254780347

254780347

riboflavin synthase subunit alpha

GeneID in NCBI database:8209332Locus tag:CLIBASIA_01160
Protein GI in NCBI database:254780347Protein Accession:YP_003064760.1
Gene range:-(242218, 242832)Protein Length:204aa
Gene description:riboflavin synthase subunit alpha
COG prediction:[H] Riboflavin synthase alpha chain
KEGG prediction:ribE; riboflavin synthase subunit alpha (EC:2.5.1.9); K00793 riboflavin synthase alpha chain [EC:2.5.1.9]
SEED prediction:Riboflavin synthase alpha chain (EC 2.5.1.9)
Pathway involved in KEGG:Riboflavin metabolism [PATH:las00740]
Subsystem involved in SEED:Riboflavin, FMN and FAD metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ
cccEEEEEEEEEEEEEEccccEEEEEEccccccccccccEEEEccEEEEEEEEccccccccEEEEEEEHHHHHHccccccccccEEEEEEccccccccccEEEEEEEccEEEEEEEEEcccEEEEEEEccHHHHcEEEcccEEEEccEEEEEEEEcccEEEEEEEEccHHHccHHHcccccEEEEEEHHHHHHHHHHHcccccc
ccccEEEEccEEEEEccccccEEEEEEEcccHHHccccccEEEccEEEEEEEEccccccccEEEEEEEHHHHHHcHHHHcccccEEEEEEccEcccccccccEcccccEEEEEEEEcccccEEEEEEEccHHHHHHcccccEEEEccEEEEcccEcccEEEEEEcHHHHHHccHHHcccccEEEEEEcHHHHHHHHHHHccccc
MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLseehsvdnwyEVEVWAETNRITNIASWGIGTFINLErsvklgdrldghlvsghidgtVEILFLDFIgdsmycrlslphnLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ
mftgivtdigkiiamtpiakgmrLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTieettwkmhkvgDLINIEVDSMMRYIARLYALNTSQ
MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ
MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIA**Y******
MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ
MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALN***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ
MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ
MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTSQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target204 riboflavin synthase subunit alpha [Candidatus Liberibac
315122229204 riboflavin synthase subunit alpha [Candidatus Liberibac 1 3e-96
15964964206 riboflavin synthase subunit alpha [Sinorhizobium melilo 1 1e-59
307317769206 riboflavin synthase, alpha subunit [Sinorhizobium melil 1 1e-59
150396043206 riboflavin synthase subunit alpha [Sinorhizobium medica 1 2e-59
116251388204 riboflavin synthase subunit alpha [Rhizobium leguminosa 1 8e-59
190891195203 riboflavin synthase, alpha chain [Rhizobium etli CIAT 6 1 1e-58
209548783203 riboflavin synthase subunit alpha [Rhizobium leguminosa 1 2e-58
327190086203 riboflavin synthase protein, alpha chain [Rhizobium etl 1 2e-58
241204004203 riboflavin synthase subunit alpha [Rhizobium leguminosa 1 1e-57
325292543203 Riboflavin synthase alpha chain [Agrobacterium sp. H13- 1 1e-57
>gi|315122229|ref|YP_004062718.1| riboflavin synthase subunit alpha [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 204 Back     alignment and organism information
 Score =  354 bits (909), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 165/200 (82%), Positives = 187/200 (93%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVD 60
           MFTGIVTDIG+IIA+ PIAKG+RLR+MTSY+TS M++GCSIAHAGICLTVV+LS+E SV+
Sbjct: 1   MFTGIVTDIGQIIAIMPIAKGLRLRLMTSYDTSTMRVGCSIAHAGICLTVVQLSDESSVN 60

Query: 61  NWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIG 120
           NWYEVE+W ETNR+TN+ +W IGTF+NLERS+KLGD LDGHLVSGH+DGTVEILF+DF G
Sbjct: 61  NWYEVEIWEETNRLTNVVAWEIGTFVNLERSMKLGDELDGHLVSGHVDGTVEILFMDFFG 120

Query: 121 DSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKVG 180
           DS+YCRLSLPHNLE+FIAVKGSVCLNGVSLTVNLVG NFFDVLLIRHTIE+TTW MHK G
Sbjct: 121 DSVYCRLSLPHNLEKFIAVKGSVCLNGVSLTVNLVGDNFFDVLLIRHTIEQTTWSMHKTG 180

