254780346

254780346

riboflavin synthase subunit beta

GeneID in NCBI database:8209331Locus tag:CLIBASIA_01155
Protein GI in NCBI database:254780346Protein Accession:YP_003064759.1
Gene range:-(241705, 242154)Protein Length:149aa
Gene description:riboflavin synthase subunit beta
COG prediction:[H] Riboflavin synthase beta-chain
KEGG prediction:ribH; riboflavin synthase subunit beta; K00794 riboflavin synthase beta chain [EC:2.5.1.-]
SEED prediction:6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.9)
Pathway involved in KEGG:Riboflavin metabolism [PATH:las00740]
Subsystem involved in SEED:Riboflavin, FMN and FAD metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLSE
cccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEcccccccHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEcccccHHHHHHHHHHHHHHccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHEEEccEEHHHHHHHHHHHHHHHHHHHcc
MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRavqwssivtpgvleIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVdlsingslpigngivvvdseqqafdrvspshldrggcAARSALAMIELKKSLSE
MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDrvspshldrggCAARSALAMIELKKSLSE
MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLSE
****IPH*LIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLS*
MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLSE
MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLSE
MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLSE
MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLSE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target149 riboflavin synthase subunit beta [Candidatus Liberibact
315122230155 riboflavin synthase subunit beta [Candidatus Liberibact 1 3e-55
15888508148 riboflavin synthase subunit beta [Agrobacterium tumefac 1 2e-34
325292545148 riboflavin synthase beta chain [Agrobacterium sp. H13-3 1 1e-32
116251398151 6,7-dimethyl-8-ribityllumazine synthase [Rhizobium legu 1 2e-32
209548793151 6,7-dimethyl-8-ribityllumazine synthase [Rhizobium legu 1 4e-32
190891210151 6,7-dimethyl-8-ribityllumazine synthase (riboflavin syn 1 6e-32
218682019151 riboflavin synthase subunit beta [Rhizobium etli CIAT 8 1 6e-32
163759208151 riboflavin synthase subunit beta [Hoeflea phototrophica 1 7e-32
328543539149 riboflavin synthase subunit beta [polymorphum gilvum SL 1 8e-32
254469496149 6,7-dimethyl-8-ribityllumazine synthase [Pseudovibrio s 1 9e-32
>gi|315122230|ref|YP_004062719.1| riboflavin synthase subunit beta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 155 Back     alignment and organism information
 Score =  218 bits (554), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 122/144 (84%), Gaps = 1/144 (0%)

Query: 1   MEVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAK 60
           M V +P VLIIEARFYENLS ML EGCVN L+++ V+W S+VTPGVLEIPAA+SM MNA 
Sbjct: 1   MAVLVPRVLIIEARFYENLSKMLLEGCVNFLNNKDVKWDSVVTPGVLEIPAAISMAMNAT 60

Query: 61  TRSVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFD 120
              V Y+GIIVLG+VMRG+T+HCD+IA AVTRGL+D+SI  SLPIGNGIVVVD+E+QA D
Sbjct: 61  AYQV-YNGIIVLGIVMRGETSHCDIIAQAVTRGLIDISIKDSLPIGNGIVVVDNEKQALD 119

Query: 121 RVSPSHLDRGGCAARSALAMIELK 144
           RVS + L+RGGCAARS L MIELK
Sbjct: 120 RVSSACLNRGGCAARSVLTMIELK 143


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15888508|ref|NP_354189.1| riboflavin synthase subunit beta [Agrobacterium tumefaciens str. C58] Length = 148 Back     alignment and organism information
>gi|325292545|ref|YP_004278409.1| riboflavin synthase beta chain [Agrobacterium sp. H13-3] Length = 148 Back     alignment and organism information
>gi|116251398|ref|YP_767236.1| 6,7-dimethyl-8-ribityllumazine synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 151 Back     alignment and organism information
>gi|209548793|ref|YP_002280710.1| 6,7-dimethyl-8-ribityllumazine synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 151 Back     alignment and organism information
>gi|190891210|ref|YP_001977752.1| 6,7-dimethyl-8-ribityllumazine synthase (riboflavin synthase beta chain) [Rhizobium etli CIAT 652] Length = 151 Back     alignment and organism information
>gi|218682019|ref|ZP_03529620.1| riboflavin synthase subunit beta [Rhizobium etli CIAT 894] Length = 151 Back     alignment and organism information
>gi|163759208|ref|ZP_02166294.1| riboflavin synthase subunit beta [Hoeflea phototrophica DFL-43] Length = 151 Back     alignment and organism information
>gi|328543539|ref|YP_004303648.1| riboflavin synthase subunit beta [polymorphum gilvum SL003B-26A1] Length = 149 Back     alignment and organism information
>gi|254469496|ref|ZP_05082901.1| 6,7-dimethyl-8-ribityllumazine synthase [Pseudovibrio sp. JE062] Length = 149 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target149 riboflavin synthase subunit beta [Candidatus Liberibact
PRK00061154 PRK00061, ribH, 6,7-dimethyl-8-ribityllumazine synthase 2e-31
COG0054152 COG0054, RibH, Riboflavin synthase beta-chain [Coenzyme 9e-23
TIGR00114138 TIGR00114, lumazine-synth, 6,7-dimethyl-8-ribityllumazi 9e-16
PLN02404141 PLN02404, PLN02404, 6,7-dimethyl-8-ribityllumazine synt 7e-15
KOG3243158 KOG3243, KOG3243, KOG3243, 6,7-dimethyl-8-ribityllumazi 1e-11
pfam00885144 pfam00885, DMRL_synthase, 6,7-dimethyl-8-ribityllumazin 3e-29
>gnl|CDD|178833 PRK00061, ribH, 6,7-dimethyl-8-ribityllumazine synthase; Provisional Back     alignment and domain information
>gnl|CDD|30403 COG0054, RibH, Riboflavin synthase beta-chain [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|129220 TIGR00114, lumazine-synth, 6,7-dimethyl-8-ribityllumazine synthase Back     alignment and domain information
>gnl|CDD|178026 PLN02404, PLN02404, 6,7-dimethyl-8-ribityllumazine synthase Back     alignment and domain information
>gnl|CDD|38453 KOG3243, KOG3243, KOG3243, 6,7-dimethyl-8-ribityllumazine synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|144470 pfam00885, DMRL_synthase, 6,7-dimethyl-8-ribityllumazine synthase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 149 riboflavin synthase subunit beta [Candidatus Liberibact
PRK00061154 ribH riboflavin synthase subunit beta; Provisional 100.0
PRK12419158 riboflavin synthase subunit beta; Provisional 100.0
pfam00885144 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase. 100.0
COG0054152 RibH Riboflavin synthase beta-chain [Coenzyme metabolis 100.0
TIGR00114148 lumazine-synth 6,7-dimethyl-8-ribityllumazine synthase; 100.0
KOG3243158 consensus 100.0
PRK06455155 riboflavin synthase; Provisional 98.21
COG1731154 Archaeal riboflavin synthase [Coenzyme metabolism] 97.79
TIGR01506152 ribC_arch riboflavin synthase; InterPro: IPR006399 Thes 97.7
cd06284267 PBP1_LacI_like_6 Ligand-binding domain of an uncharacte 96.74
cd06288269 PBP1_sucrose_transcription_regulator Ligand-binding dom 96.63
cd06291265 PBP1_Qymf_like Ligand binding domain of the lacI-like t 96.57
cd06271268 PBP1_AglR_RafR_like Ligand-binding domain of DNA transc 96.25
cd06270268 PBP1_GalS_like Ligand binding domain of DNA transcripti 96.0
cd06294270 PBP1_ycjW_transcription_regulator_like Ligand-binding d 95.97
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding domai 95.92
cd06296270 PBP1_CatR_like Ligand-binding domain of a LacI-like tra 95.78
cd06293269 PBP1_LacI_like_11 Ligand-binding domain of uncharacteri 95.61
PRK10703335 DNA-binding transcriptional repressor PurR; Provisional 95.55
cd06275269 PBP1_PurR Ligand-binding domain of purine repressor, Pu 95.52
cd01545270 PBP1_SalR Ligand-binding domain of DNA transcription re 95.45
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain of t 95.41
cd06290265 PBP1_LacI_like_9 Ligand-binding domain of uncharacteriz 95.33
cd06281269 PBP1_LacI_like_5 Ligand-binding domain of uncharacteriz 95.28
cd06286260 PBP1_CcpB_like Ligand-binding domain of a novel transcr 95.24
PRK10014342 DNA-binding transcriptional repressor MalI; Provisional 95.2
cd06295275 PBP1_CelR Ligand binding domain of a transcription regu 95.18
cd06285265 PBP1_LacI_like_7 Ligand-binding domain of uncharacteriz 94.91
PRK11041341 DNA-binding transcriptional regulator CytR; Provisional 94.36
cd06325281 PBP1_ABC_uncharacterized_transporter Type I periplasmic 94.33
cd01575268 PBP1_GntR Ligand-binding domain of DNA transcription re 93.9
cd06279283 PBP1_LacI_like_3 Ligand-binding domain of uncharacteriz 93.8
cd06287269 PBP1_LacI_like_8 Ligand-binding domain of uncharacteriz 93.45
cd01536267 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding d 93.43
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a transcr 93.39
COG1609333 PurR Transcriptional regulators [Transcription] 93.1
PRK09526342 lacI lac repressor; Reviewed 92.49
cd06273268 PBP1_GntR_like_1 This group includes the ligand-binding 92.48
cd06272261 PBP1_hexuronate_repressor_like Ligand-binding domain of 92.35
cd01543265 PBP1_XylR Ligand-binding domain of DNA transcription re 91.94
cd06274264 PBP1_FruR Ligand binding domain of DNA transcription re 91.92
cd06298268 PBP1_CcpA_like Ligand-binding domain of the catabolite 91.75
PRK10727342 DNA-binding transcriptional regulator GalR; Provisional 91.71
cd06299265 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding 91.57
cd06277268 PBP1_LacI_like_1 Ligand-binding domain of uncharacteriz 91.27
cd06280263 PBP1_LacI_like_4 Ligand-binding domain of uncharacteriz 91.25
cd06292273 PBP1_LacI_like_10 Ligand-binding domain of uncharacteri 91.02
cd06278266 PBP1_LacI_like_2 Ligand-binding domain of uncharacteriz 90.84
PRK10339327 DNA-binding transcriptional repressor EbgR; Provisional 90.69
PRK11303330 DNA-binding transcriptional regulator FruR; Provisional 90.57
PRK10423327 transcriptional repressor RbsR; Provisional 95.09
PRK10401346 DNA-binding transcriptional regulator GalS; Provisional 93.51
PRK13337 305 putative lipid kinase; Reviewed 90.62
cd06310 273 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding 92.35
pfam00532281 Peripla_BP_1 family. This family includes the periplasm 92.16
>PRK00061 ribH riboflavin synthase subunit beta; Provisional Back     alignment and domain information
>PRK12419 riboflavin synthase subunit beta; Provisional Back     alignment and domain information
>pfam00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase Back     alignment and domain information
>COG0054 RibH Riboflavin synthase beta-chain [Coenzyme metabolism] Back     alignment and domain information
>TIGR00114 lumazine-synth 6,7-dimethyl-8-ribityllumazine synthase; InterPro: IPR002180 This family includes the beta chain of 6,7-dimethyl-8-ribityllumazine synthase 2 Back     alignment and domain information
>KOG3243 consensus Back     alignment and domain information
>PRK06455 riboflavin synthase; Provisional Back     alignment and domain information
>COG1731 Archaeal riboflavin synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01506 ribC_arch riboflavin synthase; InterPro: IPR006399 These archaeal proteins, bacterial riboflavin biosynthesis alpha chain, catalyze the final step in riboflavin biosynthesis Back     alignment and domain information
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria Back     alignment and domain information
>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs Back     alignment and domain information
>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK11041 DNA-binding transcriptional regulator CytR; Provisional Back     alignment and domain information
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR) Back     alignment and domain information
>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia Back     alignment and domain information
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>PRK13337 putative lipid kinase; Reviewed Back     alignment and domain information
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>pfam00532 Peripla_BP_1 family Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target149 riboflavin synthase subunit beta [Candidatus Liberibact
1vsw_A153 Crystal Structure Of Lumazine Synthase From Bacillu 1e-34
1rvv_A154 SynthaseRIBOFLAVIN SYNTHASE COMPLEX OF BACILLUS SUB 1e-33
3mk3_A156 Crystal Structure Of Lumazine Synthase From Salmone 1e-30
1hqk_A154 Crystal Structure Analysis Of Lumazine Synthase Fro 5e-30
2o6h_A157 Lumazine Synthase Ribh1 From Brucella Melitensis (G 8e-30
1c2y_A156 Crystal Structures Of A Pentameric Fungal And An Ic 4e-29
2f59_A157 Lumazine Synthase Ribh1 From Brucella Abortus (Gene 5e-29
2jfb_A164 3d Structure Of Lumazine Synthase From Candida Albi 6e-25
1c41_A200 Crystal Structures Of A Pentameric Fungal And An Ic 2e-22
1ejb_A168 Lumazine Synthase From Saccharomyces Cerevisiae Len 4e-22
1kz9_A159 Mutant Enzyme L119f Lumazine Synthase From S.Pombe 4e-22
1kz6_A159 Mutant Enzyme W63yL119F LUMAZINE SYNTHASE FROM S.PO 9e-22
1kyv_A159 Lumazine Synthase From S.Pombe Bound To Riboflavin 3e-21
1kz4_A159 Mutant Enzyme W63y Lumazine Synthase From S.Pombe L 6e-21
2a57_A159 Structure Of 6,7-Dimthyl-8-Ribityllumazine Synthase 6e-21
1w19_A160 Lumazine Synthase From Mycobacterium Tuberculosis B 3e-20
1kz1_A159 Mutant Enzyme W27g Lumazine Synthase From S.Pombe L 5e-19
1di0_A158 Crystal Structure Of Lumazine Synthase From Brucell 1e-17
1t13_A158 Crystal Structure Of Lumazine Synthase From Brucell 1e-17
2obx_A157 Lumazine Synthase Ribh2 From Mesorhizobium Loti (Ge 2e-17
gi|311771805|pdb|1VSW|A Chain A, Crystal Structure Of Lumazine Synthase From Bacillus Anthracis Length = 153 Back     alignment and structure
 Score =  149 bits (376), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 41/145 (28%), Positives = 70/145 (48%), Gaps = 7/145 (4%)

Query: 7   HVLIIEARFYENLSAMLFEGCVNVLHSRAV---QWSSIVTPGVLEIPAAVSMVMNAKTRS 63
            V ++  RF E +++ L  G ++ L    V          PG  EIP     + N    S
Sbjct: 13  KVGVVVGRFNEFITSKLLGGALDGLKRHGVEENDIDVAWVPGAFEIPLIAKKMAN----S 68

Query: 64  VTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVS 123
             YD +I LG V+RG T H D + + V +G+  LS+   +P+  G++  ++ +QA +R  
Sbjct: 69  GKYDAVITLGTVIRGATTHYDYVCNEVAKGVASLSLQTDIPVIFGVLTTETIEQAIERAG 128

Query: 124 PSHLDRGGCAARSALAMIELKKSLS 148
               ++G  +A +A+ M  L K  +
Sbjct: 129 TKAGNKGYESAVAAIEMAHLSKHWA 153


gi|1942903|pdb|1RVV|A Chain A, SynthaseRIBOFLAVIN SYNTHASE COMPLEX OF BACILLUS SUBTILIS Length = 154 Back     alignment and structure
gi|321159798|pdb|3MK3|A Chain A, Crystal Structure Of Lumazine Synthase From Salmonella Typhimurium Lt2 Length = 156 Back     alignment and structure
gi|18159011|pdb|1HQK|A Chain A, Crystal Structure Analysis Of Lumazine Synthase From Aquifex Aeolicus Length = 154 Back     alignment and structure
gi|157835491|pdb|2O6H|A Chain A, Lumazine Synthase Ribh1 From Brucella Melitensis (Gene Bmei1187, Swiss-Prot Entry Q8ygh2) Complexed With Inhibitor 5-Nitro-6-(D-Ribitylamino)-2,4(1h,3h) Pyrimidinedione Length = 157 Back     alignment and structure
>gi|9954974|pdb|1C2Y|A Chain A, Crystal Structures Of A Pentameric Fungal And An Icosahedral Plant Lumazine Synthase Reveals The Structural Basis For Differences In Assembly Length = 156 Back     alignment and structure
gi|119389424|pdb|2F59|A Chain A, Lumazine Synthase Ribh1 From Brucella Abortus (Gene Bruab1_0785, Swiss-Prot Entry Q57dy1) Complexed With Inhibitor 5-Nitro-6-(D-Ribitylamino)-2,4(1h,3h) Pyrimidinedione Length = 157 Back     alignment and structure
>gi|146386557|pdb|2JFB|A Chain A, 3d Structure Of Lumazine Synthase From Candida Albicans Length = 164 Back     alignment and structure
gi|10121040|pdb|1C41|A Chain A, Crystal Structures Of A Pentameric Fungal And An Icosahedral Plant Lumazine Synthase Reveals The Structural Basis For Differences In Assembly Length = 200 Back     alignment and structure
>gi|13399523|pdb|1EJB|A Chain A, Lumazine Synthase From Saccharomyces Cerevisiae Length = 168 Back     alignment and structure
>gi|22219162|pdb|1KZ9|A Chain A, Mutant Enzyme L119f Lumazine Synthase From S.Pombe Length = 159 Back     alignment and structure
>gi|22219157|pdb|1KZ6|A Chain A, Mutant Enzyme W63yL119F LUMAZINE SYNTHASE FROM S.POMBE Length = 159 Back     alignment and structure
gi|22219132|pdb|1KYV|A Chain A, Lumazine Synthase From S.Pombe Bound To Riboflavin Length = 159 Back     alignment and structure
>gi|22219152|pdb|1KZ4|A Chain A, Mutant Enzyme W63y Lumazine Synthase From S.Pombe Length = 159 Back     alignment and structure
>gi|73536119|pdb|2A57|A Chain A, Structure Of 6,7-Dimthyl-8-Ribityllumazine Synthase From Schizosaccharomyces Pombe Mutant W27y With Bound Ligand 6- Carboxyethyl-7-Oxo-8-Ribityllumazine Length = 159 Back     alignment and structure
gi|62738172|pdb|1W19|A Chain A, Lumazine Synthase From Mycobacterium Tuberculosis Bound To 3-(1,3,7-Trihydro-9-D-Ribityl-2,6,8-Purinetrione-7-Yl) Propane 1-Phosphate Length = 160 Back     alignment and structure
>gi|22219147|pdb|1KZ1|A Chain A, Mutant Enzyme W27g Lumazine Synthase From S.Pombe Length = 159 Back     alignment and structure
>gi|7766957|pdb|1DI0|A Chain A, Crystal Structure Of Lumazine Synthase From Brucella Abortus Length = 158 Back     alignment and structure
gi|66360137|pdb|1T13|A Chain A, Crystal Structure Of Lumazine Synthase From Brucella Abortus Bound To 5-Nitro-6-(D-Ribitylamino)-2,4(1h,3h) Pyrimidinedione Length = 158 Back     alignment and structure
gi|157835518|pdb|2OBX|A Chain A, Lumazine Synthase Ribh2 From Mesorhizobium Loti (Gene Mll7281, Swiss-Prot Entry Q986n2) Complexed With Inhibitor 5-Nitro-6-(D-Ribitylamino)-2,4(1h,3h) Pyrimidinedione Length = 157 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target149 riboflavin synthase subunit beta [Candidatus Liberibact
1ejb_A168 Lumazine synthase; analysis, inhibitor complex, vitamin 4e-29
1hqk_A154 6,7-dimethyl-8-ribityllumazine synthase; analysis, enzy 2e-28
2i0f_A157 6,7-dimethyl-8-ribityllumazine synthase 1; lumazine syn 2e-26
1kz1_A159 6,7-dimethyl-8-ribityllumazine synthase; riboflavin bio 1e-25
1c41_A200 Lumazine synthase; riboflavin biosynthesis; HET: LMZ; 3 2e-23
1rvv_A154 Riboflavin synthase; transferase, flavoprotein; HET: IN 3e-23
2obx_A157 DMRL synthase 1, 6,7-dimethyl-8-ribityllumazine synthas 1e-21
1c2y_A156 Protein (lumazine synthase); riboflavin biosynthesis; H 4e-21
1di0_A158 Lumazine synthase; transferase; 2.70A {Brucella abortus 7e-21
2c92_A160 6,7-dimethyl-8-ribityllumazine synthase; transferase, r 2e-20
2b99_A156 Riboflavin synthase; lumazine riboflavin, transferase; 2e-18
>1ejb_A Lumazine synthase; analysis, inhibitor complex, vitamin biosynthesis transferase; HET: INJ; 1.85A {Saccharomyces cerevisiae} SCOP: c.16.1.1 PDB: 2jfb_A Length = 168 Back     alignment and structure
 Score =  122 bits (307), Expect = 4e-29
 Identities = 35/147 (23%), Positives = 64/147 (43%), Gaps = 8/147 (5%)

Query: 7   HVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVT---PGVLEIPAAVS-MVMNAKTR 62
            V II AR+   +   L +G +  + S  V+ ++I+    PG  E+P      V      
Sbjct: 18  RVGIIHARWNRVIIDALVKGAIERMASLGVEENNIIIETVPGSYELPWGTKRFVDRQAKL 77

Query: 63  SVTYDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRV 122
               D +I +GV+++G T H + I+ + T  L++L     +P+  G++   +E+QA  R 
Sbjct: 78  GKPLDVVIPIGVLIKGSTMHFEYISDSTTHALMNLQEKVDMPVIFGLLTCMTEEQALARA 137

Query: 123 SPSH----LDRGGCAARSALAMIELKK 145
                    + G     +A+ M     
Sbjct: 138 GIDEAHSMHNHGEDWGAAAVEMAVKFG 164


>1hqk_A 6,7-dimethyl-8-ribityllumazine synthase; analysis, enzyme stability, vitamin biosynthesis, transferase; 1.60A {Aquifex aeolicus} SCOP: c.16.1.1 PDB: 1nqu_A* 1nqv_A* 1nqw_A* 1nqx_A* Length = 154 Back     alignment and structure
>2i0f_A 6,7-dimethyl-8-ribityllumazine synthase 1; lumazine synthase RIBH1, transferase; 2.22A {Brucella abortus} PDB: 2f59_A 2o6h_A* Length = 157 Back     alignment and structure
>1kz1_A 6,7-dimethyl-8-ribityllumazine synthase; riboflavin biosynthesis, ligand binding, transferase; 2.00A {Schizosaccharomyces pombe} SCOP: c.16.1.1 PDB: 2a59_A* 2a58_A* 2a57_A* 1kyv_A* 1kyx_A* 1kyy_A* 1kz9_A 1kz4_A 1kz6_A Length = 159 Back     alignment and structure
>1c41_A Lumazine synthase; riboflavin biosynthesis; HET: LMZ; 3.10A {Magnaporthe grisea} SCOP: c.16.1.1 Length = 200 Back     alignment and structure
>1rvv_A Riboflavin synthase; transferase, flavoprotein; HET: INI; 2.40A {Bacillus subtilis} SCOP: c.16.1.1 PDB: 1zis_A* Length = 154 Back     alignment and structure
>2obx_A DMRL synthase 1, 6,7-dimethyl-8-ribityllumazine synthase 1, riboflavin; alpha-beta, transferase; HET: INI; 2.53A {Mesorhizobium loti} Length = 157 Back     alignment and structure
>1c2y_A Protein (lumazine synthase); riboflavin biosynthesis; HET: LMZ; 3.30A {Spinacia oleracea} SCOP: c.16.1.1 Length = 156 Back     alignment and structure
>1di0_A Lumazine synthase; transferase; 2.70A {Brucella abortus} SCOP: c.16.1.1 PDB: 1t13_A* 1xn1_A Length = 158 Back     alignment and structure
>2c92_A 6,7-dimethyl-8-ribityllumazine synthase; transferase, riboflavin biosynthesis, inhibitor binding; HET: TP6; 1.6A {Mycobacterium tuberculosis} PDB: 1w29_A* 1w19_A* 2c94_A* 2c97_A* 2c9b_A* 2c9d_A* 2vi5_A* Length = 160 Back     alignment and structure
>2b99_A Riboflavin synthase; lumazine riboflavin, transferase; HET: RDL; 2.22A {Methanocaldococcus jannaschii} PDB: 2b98_A* Length = 156 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target149 riboflavin synthase subunit beta [Candidatus Liberibact
2i0f_A157 6,7-dimethyl-8-ribityllumazine synthase 1; lumazine syn 100.0
1c2y_A156 Protein (lumazine synthase); riboflavin biosynthesis, t 100.0
1hqk_A154 6,7-dimethyl-8-ribityllumazine synthase; analysis, enzy 100.0
1rvv_A154 Riboflavin synthase; transferase, flavoprotein; HET: IN 100.0
1c41_A200 Lumazine synthase; riboflavin biosynthesis, transferase 100.0
2c92_A160 6,7-dimethyl-8-ribityllumazine synthase; transferase, r 100.0
1ejb_A168 Lumazine synthase; analysis, inhibitor complex, vitamin 100.0
2obx_A157 DMRL synthase 1, 6,7-dimethyl-8-ribityllumazine synthas 100.0
1di0_A158 Lumazine synthase; transferase; 2.70A {Brucella abortus 100.0
1kz1_A159 6,7-dimethyl-8-ribityllumazine synthase; riboflavin bio 100.0
2b99_A156 Riboflavin synthase; lumazine riboflavin, transferase; 100.0
3c3k_A285 Alanine racemase; structural genomics, protein structur 94.58
3gyb_A280 Transcriptional regulators (LACI-family transcriptional 94.4
3g85_A289 Transcriptional regulator (LACI family); transcription 94.0
3gv0_A288 Transcriptional regulator, LACI family; transcription r 93.09
3jvd_A333 Transcriptional regulators; structural genomics, PSI-2, 91.92
2ioy_A283 Periplasmic sugar-binding protein; ribose binding prote 91.32
3hcw_A295 Maltose operon transcriptional repressor; RNA-binding, 95.31
1u9c_A224 APC35852; structural genomics, protein structure initia 94.34
3egc_A291 Putative ribose operon repressor; structural genomics, 92.92
2fn9_A 290 Ribose ABC transporter, periplasmic ribose- binding pro 94.86
>2i0f_A 6,7-dimethyl-8-ribityllumazine synthase 1; lumazine synthase RIBH1, transferase; 2.22A {Brucella abortus} PDB: 2f59_A 2o6h_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=348.55  Aligned_cols=146  Identities=40%  Similarity=0.748  Sum_probs=139.4

Q ss_pred             CCCCEEEEEEECHHHHHHHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHH-HCCCCCCEEEEEEEEECCCCC
Q ss_conf             6587179998031289999999999999998799555553001442269999998633-113785356654120006652
Q gi|254780346|r    3 VFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAK-TRSVTYDGIIVLGVVMRGKTA   81 (149)
Q Consensus         3 ~~~~kI~IV~s~~~~~i~~~ll~ga~~~l~~~~~~~~~i~VPGa~EiP~a~~~~~~~~-~~~~~~D~vIaLG~VIkGeT~   81 (149)
                      ...+||+||.|+||++|+++|+++|.+.|++.|+++++++||||||||+++++++++. ..+.+|||+|+|||||||||+
T Consensus        10 ~~~~kI~IV~s~~n~~It~~l~~~a~~~L~~~g~~~~~i~VPGa~EiP~~~~~~~~~~~~~~~~~d~vIalG~VIkGeT~   89 (157)
T 2i0f_A           10 ADAPHLLIVEARFYDDLADALLDGAKAALDEAGATYDVVTVPGALEIPATISFALDGADNGGTEYDGFVALGTVIRGETY   89 (157)
T ss_dssp             -CCCEEEEEEECSSHHHHHHHHHHHHHHHHHTTCEEEEEEESSGGGHHHHHHHHHHHHHTTCCCCSEEEEEEEEECCSSS
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCCCC
T ss_conf             89998999977488899999999999999986997589996607665899999998744036775789998878738883


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             4678999999999999974399705654255889999995065657456999999999999998636
Q gi|254780346|r   82 HCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLS  148 (149)
Q Consensus        82 H~e~I~~~v~~gl~~lsl~~~~PI~~gILt~~n~~QA~~R~~~~~~nkG~eaa~Aal~mi~l~~~l~  148 (149)
                      |||+||++|++|||++|+++++||+||||||+|++||++|++++.+|||.|||+||++|++++|+|+
T Consensus        90 H~e~I~~~v~~gl~~lsl~~~~PI~~GILT~~n~~QA~~R~~~~~~nkG~eaA~Aal~mi~l~~~l~  156 (157)
T 2i0f_A           90 HFDIVSNESCRALTDLSVEESIAIGNGILTVENEEQAWVHARREDKDKGGFAARAALTMIGLRKKFG  156 (157)
T ss_dssp             TTHHHHHHHHHHHHHHHHHTTCCEEEEEEEESSHHHHHHHHCTTTTCHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             5899999999999999721699779997068999999998286666768999999999999998748



>1c2y_A Protein (lumazine synthase); riboflavin biosynthesis, transferase; HET: LMZ; 3.30A {Spinacia oleracea} SCOP: c.16.1.1 Back     alignment and structure
>1hqk_A 6,7-dimethyl-8-ribityllumazine synthase; analysis, enzyme stability, vitamin biosynthesis, transferase; 1.60A {Aquifex aeolicus} SCOP: c.16.1.1 PDB: 1nqu_A* 1nqv_A* 1nqw_A* 1nqx_A* Back     alignment and structure
>1rvv_A Riboflavin synthase; transferase, flavoprotein; HET: INI; 2.40A {Bacillus subtilis} SCOP: c.16.1.1 PDB: 1zis_A* Back     alignment and structure
>1c41_A Lumazine synthase; riboflavin biosynthesis, transferase; HET: LMZ; 3.10A {Magnaporthe grisea} SCOP: c.16.1.1 Back     alignment and structure
>2c92_A 6,7-dimethyl-8-ribityllumazine synthase; transferase, riboflavin biosynthesis, inhibitor binding; HET: TP6; 1.6A {Mycobacterium tuberculosis} PDB: 1w29_A* 1w19_A* 2c94_A* 2c97_A* 2c9b_A* 2c9d_A* 2vi5_A* Back     alignment and structure
>1ejb_A Lumazine synthase; analysis, inhibitor complex, vitamin biosynthesis transferase; HET: INJ; 1.85A {Saccharomyces cerevisiae} SCOP: c.16.1.1 PDB: 2jfb_A Back     alignment and structure
>2obx_A DMRL synthase 1, 6,7-dimethyl-8-ribityllumazine synthase 1, riboflavin; alpha-beta, transferase; HET: INI; 2.53A {Mesorhizobium loti} Back     alignment and structure
>1di0_A Lumazine synthase; transferase; 2.70A {Brucella abortus} SCOP: c.16.1.1 PDB: 1t13_A* 1xn1_A Back     alignment and structure
>1kz1_A 6,7-dimethyl-8-ribityllumazine synthase; riboflavin biosynthesis, ligand binding, transferase; 2.00A {Schizosaccharomyces pombe} SCOP: c.16.1.1 PDB: 2a59_A* 2a58_A* 2a57_A* 1kyv_A* 1kyx_A* 1kyy_A* 1kz9_A 1kz4_A 1kz6_A Back     alignment and structure
>2b99_A Riboflavin synthase; lumazine riboflavin, transferase; HET: RDL; 2.22A {Methanocaldococcus jannaschii} PDB: 2b98_A* Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.99A {Actinobacillus succinogenes 130Z} Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3g85_A Transcriptional regulator (LACI family); transcription regulator, PSI-II, structural genomics, protein structure initiative; 1.84A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics, protein structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcription regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, parkinson'S disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcription, transcription regulation; 2.35A {Burkholderia thailandensis E264} Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose- binding protein; RBP, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima MSB8} PDB: 2fn8_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 149 riboflavin synthase subunit beta [Candidatus Liberibact
d1c41a_195 c.16.1.1 (A:) Lumazine synthase {Rice blast fungus (Mag 2e-24
d1rvv1_154 c.16.1.1 (1:) Lumazine synthase {Bacillus subtilis [Tax 4e-24
d1ejba_168 c.16.1.1 (A:) Lumazine synthase {Baker's yeast (Sacchar 5e-24
d1nqua_154 c.16.1.1 (A:) Lumazine synthase {Aquifex aeolicus [TaxI 5e-22
d1c2ya_155 c.16.1.1 (A:) Lumazine synthase {Spinach (Spinacia oler 5e-22
d1di0a_148 c.16.1.1 (A:) Lumazine synthase {Brucella abortus [TaxI 4e-21
d1kz1a_150 c.16.1.1 (A:) Lumazine synthase {Fission yeast (Schizos 3e-19
>d1c41a_ c.16.1.1 (A:) Lumazine synthase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 195 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Lumazine synthase
superfamily: Lumazine synthase
family: Lumazine synthase
domain: Lumazine synthase
species: Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]
 Score =  105 bits (262), Expect = 2e-24
 Identities = 37/180 (20%), Positives = 72/180 (40%), Gaps = 37/180 (20%)

Query: 7   HVLIIEARFYENLSAMLFEGCVNVLHSRAV---QWSSIVTPGVLEIPAAVSMVMNAKT-- 61
            + I+ AR+ E +   L  G    L +  V          PG  E+P AV  + +A    
Sbjct: 13  RIGIVHARWNETIIEPLLAGTKAKLLACGVKESNIVVQSVPGSWELPIAVQRLYSASQLQ 72

Query: 62  ------------------------------RSVTYDGIIVLGVVMRGKTAHCDVIAHAVT 91
                                          +  +D +I +GV+++G+T H + IA +V+
Sbjct: 73  TPSSGPSLSAGDLLGSSTTDLTALPTTTASSTGPFDALIAIGVLIKGETMHFEYIADSVS 132

Query: 92  RGLVDLSINGSLPIGNGIVVVDSEQQAFDR--VSPSHLDRGGCAARSALAMIELKKSLSE 149
            GL+ + ++  +P+  G++ V ++ QA  R  V     + G     +A+ M   ++  + 
Sbjct: 133 HGLMRVQLDTGVPVIFGVLTVLTDDQAKARAGVIEGSHNHGEDWGLAAVEMGVRRRDWAA 192


>d1rvv1_ c.16.1.1 (1:) Lumazine synthase {Bacillus subtilis [TaxId: 1423]} Length = 154 Back     information, alignment and structure
>d1ejba_ c.16.1.1 (A:) Lumazine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 168 Back     information, alignment and structure
>d1nqua_ c.16.1.1 (A:) Lumazine synthase {Aquifex aeolicus [TaxId: 63363]} Length = 154 Back     information, alignment and structure
>d1c2ya_ c.16.1.1 (A:) Lumazine synthase {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 155 Back     information, alignment and structure
>d1di0a_ c.16.1.1 (A:) Lumazine synthase {Brucella abortus [TaxId: 235]} Length = 148 Back     information, alignment and structure
>d1kz1a_ c.16.1.1 (A:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 150 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target149 riboflavin synthase subunit beta [Candidatus Liberibact
d1c2ya_155 Lumazine synthase {Spinach (Spinacia oleracea) [TaxId: 100.0
d1nqua_154 Lumazine synthase {Aquifex aeolicus [TaxId: 63363]} 100.0
d1c41a_195 Lumazine synthase {Rice blast fungus (Magnaporthe grise 100.0
d1rvv1_154 Lumazine synthase {Bacillus subtilis [TaxId: 1423]} 100.0
d1ejba_168 Lumazine synthase {Baker's yeast (Saccharomyces cerevis 100.0
d1di0a_148 Lumazine synthase {Brucella abortus [TaxId: 235]} 100.0
d1kz1a_150 Lumazine synthase {Fission yeast (Schizosaccharomyces p 100.0
d1dbqa_ 282 Purine repressor (PurR), C-terminal domain {Escherichia 91.86
>d1c2ya_ c.16.1.1 (A:) Lumazine synthase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Lumazine synthase
superfamily: Lumazine synthase
family: Lumazine synthase
domain: Lumazine synthase
species: Spinach (Spinacia oleracea) [TaxId: 3562]
Probab=100.00  E-value=0  Score=337.59  Aligned_cols=143  Identities=24%  Similarity=0.413  Sum_probs=135.2

Q ss_pred             CCCCEEEEEEECHHHHHHHHHHHHHHHHHHHCCCC--EEEEEHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCC
Q ss_conf             65871799980312899999999999999987995--5555300144226999999863311378535665412000665
Q gi|254780346|r    3 VFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQ--WSSIVTPGVLEIPAAVSMVMNAKTRSVTYDGIIVLGVVMRGKT   80 (149)
Q Consensus         3 ~~~~kI~IV~s~~~~~i~~~ll~ga~~~l~~~~~~--~~~i~VPGa~EiP~a~~~~~~~~~~~~~~D~vIaLG~VIkGeT   80 (149)
                      -...||+||.|+||++|+++|++||.+.|+++|++  ++.++||||||+|++++++++    +++|||+|||||||||||
T Consensus        11 ~~~~ki~IV~s~~n~~It~~L~~ga~~~l~~~g~~~~i~~~~VPGa~EiP~~~~~l~~----~~~~daiIaLG~VIkGeT   86 (155)
T d1c2ya_          11 AQSFRFAIVVARFNEFVTRRLMEGALDTFKKYSVNEDIDVVWVPGAYELGVTAQALGK----SGKYHAIVCLGAVVKGDT   86 (155)
T ss_dssp             CTTCCEEEEEESTTHHHHHHHHHHHHHHHHHTTCCSCCEEEEESSHHHHHHHHHHHHH----TTCCSEEEEEEECCCCSS
T ss_pred             CCCCEEEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCHHHHHHHHHHHHH----CCCCCEEEEEEEEECCCC
T ss_conf             8897899999437699999999999999998399977189994437888999999985----379884999989970786


Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCC
Q ss_conf             246789999999999999743997056542558899999950656574569999999999999986369
Q gi|254780346|r   81 AHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLSE  149 (149)
Q Consensus        81 ~H~e~I~~~v~~gl~~lsl~~~~PI~~gILt~~n~~QA~~R~~~~~~nkG~eaa~Aal~mi~l~~~l~~  149 (149)
                      +|||+||+++++|||++|+++++||+||||||+|++||++|++++.+|||.|||+||++|++|+|++-|
T Consensus        87 ~H~e~I~~~v~~gl~~lsl~~~~PV~~GILT~~n~~QA~~R~~~~~~nkG~eaa~aal~m~~l~~~~~k  155 (155)
T d1c2ya_          87 SHYDAVVNSASSGVLSAGLNSGVPCVFGVLTCDNMDQAINRAGGKAGNKGAESALTAIEMASLFEHHLK  155 (155)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHTSCEEEEEECCSSHHHHHHHEEETTEEHHHHHHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCC
T ss_conf             188899999999999997441998796224889889999884664345799999999999999998519



>d1nqua_ c.16.1.1 (A:) Lumazine synthase {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1c41a_ c.16.1.1 (A:) Lumazine synthase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1rvv1_ c.16.1.1 (1:) Lumazine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ejba_ c.16.1.1 (A:) Lumazine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1di0a_ c.16.1.1 (A:) Lumazine synthase {Brucella abortus [TaxId: 235]} Back     information, alignment and structure
>d1kz1a_ c.16.1.1 (A:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 149 riboflavin synthase subunit beta [Candidatus Liber
2i0f_A_157 (A:) 6,7-dimethyl-8-ribityllumazine synthase 1; lu 3e-30
1rvv_A_154 (A:) Riboflavin synthase; transferase, flavoprotei 3e-28
1hqk_A_154 (A:) 6,7-dimethyl-8-ribityllumazine synthase; anal 4e-28
1ejb_A_168 (A:) Lumazine synthase; analysis, inhibitor comple 6e-28
1c2y_A_156 (A:) Protein (lumazine synthase); riboflavin biosy 9e-28
2c92_A_160 (A:) 6,7-dimethyl-8-ribityllumazine synthase; tran 9e-28
1di0_A_158 (A:) Lumazine synthase; transferase; 2.70A {Brucel 1e-27
2obx_A_157 (A:) DMRL synthase 1, 6,7-dimethyl-8-ribityllumazi 2e-27
1kz1_A_159 (A:) 6,7-dimethyl-8-ribityllumazine synthase; ribo 5e-27
1c41_A_200 (A:) Lumazine synthase; riboflavin biosynthesis; H 8e-27
2b99_A_156 (A:) Riboflavin synthase; lumazine riboflavin, tra 4e-23
>2i0f_A (A:) 6,7-dimethyl-8-ribityllumazine synthase 1; lumazine synthase RIBH1, transferase; 2.22A {Brucella abortus} PDB: 2f59_A 2o6h_A*Length = 157 Back     alignment and structure
 Score =  125 bits (315), Expect = 3e-30
 Identities = 57/142 (40%), Positives = 83/142 (58%), Gaps = 1/142 (0%)

Query: 7   HVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIP-AAVSMVMNAKTRSVT 65
           H+LI+EARFY++L+  L +G    L      +  +  PG LEIP      +  A      
Sbjct: 14  HLLIVEARFYDDLADALLDGAKAALDEAGATYDVVTVPGALEIPATISFALDGADNGGTE 73

Query: 66  YDGIIVLGVVMRGKTAHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPS 125
           YDG + LG V+RG+T H D++++   R L DLS+  S+ IGNGI+ V++E+QA+      
Sbjct: 74  YDGFVALGTVIRGETYHFDIVSNESCRALTDLSVEESIAIGNGILTVENEEQAWVHARRE 133

Query: 126 HLDRGGCAARSALAMIELKKSL 147
             D+GG AAR+AL MI L+K  
Sbjct: 134 DKDKGGFAARAALTMIGLRKKF 155


>1rvv_A (A:) Riboflavin synthase; transferase, flavoprotein; HET: INI; 2.40A {Bacillus subtilis}Length = 154 Back     alignment and structure
>1hqk_A (A:) 6,7-dimethyl-8-ribityllumazine synthase; analysis, enzyme stability, vitamin biosynthesis, transferase; 1.60A {Aquifex aeolicus}Length = 154 Back     alignment and structure
>1ejb_A (A:) Lumazine synthase; analysis, inhibitor complex, vitamin biosynthesis transferase; HET: INJ; 1.85A {Saccharomyces cerevisiae}Length = 168 Back     alignment and structure
>1c2y_A (A:) Protein (lumazine synthase); riboflavin biosynthesis; HET: LMZ; 3.30A {Spinacia oleracea}Length = 156 Back     alignment and structure
>2c92_A (A:) 6,7-dimethyl-8-ribityllumazine synthase; transferase, riboflavin biosynthesis, inhibitor binding; HET: TP6; 1.6A {Mycobacterium tuberculosis} PDB: 1w29_A* 1w19_A* 2c94_A* 2c97_A* 2c9b_A* 2c9d_A* 2vi5_A*Length = 160 Back     alignment and structure
>1di0_A (A:) Lumazine synthase; transferase; 2.70A {Brucella abortus}Length = 158 Back     alignment and structure
>2obx_A (A:) DMRL synthase 1, 6,7-dimethyl-8-ribityllumazine synthase 1, riboflavin; alpha-beta, transferase; HET: INI; 2.53A {Mesorhizobium loti}Length = 157 Back     alignment and structure
>1kz1_A (A:) 6,7-dimethyl-8-ribityllumazine synthase; riboflavin biosynthesis, ligand binding, transferase; 2.00A {Schizosaccharomyces pombe}Length = 159 Back     alignment and structure
>1c41_A (A:) Lumazine synthase; riboflavin biosynthesis; HET: LMZ; 3.10A {Magnaporthe grisea}Length = 200 Back     alignment and structure
>2b99_A (A:) Riboflavin synthase; lumazine riboflavin, transferase; HET: RDL; 2.22A {Methanocaldococcus jannaschii} PDB: 2b98_A*Length = 156 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target149 riboflavin synthase subunit beta [Candidatus Liberibact
2i0f_A_157 6,7-dimethyl-8-ribityllumazine synthase 1; lumazin 100.0
1c41_A_200 Lumazine synthase; riboflavin biosynthesis; HET: L 100.0
1c2y_A_156 Protein (lumazine synthase); riboflavin biosynthes 100.0
1ejb_A_168 Lumazine synthase; analysis, inhibitor complex, vi 100.0
1hqk_A_154 6,7-dimethyl-8-ribityllumazine synthase; analysis, 100.0
1rvv_A_154 Riboflavin synthase; transferase, flavoprotein; HE 100.0
2c92_A_160 6,7-dimethyl-8-ribityllumazine synthase; transfera 100.0
2obx_A_157 DMRL synthase 1, 6,7-dimethyl-8-ribityllumazine sy 100.0
1kz1_A_159 6,7-dimethyl-8-ribityllumazine synthase; riboflavi 100.0
1di0_A_158 Lumazine synthase; transferase; 2.70A {Brucella ab 100.0
2b99_A_156 Riboflavin synthase; lumazine riboflavin, transfer 100.0
1dbq_A_1-109_242-289157 Purine repressor; transcription regulation, DNA-bi 95.23
2dri_A_1-104_237-271139 D-ribose-binding protein; sugar transport; HET: RI 94.91
2fep_A_1-116_250-289156 Catabolite control protein A; CCPA, transcriptiona 94.9
3jy6_A_1-106_224-276159 Transcriptional regulator, LACI family; NYSGXRC, P 94.69
2ioy_A_1-104_238-283150 Periplasmic sugar-binding protein; ribose binding 93.32
1qpz_A_58-160_293-340151 PURA, protein (purine nucleotide synthesis repress 93.01
3h5o_A_1-161_294-339207 Transcriptional regulator GNTR; transcription regu 91.71
3egc_A_1-108_241-291159 Putative ribose operon repressor; structural genom 90.35
3ksm_A_1-106_243-276140 ABC-type sugar transport system, periplasmic compo 90.05
3c3k_A_108-238131 Alanine racemase; structural genomics, protein str 95.53
3hcw_A_115-246132 Maltose operon transcriptional repressor; RNA-bind 93.86
3lft_A_118-235118 Uncharacterized protein; ABC, ATPase, cassette, L- 93.76
1gud_A_114-248135 ALBP, D-allose-binding periplasmic protein; peripl 93.52
2h3h_A_105-237_281-313166 Sugar ABC transporter, periplasmic sugar-binding p 93.41
2rjo_A_1-117_253-287152 Twin-arginine translocation pathway signal protein 93.08
3d02_A_109-244_291-303149 Putative LACI-type transcriptional regulator; peri 92.66
2ioy_A_105-237133 Periplasmic sugar-binding protein; ribose binding 92.19
3e61_A_1-100_232-251120 Putative transcriptional repressor of ribose opero 91.98
3ksm_A_107-242136 ABC-type sugar transport system, periplasmic compo 91.97
3h75_A_122-263142 Periplasmic sugar-binding domain protein; protein 91.67
3l6u_A_112-249138 ABC-type sugar transport system periplasmic compon 91.47
2fn9_A_1-106_247-290150 Ribose ABC transporter, periplasmic ribose- bindin 91.24
3d8u_A_103-223121 PURR transcriptional regulator; APC91343.1, vibrio 91.2
3jvd_A_1-157_286-333205 Transcriptional regulators; structural genomics, P 91.18
3brq_A_122-254133 HTH-type transcriptional regulator ASCG; transcrip 91.11
3dbi_A_164-296133 Sugar-binding transcriptional regulator, LACI fami 91.11
2vk2_A_1-108_251-276134 YTFQ, ABC transporter periplasmic-binding protein 91.03
3c3k_A_1-107_239-285154 Alanine racemase; structural genomics, protein str 90.93
2fn9_A_107-246140 Ribose ABC transporter, periplasmic ribose- bindin 90.49
8abp_A_1-109_256-284138 L-arabinose-binding protein; binding proteins; HET 90.18
2q62_A_247 ARSH; alpha/beta, flavoprotein; 1.80A {Sinorhizobi 91.15
3klb_A_162 Putative flavoprotein; structural genomics, joint 90.97
2iks_A_1-121_252-293163 DNA-binding transcriptional dual regulator; struct 90.83
3d8u_A_1-102_224-275154 PURR transcriptional regulator; APC91343.1, vibrio 90.24
>2i0f_A (A:) 6,7-dimethyl-8-ribityllumazine synthase 1; lumazine synthase RIBH1, transferase; 2.22A {Brucella abortus} PDB: 2f59_A 2o6h_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=333.24  Aligned_cols=147  Identities=41%  Similarity=0.753  Sum_probs=140.0

Q ss_pred             CCCCCEEEEEEECHHHHHHHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHC-CCCCCEEEEEEEEECCCC
Q ss_conf             6658717999803128999999999999999879955555300144226999999863311-378535665412000665
Q gi|254780346|r    2 EVFIPHVLIIEARFYENLSAMLFEGCVNVLHSRAVQWSSIVTPGVLEIPAAVSMVMNAKTR-SVTYDGIIVLGVVMRGKT   80 (149)
Q Consensus         2 ~~~~~kI~IV~s~~~~~i~~~ll~ga~~~l~~~~~~~~~i~VPGa~EiP~a~~~~~~~~~~-~~~~D~vIaLG~VIkGeT   80 (149)
                      +....||+||.|+||++|++.|++||.+.|+++|+++++++|||+||||+++++++++... ..+|||+|||||||||||
T Consensus         9 ~~~~~riaIV~s~fn~~i~~~l~~ga~~~l~~~g~~i~v~~VPGa~EiP~a~~~l~~~~~~~~~~yDaviaLG~VIrGeT   88 (157)
T 2i0f_A            9 EADAPHLLIVEARFYDDLADALLDGAKAALDEAGATYDVVTVPGALEIPATISFALDGADNGGTEYDGFVALGTVIRGET   88 (157)
T ss_dssp             --CCCEEEEEEECSSHHHHHHHHHHHHHHHHHTTCEEEEEEESSGGGHHHHHHHHHHHHHTTCCCCSEEEEEEEEECCSS
T ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEEECCC
T ss_conf             68999899997848789999999999999998699589998042655799999999862402566666998877872464


Q ss_pred             CHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             24678999999999999974399705654255889999995065657456999999999999998636
Q gi|254780346|r   81 AHCDVIAHAVTRGLVDLSINGSLPIGNGIVVVDSEQQAFDRVSPSHLDRGGCAARSALAMIELKKSLS  148 (149)
Q Consensus        81 ~H~e~I~~~v~~gl~~lsl~~~~PI~~gILt~~n~~QA~~R~~~~~~nkG~eaa~Aal~mi~l~~~l~  148 (149)
                      +||||||++|++|||++++++++||+|||||++|++||++|++++.+|||+|||+||++|++++|+|.
T Consensus        89 ~H~e~v~~~v~~gl~~v~l~~~~PV~~gvLt~~~~eQA~~R~~~~~~nkG~eaA~aalem~~l~~~l~  156 (157)
T 2i0f_A           89 YHFDIVSNESCRALTDLSVEESIAIGNGILTVENEEQAWVHARREDKDKGGFAARAALTMIGLRKKFG  156 (157)
T ss_dssp             STTHHHHHHHHHHHHHHHHHTTCCEEEEEEEESSHHHHHHHHCTTTTCHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHC
T ss_conf             05779999999999998752596189887137988999998375656668999999999999998748



>1c41_A (A:) Lumazine synthase; riboflavin biosynthesis; HET: LMZ; 3.10A {Magnaporthe grisea} Back     alignment and structure
>1c2y_A (A:) Protein (lumazine synthase); riboflavin biosynthesis; HET: LMZ; 3.30A {Spinacia oleracea} Back     alignment and structure
>1ejb_A (A:) Lumazine synthase; analysis, inhibitor complex, vitamin biosynthesis transferase; HET: INJ; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>1hqk_A (A:) 6,7-dimethyl-8-ribityllumazine synthase; analysis, enzyme stability, vitamin biosynthesis, transferase; 1.60A {Aquifex aeolicus} Back     alignment and structure
>1rvv_A (A:) Riboflavin synthase; transferase, flavoprotein; HET: INI; 2.40A {Bacillus subtilis} Back     alignment and structure
>2c92_A (A:) 6,7-dimethyl-8-ribityllumazine synthase; transferase, riboflavin biosynthesis, inhibitor binding; HET: TP6; 1.6A {Mycobacterium tuberculosis} PDB: 1w29_A* 1w19_A* 2c94_A* 2c97_A* 2c9b_A* 2c9d_A* 2vi5_A* Back     alignment and structure
>2obx_A (A:) DMRL synthase 1, 6,7-dimethyl-8-ribityllumazine synthase 1, riboflavin; alpha-beta, transferase; HET: INI; 2.53A {Mesorhizobium loti} Back     alignment and structure
>1kz1_A (A:) 6,7-dimethyl-8-ribityllumazine synthase; riboflavin biosynthesis, ligand binding, transferase; 2.00A {Schizosaccharomyces pombe} Back     alignment and structure
>1di0_A (A:) Lumazine synthase; transferase; 2.70A {Brucella abortus} Back     alignment and structure
>2b99_A (A:) Riboflavin synthase; lumazine riboflavin, transferase; HET: RDL; 2.22A {Methanocaldococcus jannaschii} PDB: 2b98_A* Back     alignment and structure
>1dbq_A (A:1-109,A:242-289) Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} Back     alignment and structure
>2dri_A (A:1-104,A:237-271) D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} Back     alignment and structure
>2fep_A (A:1-116,A:250-289) Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* Back     alignment and structure
>3jy6_A (A:1-106,A:224-276) Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein structure initiative, structural genomics; 1.97A {Lactobacillus brevis atcc 367} Back     alignment and structure
>2ioy_A (A:1-104,A:238-283) Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1qpz_A (A:58-160,A:293-340) PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} Back     alignment and structure
>3h5o_A (A:1-161,A:294-339) Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3egc_A (A:1-108,A:241-291) Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcription, transcription regulation; 2.35A {Burkholderia thailandensis E264} Back     alignment and structure
>3ksm_A (A:1-106,A:243-276) ABC-type sugar transport system, periplasmic component; PSI- II, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis kctc 2396} Back     alignment and structure
>3c3k_A (A:108-238) Alanine racemase; structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.99A {Actinobacillus succinogenes 130Z} Back     alignment and structure
>3hcw_A (A:115-246) Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3lft_A (A:118-235) Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>1gud_A (A:114-248) ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} Back     alignment and structure
>2h3h_A (A:105-237,A:281-313) Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* Back     alignment and structure
>2rjo_A (A:1-117,A:253-287) Twin-arginine translocation pathway signal protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: GAL; 2.05A {Burkholderia phytofirmans psjn} Back     alignment and structure
>3d02_A (A:109-244,A:291-303) Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structural genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ioy_A (A:105-237) Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3e61_A (A:1-100,A:232-251) Putative transcriptional repressor of ribose operon; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3ksm_A (A:107-242) ABC-type sugar transport system, periplasmic component; PSI- II, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis kctc 2396} Back     alignment and structure
>3h75_A (A:122-263) Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding protein, alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3l6u_A (A:112-249) ABC-type sugar transport system periplasmic component; structural genomics, nysgrc, target 11006S, PSI-2, protein structure initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>2fn9_A (A:1-106,A:247-290) Ribose ABC transporter, periplasmic ribose- binding protein; RBP, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima MSB8} PDB: 2fn8_A* Back     alignment and structure
>3d8u_A (A:103-223) PURR transcriptional regulator; APC91343.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>3jvd_A (A:1-157,A:286-333) Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcription regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure