDN 66

Query: 71  HPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLF 130
           H FGH KAE +AA+ + + ++  AL +      ++          +G+ +  +A I ++ 
Sbjct: 67  HSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTII 126

Query: 131 WGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACN 190
              +  +   +  S A +A+  H+ +DV+M+  +L  L L     +   D++ A  +   
Sbjct: 127 LVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSW-YGWHRADALFALGIGIY 185

Query: 191 ILYQGCKVISSSIKNLMD 208
           ILY   ++   ++++L+D
Sbjct: 186 ILYSALRMGYEAVQSLLD 203


>d3bypa1 d.52.9.1 (A:6-87) Putative Zinc transporter CzrB {Thermus thermophilus [TaxId: 274]} Length = 82 Back     information, alignment and structure
>d2qfia1 d.52.9.1 (A:209-290) Ferrous-iron efflux pump FieF (YiiP) {Escherichia coli [TaxId: 562]} Length = 82 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target311 probable cation efflux protein [Candidatus Liberibacter
d2qfia2204 Ferrous-iron efflux pump FieF {Escherichia coli [TaxId: 100.0
d3bypa182 Putative Zinc transporter CzrB {Thermus thermophilus [T 99.63
d2qfia182 Ferrous-iron efflux pump FieF (YiiP) {Escherichia coli 99.54
d2qfia2204 Ferrous-iron efflux pump FieF {Escherichia coli [TaxId: 90.24
>d2qfia2 f.59.1.1 (A:5-208) Ferrous-iron efflux pump FieF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Cation efflux protein transmembrane domain-like
superfamily: Cation efflux protein transmembrane domain-like
family: Cation efflux protein transmembrane domain-like
domain: Ferrous-iron efflux pump FieF
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.5e-43  Score=292.28  Aligned_cols=201  Identities=24%  Similarity=0.432  Sum_probs=190.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             89999999999999999999999999727999999999999999999999999995489986687241467799998968
Q gi|254780343|r    8 NMIRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEG   87 (311)
Q Consensus         8 ~~~r~~~~~~~~n~~~~~~k~~~g~~t~S~allada~~s~~D~~~~~~~l~~~~~s~k~~d~~~pyG~~r~E~l~~l~~~   87 (311)
                      ..+|..++++.+|+++++.|+++|++|||+|+++|++||+.|++++++++++.|.++||||++|||||+|.|++++++++
T Consensus         4 ~~~r~~~~~~~~n~~l~i~~~~~~~~t~S~allada~~s~~D~~~~~~~l~~~~~s~k~~d~~~pyG~~r~E~l~~l~~~   83 (204)
T d2qfia2           4 LVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSLQPADDNHSFGHGKAESLAALAQS   83 (204)
T ss_dssp             SSSTTSHHHHGGGTTTTTBTTBCCCCTTSSCCCCCCCTTHHHHHHHHHHHHHHTTSSSSCSTTSSCSCCTHHHHHHHTTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99999999999999999999999999552999999999999999999999998760799986688642678799999989


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999889999999999863002232210267888872012467999998741033057787599866537887888887
Q gi|254780343|r   88 LLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCG  167 (311)
Q Consensus        88 ~~l~~~~~~i~~es~~~l~~~~~~~~~~~~~~i~~~~~~v~~~~~~~~~~~~~~~~s~~l~a~~~~~~~D~~~s~~vii~  167 (311)
                      ++++++++++++|+++++++|++++...+++.+++++.+++..+.++..+.+|+.+|++++++++|+++|+++|++++++
T Consensus        84 ~~l~~~~~~~~~~si~~l~~~~~~~~~~~~~~v~~~~~~~~~~l~~~~~~~~~~~~s~~~~a~~~~~~~D~~~s~~vii~  163 (204)
T d2qfia2          84 MFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLA  163 (204)
T ss_dssp             TTTSSSTTGGGSSCTTSSTTTSSSSTTTSCCCCCGGGSSCGGGGTTTHHHHGGGCCSTTSGGGGGGHHHHTCCSSTTCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999972011346099999999999999999999887220021452699999999789987999999


Q ss_pred             HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             765302772246876689999999999899999989974044
Q gi|254780343|r  168 LLLVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDA  209 (311)
Q Consensus       168 ~~~~~~~~~~~~D~i~ai~i~~~i~~~~~~~~~~~~~~Ll~~  209 (311)
                      ..+.+ ++|+|+||++++++++++++.+++++||+.++|+|+
T Consensus       164 ~~~~~-~~~~~~D~i~aiii~~~i~~~~~~~~~~~~~~Lld~  204 (204)
T d2qfia2         164 LGLSW-YGWHRADALFALGIGIYILYSALRMGYEAVQSLLDR  204 (204)
T ss_dssp             TTSSC-SSTTSSSSSSHHHHTTTTTTTTTTHHHHTGGGSSCC
T ss_pred             HHHHH-HCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99999-384032699999999999999999999999987294



>d3bypa1 d.52.9.1 (A:6-87) Putative Zinc transporter CzrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qfia1 d.52.9.1 (A:209-290) Ferrous-iron efflux pump FieF (YiiP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qfia2 f.59.1.1 (A:5-208) Ferrous-iron efflux pump FieF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 311 probable cation efflux protein [Candidatus Liberib
3h90_A_1-202202 (A:1-202) Ferrous-iron efflux pump FIEF; membrane 5e-21
3byp_A_94 (A:) CZRB protein; membrane protein, zinc transpor 6e-18
2zzt_A_107 (A:) Putative uncharacterized protein; cation diff 3e-15
3h90_A_203-28381 (A:203-283) Ferrous-iron efflux pump FIEF; membran 1e-14
>3h90_A (A:1-202) Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_ALength = 202 Back     alignment and structure
 Score = 96.1 bits (238), Expect = 5e-21
 Identities = 49/200 (24%), Positives = 107/200 (53%), Gaps = 1/200 (0%)

Query: 11  RMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNT 70
           R A+    +++ +  +KI AW+ TG +S+L+  ++S+V+I  ++ +   ++Y+ +PAD+ 
Sbjct: 4   RAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSLQPADDN 63

Query: 71  HPFGHQKAEYIAAVVEGLLMTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLF 130
           H FGH KAE +AA+ + + ++  AL +      ++          +G+ +  +A I ++ 
Sbjct: 64  HSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTII 123

Query: 131 WGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLLLVLITEYTVLDSIIACFMACN 190
              +  +   +  S A +A+  H+ +DV+M+  +L  L L     +   D++ A  +   
Sbjct: 124 LVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSW-YGWHRADALFALGIGIY 182

Query: 191 ILYQGCKVISSSIKNLMDAA 210
           ILY   ++   ++++L+D A
Sbjct: 183 ILYSALRMGYEAVQSLLDRA 202


>3byp_A (A:) CZRB protein; membrane protein, zinc transporter, transport protein; 1.70A {Thermus thermophilus}Length = 94 Back     alignment and structure
>2zzt_A (A:) Putative uncharacterized protein; cation diffusion facilitator (CDF), transporter, zinc, membrane protein, cytosolic domain; 2.84A {Thermotoga maritima}Length = 107 Back     alignment and structure
>3h90_A (A:203-283) Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_ALength = 81 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target311 probable cation efflux protein [Candidatus Liberibacter
3h90_A_1-202202 Ferrous-iron efflux pump FIEF; membrane protein, z 100.0
3byp_A_94 CZRB protein; membrane protein, zinc transporter, 99.73
2zzt_A_107 Putative uncharacterized protein; cation diffusion 99.66
3h90_A_203-28381 Ferrous-iron efflux pump FIEF; membrane protein, z 99.65
3h90_A_1-202202 Ferrous-iron efflux pump FIEF; membrane protein, z 96.9
>3h90_A (A:1-202) Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Back     alignment and structure
Probab=100.00  E-value=5.6e-39  Score=265.73  Aligned_cols=200  Identities=25%  Similarity=0.443  Sum_probs=192.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999972799999999999999999999999999548998668724146779999896889
Q gi|254780343|r   10 IRMALWGIPISAAITALKIIAWYVTGFISLLSDGLESIVNIITAIISYFTLKYAYRPADNTHPFGHQKAEYIAAVVEGLL   89 (311)
Q Consensus        10 ~r~~~~~~~~n~~~~~~k~~~g~~t~S~allada~~s~~D~~~~~~~l~~~~~s~k~~d~~~pyG~~r~E~l~~l~~~~~   89 (311)
                      .|..+++++.|+++++.|+++|++|||.++++|++||+.|+++.++++++.+.++||||++|||||+|.|++++++.+++
T Consensus         3 ~r~~~i~l~~~~~~~v~~~~~g~~t~S~allada~~sl~d~~~~~~~l~~~~~~~k~~~~~~pyG~~r~E~l~~~~~~~~   82 (202)
T 3h90_A            3 SRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSLQPADDNHSFGHGKAESLAALAQSMF   82 (202)
T ss_dssp             CTHHHHHHHHHHTTHHHHHHSSCSSSSSCCCSTTTHHHHHHHHHHHHHHHHHHHTCCCCSSCSSCSTTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             78999999999999999999999980899999999999999999999999998279998889960666407988778998


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99988999999999986300223221026788887201246799999874103305778759986653788788888776
Q gi|254780343|r   90 MTNIALIILYESWHNMSHSPSNDFSIMGLFIGFMANIISLFWGKWLIYSGEKNHSAAFKANGQHFVADVVMSAGVLCGLL  169 (311)
Q Consensus        90 l~~~~~~i~~es~~~l~~~~~~~~~~~~~~i~~~~~~v~~~~~~~~~~~~~~~~s~~l~a~~~~~~~D~~~s~~vii~~~  169 (311)
                      +++.++++++++++++++|++++...+.+...+++..++...+++..+.+++.+|++++++.+|+++|+++|++++++.+
T Consensus        83 l~~~~~~~~~~ai~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~d~l~s~~vii~~l  162 (202)
T 3h90_A           83 ISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALG  162 (202)
T ss_dssp             HHHHHHHHHHHHHHTSSSSCCCCCCCCCTHHHHHHHHHHHHHHHHHHHHHHHSCCHHHHHHHHHHHHHHCCCSCSCSSSC
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             99999999999999984357666776542002333234799999987630345776676423454133212338899999


Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             53027722468766899999999998999999899740445
Q gi|254780343|r  170 LVLITEYTVLDSIIACFMACNILYQGCKVISSSIKNLMDAA  210 (311)
Q Consensus       170 ~~~~~~~~~~D~i~ai~i~~~i~~~~~~~~~~~~~~Ll~~s  210 (311)
                      +.++ +|+|+||++++++++++++.+++++|++.+.|+|++
T Consensus       163 ~~~~-~~~~~D~i~~iii~~~i~~~~~~~~~~s~~~Ll~~a  202 (202)
T 3h90_A          163 LSWY-GWHRADALFALGIGIYILYSALRMGYEAVQSLLDRA  202 (202)
T ss_dssp             SCST-TSCCSTHHHHHHHHHHHHHHHHHHHHHHHHHHTTCC
T ss_pred             HHHH-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9994-816675898999999999999999999977653677



>3byp_A (A:) CZRB protein; membrane protein, zinc transporter, transport protein; 1.70A {Thermus thermophilus} Back     alignment and structure
>2zzt_A (A:) Putative uncharacterized protein; cation diffusion facilitator (CDF), transporter, zinc, membrane protein, cytosolic domain; 2.84A {Thermotoga maritima} Back     alignment and structure
>3h90_A (A:203-283) Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Back     alignment and structure
>3h90_A (A:1-202) Ferrous-iron efflux pump FIEF; membrane protein, zinc transporter, cell inner membrane, cell membrane, ION transport, iron transport; 2.90A {Escherichia coli k-12} PDB: 2qfi_A Back     alignment and structure