Query: 181 DLINIEVDSMMRYIARLYAL 200
           DLINIEVDSMMRYI+RL A 
Sbjct: 181 DLINIEVDSMMRYISRLCAF 200


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15964964|ref|NP_385317.1| riboflavin synthase subunit alpha [Sinorhizobium meliloti 1021] Length = 206 Back     alignment and organism information
>gi|307317769|ref|ZP_07597207.1| riboflavin synthase, alpha subunit [Sinorhizobium meliloti AK83] Length = 206 Back     alignment and organism information
>gi|150396043|ref|YP_001326510.1| riboflavin synthase subunit alpha [Sinorhizobium medicae WSM419] Length = 206 Back     alignment and organism information
>gi|116251388|ref|YP_767226.1| riboflavin synthase subunit alpha [Rhizobium leguminosarum bv. viciae 3841] Length = 204 Back     alignment and organism information
>gi|190891195|ref|YP_001977737.1| riboflavin synthase, alpha chain [Rhizobium etli CIAT 652] Length = 203 Back     alignment and organism information
>gi|209548783|ref|YP_002280700.1| riboflavin synthase subunit alpha [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 203 Back     alignment and organism information
>gi|327190086|gb|EGE57201.1| riboflavin synthase protein, alpha chain [Rhizobium etli CNPAF512] Length = 203 Back     alignment and organism information
>gi|241204004|ref|YP_002975100.1| riboflavin synthase subunit alpha [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 203 Back     alignment and organism information
>gi|325292543|ref|YP_004278407.1| Riboflavin synthase alpha chain [Agrobacterium sp. H13-3] Length = 203 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target204 riboflavin synthase subunit alpha [Candidatus Liberibac
PRK09289194 PRK09289, PRK09289, riboflavin synthase subunit alpha; 1e-68
PRK13020206 PRK13020, PRK13020, riboflavin synthase subunit alpha; 5e-39
TIGR00187200 TIGR00187, ribE, riboflavin synthase, alpha subunit 5e-38
PLN02741194 PLN02741, PLN02741, riboflavin synthase 3e-32
KOG3310210 KOG3310, KOG3310, KOG3310, Riboflavin synthase alpha ch 5e-27
COG0307204 COG0307, RibC, Riboflavin synthase alpha chain [Coenzym 5e-53
pfam0067786 pfam00677, Lum_binding, Lumazine binding domain 1e-10
pfam0067786 pfam00677, Lum_binding, Lumazine binding domain 2e-05
>gnl|CDD|181760 PRK09289, PRK09289, riboflavin synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|183846 PRK13020, PRK13020, riboflavin synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|161753 TIGR00187, ribE, riboflavin synthase, alpha subunit Back     alignment and domain information
>gnl|CDD|178342 PLN02741, PLN02741, riboflavin synthase Back     alignment and domain information
>gnl|CDD|38520 KOG3310, KOG3310, KOG3310, Riboflavin synthase alpha chain [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|30655 COG0307, RibC, Riboflavin synthase alpha chain [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|144321 pfam00677, Lum_binding, Lumazine binding domain Back     alignment and domain information
>gnl|CDD|144321 pfam00677, Lum_binding, Lumazine binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 204 riboflavin synthase subunit alpha [Candidatus Liberibac
PRK09289198 riboflavin synthase subunit alpha; Provisional 100.0
PRK13020207 riboflavin synthase subunit alpha; Provisional 100.0
COG0307204 RibC Riboflavin synthase alpha chain [Coenzyme metaboli 100.0
TIGR00187225 ribE riboflavin synthase, alpha subunit; InterPro: IPR0 100.0
KOG3310210 consensus 100.0
pfam0067786 Lum_binding Lumazine binding domain. This domain binds 99.94
PRK13020 207 riboflavin synthase subunit alpha; Provisional 99.82
PRK09289198 riboflavin synthase subunit alpha; Provisional 99.81
TIGR00187 225 ribE riboflavin synthase, alpha subunit; InterPro: IPR0 99.81
KOG3310 210 consensus 99.51
pfam0067786 Lum_binding Lumazine binding domain. This domain binds 99.89
COG0307204 RibC Riboflavin synthase alpha chain [Coenzyme metaboli 99.76
>PRK09289 riboflavin synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13020 riboflavin synthase subunit alpha; Provisional Back     alignment and domain information
>COG0307 RibC Riboflavin synthase alpha chain [Coenzyme metabolism] Back     alignment and domain information
>TIGR00187 ribE riboflavin synthase, alpha subunit; InterPro: IPR001783 The following proteins have been shown , to be structurally and evolutionary related: Riboflavin synthase alpha chain (2 Back     alignment and domain information
>KOG3310 consensus Back     alignment and domain information
>pfam00677 Lum_binding Lumazine binding domain Back     alignment and domain information
>PRK13020 riboflavin synthase subunit alpha; Provisional Back     alignment and domain information
>PRK09289 riboflavin synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR00187 ribE riboflavin synthase, alpha subunit; InterPro: IPR001783 The following proteins have been shown , to be structurally and evolutionary related: Riboflavin synthase alpha chain (2 Back     alignment and domain information
>KOG3310 consensus Back     alignment and domain information
>pfam00677 Lum_binding Lumazine binding domain Back     alignment and domain information
>COG0307 RibC Riboflavin synthase alpha chain [Coenzyme metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target204 riboflavin synthase subunit alpha [Candidatus Liberibac
1i8d_A213 Crystal Structure Of Riboflavin Synthase Length = 2 7e-38
1kzl_A208 Riboflavin Synthase From S.Pombe Bound To Carboxyet 2e-33
3a35_A190 Crystal Structure Of Lump Complexed With Riboflavin 2e-17
3ddy_A186 Structure Of Lumazine Protein, An Optical Transpond 3e-14
1hze_A97 Solution Structure Of The N-Terminal Domain Of Ribo 7e-14
1hze_A97 Solution Structure Of The N-Terminal Domain Of Ribo 2e-07
gi|15988274|pdb|1I8D|A Chain A, Crystal Structure Of Riboflavin Synthase Length = 213 Back     alignment and structure
 Score =  161 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 65/209 (31%), Positives = 103/209 (49%), Gaps = 11/209 (5%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVM-TSYNTSKMKLGCSIAHAGICLTVVRLSEEHSV 59
           MFTGIV    K++++          V    +    ++ G S+AH G CLTV  ++     
Sbjct: 1   MFTGIVQGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEIN----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            N    ++  ET RITN+    +G ++N+ER+ K  D + GHL+SGHI  T E+  +   
Sbjct: 56  GNHVSFDLMKETLRITNLGDLKVGDWVNVERAAKFSDEIGGHLMSGHIMTTAEVAKILTS 115

Query: 120 GDSM-YCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHK 178
            ++           L ++I  KG + ++G+SLTV  V    F V LI  T+E TT    K
Sbjct: 116 ENNRQIWFKVQDSQLMKYILYKGFIGIDGISLTVGEVTPTRFCVHLIPETLERTTLGKKK 175

Query: 179 VGDLINIEVDSMMRY----IARLYALNTS 203
           +G  +NIE+D   +     + R+ A   +
Sbjct: 176 LGARVNIEIDPQTQAVVDTVERVLAAREN 204


gi|24987485|pdb|1KZL|A Chain A, Riboflavin Synthase From S.Pombe Bound To Carboxyethyllumazine Length = 208 Back     alignment and structure
>gi|266618508|pdb|3A35|A Chain A, Crystal Structure Of Lump Complexed With Riboflavin Length = 190 Back     alignment and structure
>gi|193506833|pdb|3DDY|A Chain A, Structure Of Lumazine Protein, An Optical Transponder Of Luminescent Bacteria Length = 186 Back     alignment and structure
>gi|15826467|pdb|1HZE|A Chain A, Solution Structure Of The N-Terminal Domain Of Riboflavin Synthase From E. Coli Length = 97 Back     alignment and structure
>gi|15826467|pdb|1HZE|A Chain A, Solution Structure Of The N-Terminal Domain Of Riboflavin Synthase From E. Coli Length = 97 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target204 riboflavin synthase subunit alpha [Candidatus Liberibac
3ddy_A186 Lumazine protein, LUMP; luminescent bacteria, riboflavi 7e-49
1kzl_A208 Riboflavin synthase; biosynthesis of riboflavin, ligand 8e-45
1i8d_A213 Riboflavin synthase; riboflavin biosynthesis, antimicro 9e-44
3a35_A190 Lumazine protein, LUMP; luminous bacteria, homologue of 4e-28
>3ddy_A Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi} Length = 186 Back     alignment and structure
 Score =  188 bits (479), Expect = 7e-49
 Identities = 35/188 (18%), Positives = 73/188 (38%), Gaps = 7/188 (3%)

Query: 1   MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYNTSK-MKLGCSIAHAGICLTVVRLSEEHSV 59
           MF GIV   G I +++      R  +       + + +   +   G   TVVR+      
Sbjct: 1   MFRGIVQGRGVIRSISKSEDSQRHGIAFPEGMFQLVDVDTVMLVNGCSNTVVRIL----- 55

Query: 60  DNWYEVEVWAETNRITNIASWGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFI 119
            +    ++  +    T       G  +NLE   K G+ +    ++G+I GT  +  ++  
Sbjct: 56  GDMVYFDI-DQALGTTTFDGLKEGDQVNLEIHPKFGEVVGRGGLTGNIKGTALVAAIEEN 114

Query: 120 GDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWKMHKV 179
                  + +P  L + + VK  + ++G+SL +  +  +   +   R  +  T       
Sbjct: 115 DAGFSVLIDIPKGLAENLTVKDDIGIDGISLPITDMSDSIITLNYSRDLLASTNIASLAK 174

Query: 180 GDLINIEV 187
              +N+E+
Sbjct: 175 DVKVNVEI 182


>1kzl_A Riboflavin synthase; biosynthesis of riboflavin, ligand binding, transferase; HET: CRM; 2.10A {Schizosaccharomyces pombe} SCOP: b.43.4.3 b.43.4.3 Length = 208 Back     alignment and structure
>1i8d_A Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli} SCOP: b.43.4.3 b.43.4.3 PDB: 1hze_A* 1i18_A* 1pkv_A* Length = 213 Back     alignment and structure
>3a35_A Lumazine protein, LUMP; luminous bacteria, homologue of riboflavin synthase, luminescent protein; HET: RBF; 1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A* Length = 190 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target204 riboflavin synthase subunit alpha [Candidatus Liberibac
1kzl_A208 Riboflavin synthase; biosynthesis of riboflavin, ligand 100.0
1i8d_A213 Riboflavin synthase; riboflavin biosynthesis, antimicro 100.0
3a35_A190 Lumazine protein, LUMP; luminous bacteria, homologue of 100.0
3ddy_A186 Lumazine protein, LUMP; luminescent bacteria, riboflavi 100.0
1i8d_A 213 Riboflavin synthase; riboflavin biosynthesis, antimicro 99.83
3ddy_A186 Lumazine protein, LUMP; luminescent bacteria, riboflavi 99.82
3a35_A190 Lumazine protein, LUMP; luminous bacteria, homologue of 99.8
1kzl_A208 Riboflavin synthase; biosynthesis of riboflavin, ligand 99.8
>1kzl_A Riboflavin synthase; biosynthesis of riboflavin, ligand binding, transferase; HET: CRM; 2.10A {Schizosaccharomyces pombe} SCOP: b.43.4.3 b.43.4.3 Back     alignment and structure
Probab=100.00  E-value=0  Score=503.55  Aligned_cols=198  Identities=30%  Similarity=0.497  Sum_probs=188.6

Q ss_pred             CCCEEEEEEEEEEEEEEC-CCCEEEEEEECCCCCCCCCCCEEEECCEEEEEEEECCCCCCCCEEEEEEEHHHHHHCCCCC
Q ss_conf             945337118999999876-9935999981755112667724653331542365045556686799998656553201355
Q gi|254780347|r    1 MFTGIVTDIGKIIAMTPI-AKGMRLRVMTSYNTSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIAS   79 (204)
Q Consensus         1 MFtGIV~~~G~V~~i~~~-~~~~~l~i~~~~~~~~l~~G~SIavnGvCLTV~~i~~~~~~~~~f~~~~~~ETl~~T~l~~   79 (204)
                      |||||||++|+|.++++. ++++++.+.++..++++++|||||||||||||++++     +++|+|++++||+++|||+.
T Consensus         1 MFTGII~~~G~V~~i~~~~~~~~~l~i~~~~~~~~l~iG~SIavnGvCLTV~~~~-----~~~~~~dv~~ETl~~T~l~~   75 (208)
T 1kzl_A            1 MFTGLVEAIGVVKDVQGTIDNGFAMKIEAPQILDDCHTGDSIAVNGTCLTVTDFD-----RYHFTVGIAPESLRLTNLGQ   75 (208)
T ss_dssp             CBCSCCCEEEEEEEEEEETTTEEEEEEECGGGCTTCCTTCEEEETTEEEEEEEEC-----SSEEEEEECHHHHHHSSGGG
T ss_pred             CCCCCCCEEEEEEEEEECCCCCEEEEEECCCCCCCCCCCCEEEECCEEEEEEECC-----CCEEEEEEHHHHHHHHHHCC
T ss_conf             9880107699999989768995899997574224477788699889998899768-----87799998588555665255


Q ss_pred             CCCCCCCCCCCCCHHHHCCCCCEEEECCCCHHHHHHHCCCCCEEEEEEECCC-CCCCEECCCCEEEEEEEEEEEEEECCC
Q ss_conf             5656631335432000004764245401001101110023313798751342-112100235719982345787741685
Q gi|254780347|r   80 WGIGTFINLERSVKLGDRLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPH-NLEQFIAVKGSVCLNGVSLTVNLVGKN  158 (204)
Q Consensus        80 l~~G~~VNLE~a~~~g~~lgGH~v~GhVd~~~~i~~i~~~~~~~~~~i~~~~-~~~~~l~~KgsI~idGvSLTV~~~~~~  158 (204)
                      |++|++|||||||++|||+|||+||||||++|+++++++.++++.+++..|+ .+.+|+++|||||+|||||||+++.++
T Consensus        76 l~~G~~VNLErsl~~gd~lgGH~V~GHVD~~~~i~~i~~~~~~~~~~~~~~~~~~~~yiv~KGsIaidGvSLTV~~v~~~  155 (208)
T 1kzl_A           76 CKAGDPVNLERAVLSSTRMGGHFVQGHVDTVAEIVEKKQDGEAIDFTFRPRDPFVLKYIVYKGYIALDGTSLTITHVDDS  155 (208)
T ss_dssp             CCTTCEEEEEECCCCSCCSSSCCBCSCCCEEEEEEEEEEETTEEEEEEEESSGGGGGGCCTTCEEEETTEEEEEEEECSS
T ss_pred             CCCCCEECCCCCEECCCEECCEEEEEECCEEEEEEEEEECCCCEEEEEEEEEHHHHCCEEECCEEEEEEEEEEEEEECCC
T ss_conf             77898883156531786867844788740899999999769963799995101122124650109985048999867299


Q ss_pred             EEEEEEEHHHHCCCCHHHCCCCCEEEEEHHHHHHHHHHHHCCCCC
Q ss_conf             499998444330133002489967469713588999998602335
Q gi|254780347|r  159 FFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARLYALNTS  203 (204)
Q Consensus       159 ~f~v~lIp~Tl~~T~l~~~k~Gd~VNiE~D~l~kyv~r~~~~~~~  203 (204)
                      +|+|+||||||++|||+++++||+||||+|++|||++|+++.+.+
T Consensus       156 ~f~v~lIP~Tl~~T~l~~~~~Gd~VNiE~D~lakYi~~~l~~~~~  200 (208)
T 1kzl_A          156 TFSIMMISYTQSKVIMAKKNVGDLVNVEVDQIGKYTEKLVEAHIA  200 (208)
T ss_dssp             CEEEEECHHHHTTSGGGGCCTTCEEEEEECTHHHHHHHHHHHHTT
T ss_pred             EEEEEEEHHHHHHCCCCCCCCCCEEEEEEHHHHHHHHHHHHHHHH
T ss_conf             899999778865451114878999998641499999999877543



>1i8d_A Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli} SCOP: b.43.4.3 b.43.4.3 PDB: 1hze_A* 1i18_A* 1pkv_A* Back     alignment and structure
>3a35_A Lumazine protein, LUMP; luminous bacteria, homologue of riboflavin synthase, luminescent protein; HET: RBF; 1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A* Back     alignment and structure
>3ddy_A Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi} Back     alignment and structure
>1i8d_A Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli} SCOP: b.43.4.3 b.43.4.3 PDB: 1hze_A* 1i18_A* 1pkv_A* Back     alignment and structure
>3ddy_A Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi} Back     alignment and structure
>3a35_A Lumazine protein, LUMP; luminous bacteria, homologue of riboflavin synthase, luminescent protein; HET: RBF; 1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A* Back     alignment and structure
>1kzl_A Riboflavin synthase; biosynthesis of riboflavin, ligand binding, transferase; HET: CRM; 2.10A {Schizosaccharomyces pombe} SCOP: b.43.4.3 b.43.4.3 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 204 riboflavin synthase subunit alpha [Candidatus Liberibac
d1kzla2110 b.43.4.3 (A:93-202) Riboflavin synthase {Fission yeast 2e-20
d1i8da2113 b.43.4.3 (A:94-206) Riboflavin synthase {Escherichia co 1e-18
d1i8da193 b.43.4.3 (A:1-93) Riboflavin synthase {Escherichia coli 8e-14
d1kzla192 b.43.4.3 (A:1-92) Riboflavin synthase {Fission yeast (S 4e-10
d1kzla2110 b.43.4.3 (A:93-202) Riboflavin synthase {Fission yeast 6e-05
d1i8da2113 b.43.4.3 (A:94-206) Riboflavin synthase {Escherichia co 6e-06
d1i8da193 b.43.4.3 (A:1-93) Riboflavin synthase {Escherichia coli 3e-17
d1kzla192 b.43.4.3 (A:1-92) Riboflavin synthase {Fission yeast (S 2e-14
>d1kzla2 b.43.4.3 (A:93-202) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 110 Back     information, alignment and structure

class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Riboflavin synthase domain-like
family: Riboflavin synthase
domain: Riboflavin synthase
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]
 Score = 92.7 bits (230), Expect = 2e-20
 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 1/102 (0%)

Query: 97  RLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLPHN-LEQFIAVKGSVCLNGVSLTVNLV 155
           R+ GH V GH+D   EI+     G+++          + ++I  KG + L+G SLT+  V
Sbjct: 1   RMGGHFVQGHVDTVAEIVEKKQDGEAIDFTFRPRDPFVLKYIVYKGYIALDGTSLTITHV 60

Query: 156 GKNFFDVLLIRHTIEETTWKMHKVGDLINIEVDSMMRYIARL 197
             + F +++I +T  +       VGDL+N+EVD + +Y  +L
Sbjct: 61  DDSTFSIMMISYTQSKVIMAKKNVGDLVNVEVDQIGKYTEKL 102


>d1i8da2 b.43.4.3 (A:94-206) Riboflavin synthase {Escherichia coli [TaxId: 562]} Length = 113 Back     information, alignment and structure
>d1i8da1 b.43.4.3 (A:1-93) Riboflavin synthase {Escherichia coli [TaxId: 562]} Length = 93 Back     information, alignment and structure
>d1kzla1 b.43.4.3 (A:1-92) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 92 Back     information, alignment and structure
>d1kzla2 b.43.4.3 (A:93-202) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 110 Back     information, alignment and structure
>d1i8da2 b.43.4.3 (A:94-206) Riboflavin synthase {Escherichia coli [TaxId: 562]} Length = 113 Back     information, alignment and structure
>d1i8da1 b.43.4.3 (A:1-93) Riboflavin synthase {Escherichia coli [TaxId: 562]} Length = 93 Back     information, alignment and structure
>d1kzla1 b.43.4.3 (A:1-92) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 92 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target204 riboflavin synthase subunit alpha [Candidatus Liberibac
d1kzla2110 Riboflavin synthase {Fission yeast (Schizosaccharomyces 100.0
d1i8da2113 Riboflavin synthase {Escherichia coli [TaxId: 562]} 100.0
d1i8da193 Riboflavin synthase {Escherichia coli [TaxId: 562]} 99.94
d1kzla192 Riboflavin synthase {Fission yeast (Schizosaccharomyces 99.93
d1i8da193 Riboflavin synthase {Escherichia coli [TaxId: 562]} 99.97
d1kzla192 Riboflavin synthase {Fission yeast (Schizosaccharomyces 99.96
d1i8da2113 Riboflavin synthase {Escherichia coli [TaxId: 562]} 99.91
d1kzla2110 Riboflavin synthase {Fission yeast (Schizosaccharomyces 99.9
>d1kzla2 b.43.4.3 (A:93-202) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Riboflavin synthase domain-like
family: Riboflavin synthase
domain: Riboflavin synthase
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]
Probab=100.00  E-value=2.6e-41  Score=259.54  Aligned_cols=108  Identities=30%  Similarity=0.515  Sum_probs=103.7

Q ss_pred             CCCCCEEEECCCCHHHHHHHCCCCCEEEEEEECC-CCCCCEECCCCEEEEEEEEEEEEEECCCEEEEEEEHHHHCCCCHH
Q ss_conf             0476424540100110111002331379875134-211210023571998234578774168549999844433013300
Q gi|254780347|r   97 RLDGHLVSGHIDGTVEILFLDFIGDSMYCRLSLP-HNLEQFIAVKGSVCLNGVSLTVNLVGKNFFDVLLIRHTIEETTWK  175 (204)
Q Consensus        97 ~lgGH~v~GhVd~~~~i~~i~~~~~~~~~~i~~~-~~~~~~l~~KgsI~idGvSLTV~~~~~~~f~v~lIp~Tl~~T~l~  175 (204)
                      |+|||+||||||++|+|+++++.++++.+++.+| +.+.+|++.|||||+|||||||+++.+++|++++|||||++|||+
T Consensus         1 r~~GH~v~GHVd~~g~I~~i~~~~~~~~~~i~~~~~~~~~~l~~~~SIavnGvcLTV~~~~~~~f~v~lipETl~~Tnl~   80 (110)
T d1kzla2           1 RMGGHFVQGHVDTVAEIVEKKQDGEAIDFTFRPRDPFVLKYIVYKGYIALDGTSLTITHVDDSTFSIMMISYTQSKVIMA   80 (110)
T ss_dssp             CSSSCCBCSCCCEEEEEEEEEEETTEEEEEEEESSGGGGGGCCTTCEEEETTEEEEEEEECSSCEEEEECHHHHTTSGGG
T ss_pred             CCCEEEEEEEECEEEEEEEEEECCCCCEEEEECCHHHHHHHHHHHHEEECCCCEEEEEEECCCEEEEEEHHHHHHHCCCC
T ss_conf             94304350795689999999987985213563250555331001214774783899972569789998769987656000


Q ss_pred             HCCCCCEEEEEHHHHHHHHHHHHCCCCCC
Q ss_conf             24899674697135889999986023359
Q gi|254780347|r  176 MHKVGDLINIEVDSMMRYIARLYALNTSQ  204 (204)
Q Consensus       176 ~~k~Gd~VNiE~D~l~kyv~r~~~~~~~~  204 (204)
                      .+++||+||||+|+||||++|+++.+.++
T Consensus        81 ~~~~G~~VNLE~D~lak~i~~~~~~~~~~  109 (110)
T d1kzla2          81 KKNVGDLVNVEVDQIGKYTEKLVEAHIAD  109 (110)
T ss_dssp             GCCTTCEEEEEECTHHHHHHHHHHHHTTT
T ss_pred             CCCCCCEEEEEEHHHHHHHHHHHHHHCCC
T ss_conf             17799989982166999999998765269



>d1i8da2 b.43.4.3 (A:94-206) Riboflavin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8da1 b.43.4.3 (A:1-93) Riboflavin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kzla1 b.43.4.3 (A:1-92) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1i8da1 b.43.4.3 (A:1-93) Riboflavin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kzla1 b.43.4.3 (A:1-92) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1i8da2 b.43.4.3 (A:94-206) Riboflavin synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kzla2 b.43.4.3 (A:93-202) Riboflavin synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 204 riboflavin synthase subunit alpha [Candidatus Libe
3a35_A_95-19096 (A:95-190) Lumazine protein, LUMP; luminous bacter 5e-20
3a35_A_1-9494 (A:1-94) Lumazine protein, LUMP; luminous bacteria 1e-15
3ddy_A_95-18692 (A:95-186) Lumazine protein, LUMP; luminescent bac 2e-18
3ddy_A_1-9494 (A:1-94) Lumazine protein, LUMP; luminescent bacte 1e-15
1kzl_A_6-9287 (A:6-92) Riboflavin synthase; biosynthesis of ribo 6e-15
1i8d_A_7-9185 (A:7-91) Riboflavin synthase; riboflavin biosynthe 4e-15
1i8d_A_1-6_92-213128 (A:1-6,A:92-213) Riboflavin synthase; riboflavin b 1e-09
1kzl_A_1-5_93-18699 (A:1-5,A:93-186) Riboflavin synthase; biosynthesis 1e-09
3a35_A_95-19096 (A:95-190) Lumazine protein, LUMP; luminous bacter 4e-18
3a35_A_1-9494 (A:1-94) Lumazine protein, LUMP; luminous bacteria 7e-19
3ddy_A_95-18692 (A:95-186) Lumazine protein, LUMP; luminescent bac 9e-18
3ddy_A_1-9494 (A:1-94) Lumazine protein, LUMP; luminescent bacte 3e-18
1kzl_A_6-9287 (A:6-92) Riboflavin synthase; biosynthesis of ribo 3e-15
1i8d_A_7-9185 (A:7-91) Riboflavin synthase; riboflavin biosynthe 6e-14
>3a35_A (A:95-190) Lumazine protein, LUMP; luminous bacteria, homologue of riboflavin synthase, luminescent protein; HET: RBF; 1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A*Length = 96 Back     alignment and structure
 Score = 92.1 bits (229), Expect = 5e-20
 Identities = 15/93 (16%), Positives = 40/93 (43%)

Query: 102 LVSGHIDGTVEILFLDFIGDSMYCRLSLPHNLEQFIAVKGSVCLNGVSLTVNLVGKNFFD 161
            ++G+I G   +  +    D +   + +P +L + I  +  + +NGVS ++  +  +   
Sbjct: 3   ALTGNIKGVATVDNITEEEDRLKVYIKIPKDLIENILSEDHIGINGVSHSIEEISDDIIF 62

Query: 162 VLLIRHTIEETTWKMHKVGDLINIEVDSMMRYI 194
           +   ++    T     + G  +N+E  ++    
Sbjct: 63  INYPKNLSITTNLGTLEKGSDVNVETLNVSNEW 95


>3a35_A (A:1-94) Lumazine protein, LUMP; luminous bacteria, homologue of riboflavin synthase, luminescent protein; HET: RBF; 1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A*Length = 94 Back     alignment and structure
>3ddy_A (A:95-186) Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi}Length = 92 Back     alignment and structure
>3ddy_A (A:1-94) Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi}Length = 94 Back     alignment and structure
>1kzl_A (A:6-92) Riboflavin synthase; biosynthesis of riboflavin, ligand binding, transferase; HET: CRM; 2.10A {Schizosaccharomyces pombe}Length = 87 Back     alignment and structure
>1i8d_A (A:7-91) Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli}Length = 85 Back     alignment and structure
>1i8d_A (A:1-6,A:92-213) Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli}Length = 128 Back     alignment and structure
>1kzl_A (A:1-5,A:93-186) Riboflavin synthase; biosynthesis of riboflavin, ligand binding, transferase; HET: CRM; 2.10A {Schizosaccharomyces pombe}Length = 99 Back     alignment and structure
>3a35_A (A:95-190) Lumazine protein, LUMP; luminous bacteria, homologue of riboflavin synthase, luminescent protein; HET: RBF; 1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A*Length = 96 Back     alignment and structure
>3a35_A (A:1-94) Lumazine protein, LUMP; luminous bacteria, homologue of riboflavin synthase, luminescent protein; HET: RBF; 1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A*Length = 94 Back     alignment and structure
>3ddy_A (A:95-186) Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi}Length = 92 Back     alignment and structure
>3ddy_A (A:1-94) Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi}Length = 94 Back     alignment and structure
>1kzl_A (A:6-92) Riboflavin synthase; biosynthesis of riboflavin, ligand binding, transferase; HET: CRM; 2.10A {Schizosaccharomyces pombe}Length = 87 Back     alignment and structure
>1i8d_A (A:7-91) Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli}Length = 85 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target204 riboflavin synthase subunit alpha [Candidatus Liberibac
3ddy_A_1-9494 Lumazine protein, LUMP; luminescent bacteria, ribo 99.97
3a35_A_1-9494 Lumazine protein, LUMP; luminous bacteria, homolog 99.96
3a35_A_95-19096 Lumazine protein, LUMP; luminous bacteria, homolog 99.96
3ddy_A_95-18692 Lumazine protein, LUMP; luminescent bacteria, ribo 99.96
1i8d_A_7-9185 Riboflavin synthase; riboflavin biosynthesis, anti 99.92
1kzl_A_6-9287 Riboflavin synthase; biosynthesis of riboflavin, l 99.91
1i8d_A_1-6_92-213128 Riboflavin synthase; riboflavin biosynthesis, anti 99.15
1kzl_A_1-5_93-18699 Riboflavin synthase; biosynthesis of riboflavin, l 98.43
3a35_A_95-19096 Lumazine protein, LUMP; luminous bacteria, homolog 99.97
1i8d_A_1-6_92-213128 Riboflavin synthase; riboflavin biosynthesis, anti 99.95
3ddy_A_95-18692 Lumazine protein, LUMP; luminescent bacteria, ribo 99.94
3a35_A_1-9494 Lumazine protein, LUMP; luminous bacteria, homolog 99.93
3ddy_A_1-9494 Lumazine protein, LUMP; luminescent bacteria, ribo 99.93
1kzl_A_6-9287 Riboflavin synthase; biosynthesis of riboflavin, l 99.91
1i8d_A_7-9185 Riboflavin synthase; riboflavin biosynthesis, anti 99.91
1kzl_A_1-5_93-18699 Riboflavin synthase; biosynthesis of riboflavin, l 99.85
>3ddy_A (A:1-94) Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi} Back     alignment and structure
Probab=99.97  E-value=8.8e-31  Score=200.24  Aligned_cols=93  Identities=22%  Similarity=0.252  Sum_probs=88.0

Q ss_pred             CCCEEEEEEEEEEEEEECCCCEEEEEEECCC-CCCCCCCCEEEECCEEEEEEEECCCCCCCCEEEEEEEHHHHHHCCCCC
Q ss_conf             9453371189999998769935999981755-112667724653331542365045556686799998656553201355
Q gi|254780347|r    1 MFTGIVTDIGKIIAMTPIAKGMRLRVMTSYN-TSKMKLGCSIAHAGICLTVVRLSEEHSVDNWYEVEVWAETNRITNIAS   79 (204)
Q Consensus         1 MFtGIV~~~G~V~~i~~~~~~~~l~i~~~~~-~~~l~~G~SIavnGvCLTV~~i~~~~~~~~~f~~~~~~ETl~~T~l~~   79 (204)
                      ||||||+++|+|.++++.++++++.+++|.. ++.+++|+|||||||||||+++.+     ++|.|+ +|||+++|||+.
T Consensus         1 MFtG~I~~~g~I~~i~~~~~~~~~~i~~~~~~~~~i~~~~SIavnGvcLTV~~v~~-----~~f~v~-ipeTl~~T~l~~   74 (94)
T 3ddy_A            1 MFRGIVQGRGVIRSISKSEDSQRHGIAFPEGMFQLVDVDTVMLVNGCSNTVVRILG-----DMVYFD-IDQALGTTTFDG   74 (94)
T ss_dssp             CBCSCCCEEEEEEEEEECSSCEEEEEECCTTTGGGCCTTCEEEETTEEEEEEEEET-----TEEEEE-ECTTTTTSSGGG
T ss_pred             CCCEEEEEEEEEEEEEECCCCEEEEEECCCCCCCCCCCCCEEEECCEEEEEEEECC-----CEEEEE-CHHHHHHCCHHH
T ss_conf             98824038999999997699389999917764342467878996879999999679-----879998-169730200601


Q ss_pred             CCCCCCCCCCCCCHHHHCCC
Q ss_conf             56566313354320000047
Q gi|254780347|r   80 WGIGTFINLERSVKLGDRLD   99 (204)
Q Consensus        80 l~~G~~VNLE~a~~~g~~lg   99 (204)
                      |++||+|||||||+++||+|
T Consensus        75 ~~~G~~VNlE~~l~~~~rlG   94 (94)
T 3ddy_A           75 LKEGDQVNLEIHPKFGEVVG   94 (94)
T ss_dssp             CCTTCEEEEECCC-------
T ss_pred             CCCCCEEEEECCCCCCCCCC
T ss_conf             74799985420666898608



>3a35_A (A:1-94) Lumazine protein, LUMP; luminous bacteria, homologue of riboflavin synthase, luminescent protein; HET: RBF; 1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A* Back     alignment and structure
>3a35_A (A:95-190) Lumazine protein, LUMP; luminous bacteria, homologue of riboflavin synthase, luminescent protein; HET: RBF; 1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A* Back     alignment and structure
>3ddy_A (A:95-186) Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi} Back     alignment and structure
>1i8d_A (A:7-91) Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>1kzl_A (A:6-92) Riboflavin synthase; biosynthesis of riboflavin, ligand binding, transferase; HET: CRM; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>1i8d_A (A:1-6,A:92-213) Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>1kzl_A (A:1-5,A:93-186) Riboflavin synthase; biosynthesis of riboflavin, ligand binding, transferase; HET: CRM; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3a35_A (A:95-190) Lumazine protein, LUMP; luminous bacteria, homologue of riboflavin synthase, luminescent protein; HET: RBF; 1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A* Back     alignment and structure
>1i8d_A (A:1-6,A:92-213) Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>3ddy_A (A:95-186) Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi} Back     alignment and structure
>3a35_A (A:1-94) Lumazine protein, LUMP; luminous bacteria, homologue of riboflavin synthase, luminescent protein; HET: RBF; 1.42A {Photobacterium kishitanii} PDB: 3a3b_B* 3a3g_A* Back     alignment and structure
>3ddy_A (A:1-94) Lumazine protein, LUMP; luminescent bacteria, riboflavin synthase, luminescence, luminescent protein; HET: RBF; 2.50A {Photobacterium leiognathi} Back     alignment and structure
>1kzl_A (A:6-92) Riboflavin synthase; biosynthesis of riboflavin, ligand binding, transferase; HET: CRM; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>1i8d_A (A:7-91) Riboflavin synthase; riboflavin biosynthesis, antimicrobial target, structure-based design, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>1kzl_A (A:1-5,A:93-186) Riboflavin synthase; biosynthesis of riboflavin, ligand binding, transferase; HET: CRM; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure