254780348

254780348

5-amino-6-(5-phosphoribosylamino)uracil reductase/diaminohydroxyphosphoribosylaminopyrimidine

GeneID in NCBI database:8209333Locus tag:CLIBASIA_01165
Protein GI in NCBI database:254780348Protein Accession:YP_003064761.1
Gene range:-(242814, 243908)Protein Length:364aa
Gene description:5-amino-6-(5-phosphoribosylamino)uracil reductase/diaminohydroxyphosphoribosylaminopyrimidine
COG prediction:[H] Pyrimidine deaminase
KEGG prediction:5-amino-6-(5-phosphoribosylamino)uracil reductase/diaminohydroxyphosphoribosylaminopyrimidine; K11752 diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
SEED prediction:Diaminohydroxyphosphoribosylaminopyrimidine deaminase (EC 3.5.4.26) / 5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193)
Pathway involved in KEGG:Riboflavin metabolism [PATH:las00740]
Subsystem involved in SEED:Riboflavin, FMN and FAD metabolism;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP3 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----
MPVSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQALEEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLSQKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMCVRRDYFGSDVCLEYIGKNLCLQEL
ccccHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccEEEEEEEccccccccHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHccccEEEEEEcccccccccHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHccEEEEccHHEEEcccccccccccccccccEEEEEcccccccccccEEEcccccEEEEEcccccHHHHHHHHHcccEEEEcccccHHHHHHHHHHccccEEEEEcHHHHHHHHHHcccccEEEEEEEcEEEcccccccccccccccccccEEEEEEEccEEEEEEEccccHHccc
ccccHHHHHHHHHHHHHHHccccccccccccEEEEEEccEEEcccccHcccccHHHHHHHHHHcHHccccEEEEEEccccccccccHHHHHHHHccccEEEEEEccccccHccHHHHHHHHcccEEEcHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccEEcccccccEcccHHHHHHHHHHHHHccEEEEccccEEccccccEEEcccccccccEEEEEEcccccccccEEEEccccccEEEEEccccHHHHHHHHHHccEEEEcccccHHHHHHHHHHccccEEEEEccHHHHHHHHHcccccEEEEEEcHHHcccccccccccccccccccEEEEEEEccccEEEEEEcccccHccc
MPVSSFDARFMSAALRFSRwhvgltstnpsVACLIVkdgivigrgvtayggcphAEVQALEEAGeeargatayvtlepcshygrsppcaqfiiecgirrvvvcvddpdvrvsgrglqwlsQKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSqdnmigmagcgsvpitgfISKNQVHLLRAQSDAILVGIGtvladdpeltcrlnglqehspmriildphfklsldsKIIKTALLAPviivtendDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIvigeggipspleegyleknfmcvrrdyfgsdvCLEYIGknlclqel
MPVSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQALEEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDpdvrvsgrglqwlsqkgIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMCVRRDYFGSDVCLEYIGKNLCLQEL
MPVSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQaleeageeargataYVTLEPCSHYGRSPPCAQFIIECGIrrvvvcvddpdvrvSGRGLQWLSQKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMCVRRDYFGSDVCLEYIGKNLCLQEL
****SFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQALEEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLSQKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMCVRRDYFGSDVCLEYIGKNLCLQEL
********RFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQALEEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLSQKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMCVRRDYFGSDVCLEYIGKNLCLQEL
*PVSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQALEEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLSQKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMCVRRDYFGSDVCLEYIGKNLC****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQALEEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLSQKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMCVRRDYFGSDVCLEYIGKNLCLQEL
MPVSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQALEEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLSQKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMCVRRDYFGSDVCLEYIGKNLCLQEL
MPVSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQALEEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLSQKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMCVRRDYFGSDVCLEYIGKNLCLQEL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target364 5-amino-6-(5-phosphoribosylamino)uracil reductase/diami
315122228367 5-amino-6-(5-phosphoribosylamino)uracil reductase/diami 1 1e-158
222085509371 5-amino-6-(5-phosphoribosylamino)uracil reductase/diami 1 1e-103
227821532367 riboflavin biosynthesis protein RibD [Sinorhizobium fre 1 3e-93
15964963401 riboflavin biosynthesis protein [Sinorhizobium meliloti 1 4e-92
218463058412 5-amino-6-(5-phosphoribosylamino)uracil reductase prote 1 2e-90
150396042398 riboflavin biosynthesis protein RibD [Sinorhizobium med 1 5e-90
294852128373 riboflavin biosynthesis protein RibD [Brucella sp. NVSL 1 5e-88
256369199373 riboflavin biosynthesis protein RibD [Brucella microti 1 2e-87
254701540373 riboflavin biosynthesis protein RibD [Brucella suis bv. 1 2e-87
256060883373 riboflavin biosynthesis protein RibD [Brucella neotomae 1 2e-87
>gi|315122228|ref|YP_004062717.1| 5-amino-6-(5-phosphoribosylamino)uracil reductase/diaminohydroxyphosphoribosylaminopyrimidine [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 367 Back     alignment and organism information
 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 268/363 (73%), Positives = 313/363 (86%)

Query: 1   MPVSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQAL 60
           M +SS D RFMS ALRFS W  GLT TNPSVACLIVKDGI++GRGVTAYGG PHAE QAL
Sbjct: 1   MSLSSLDERFMSVALRFSCWGTGLTGTNPSVACLIVKDGIIVGRGVTAYGGRPHAETQAL 60

Query: 61  EEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLS 120
           EEAGE ARGATAYVTLEPCSHYG++PPCA+FI+E GI RVVVCV DPDVRVSGRGLQWLS
Sbjct: 61  EEAGERARGATAYVTLEPCSHYGQAPPCAKFIVEAGISRVVVCVIDPDVRVSGRGLQWLS 120

Query: 121 QKGIIVDRMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISK 180
           QKGI+VD+++E EG+  L AYLTRQV+ RSH+ LK+A+SQDNMIG+ GCG+V ITG IS+
Sbjct: 121 QKGIVVDKVLEREGERVLGAYLTRQVKNRSHVILKLALSQDNMIGIVGCGNVSITGLISR 180

Query: 181 NQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTA 240
            QVHLLRAQSDAILVGIGTV++D+PELTCRL+GL++ SP+RIILDPH K+SL S+I++TA
Sbjct: 181 KQVHLLRAQSDAILVGIGTVISDNPELTCRLDGLKDRSPIRIILDPHLKISLSSRIMQTA 240

Query: 241 LLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVTSLLVEGGAAVAH 300
            LAPVIIVTE +D  LAL+ +KKN++I++C+CRDLKKLL IL  RG+TSLLVEGGA VA 
Sbjct: 241 SLAPVIIVTEKNDCNLALSIKKKNVDIVHCNCRDLKKLLAILADRGITSLLVEGGARVAR 300

Query: 301 SFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLEKNFMCVRRDYFGSDVCLEYIGKNLC 360
           SF+ S  VDSIILY+SQ +IG  GI SPLEE ++E NFMCVRRD FGSDVC EY+ KN C
Sbjct: 301 SFMMSGFVDSIILYKSQKIIGTSGIASPLEEEFIENNFMCVRRDGFGSDVCFEYVRKNFC 360

Query: 361 LQE 363
           LQE
Sbjct: 361 LQE 363


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085509|ref|YP_002544039.1| 5-amino-6-(5-phosphoribosylamino)uracil reductase/diaminohydroxyphosphoribosylaminopyrimidine deaminase protein [Agrobacterium radiobacter K84] Length = 371 Back     alignment and organism information
>gi|227821532|ref|YP_002825502.1| riboflavin biosynthesis protein RibD [Sinorhizobium fredii NGR234] Length = 367 Back     alignment and organism information
>gi|15964963|ref|NP_385316.1| riboflavin biosynthesis protein [Sinorhizobium meliloti 1021] Length = 401 Back     alignment and organism information
>gi|218463058|ref|ZP_03503149.1| 5-amino-6-(5-phosphoribosylamino)uracil reductase protein [Rhizobium etli Kim 5] Length = 412 Back     alignment and organism information
>gi|150396042|ref|YP_001326509.1| riboflavin biosynthesis protein RibD [Sinorhizobium medicae WSM419] Length = 398 Back     alignment and organism information
>gi|294852128|ref|ZP_06792801.1| riboflavin biosynthesis protein RibD [Brucella sp. NVSL 07-0026] Length = 373 Back     alignment and organism information
>gi|256369199|ref|YP_003106707.1| riboflavin biosynthesis protein RibD [Brucella microti CCM 4915] Length = 373 Back     alignment and organism information
>gi|254701540|ref|ZP_05163368.1| riboflavin biosynthesis protein RibD [Brucella suis bv. 5 str. 513] Length = 373 Back     alignment and organism information
>gi|256060883|ref|ZP_05451043.1| riboflavin biosynthesis protein RibD [Brucella neotomae 5K33] Length = 373 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target364 5-amino-6-(5-phosphoribosylamino)uracil reductase/diami
TIGR00326344 TIGR00326, eubact_ribD, riboflavin biosynthesis protein 2e-73
PRK10786367 PRK10786, ribD, bifunctional diaminohydroxyphosphoribos 4e-58
COG1985218 COG1985, RibD, Pyrimidine reductase, riboflavin biosynt 3e-42
TIGR00227216 TIGR00227, ribD_Cterm, riboflavin-specific deaminase C- 3e-33
pfam01872196 pfam01872, RibD_C, RibD C-terminal domain 2e-30
PRK05625217 PRK05625, PRK05625, 5-amino-6-(5-phosphoribosylamino)ur 1e-27
TIGR01508210 TIGR01508, rib_reduct_arch, 2, 5-diamino-6-hydroxy-4-(5 7e-23
PRK14719360 PRK14719, PRK14719, bifunctional RNAse/5-amino-6-(5-pho 5e-15
PLN02807380 PLN02807, PLN02807, diaminohydroxyphosphoribosylaminopy 5e-42
cd01284115 cd01284, Riboflavin_deaminase-reductase, Riboflavin-spe 2e-34
pfam00383104 pfam00383, dCMP_cyt_deam_1, Cytidine and deoxycytidylat 4e-16
COG0590152 COG0590, CumB, Cytosine/adenosine deaminases [Nucleotid 1e-10
cd0078696 cd00786, cytidine_deaminase-like, Cytidine and deoxycyt 4e-10
cd01286131 cd01286, deoxycytidylate_deaminase, Deoxycytidylate dea 2e-08
COG2131164 COG2131, ComEB, Deoxycytidylate deaminase [Nucleotide t 2e-08
cd01285109 cd01285, nucleoside_deaminase, Nucleoside deaminases in 1e-07
KOG1018169 KOG1018, KOG1018, KOG1018, Cytosine deaminase FCY1 and 5e-05
PRK10860172 PRK10860, PRK10860, tRNA-specific adenosine deaminase; 8e-05
KOG3127230 KOG3127, KOG3127, KOG3127, Deoxycytidylate deaminase [N 1e-04
COG0117146 COG0117, RibD, Pyrimidine deaminase [Coenzyme metabolis 1e-45
PRK14059251 PRK14059, PRK14059, hypothetical protein; Provisional 4e-06
PHA02588168 PHA02588, cd, deoxycytidylate deaminase; Provisional 5e-05
>gnl|CDD|161819 TIGR00326, eubact_ribD, riboflavin biosynthesis protein RibD Back     alignment and domain information
>gnl|CDD|182729 PRK10786, ribD, bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional Back     alignment and domain information
>gnl|CDD|32168 COG1985, RibD, Pyrimidine reductase, riboflavin biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|129330 TIGR00227, ribD_Cterm, riboflavin-specific deaminase C-terminal domain Back     alignment and domain information
>gnl|CDD|145176 pfam01872, RibD_C, RibD C-terminal domain Back     alignment and domain information
>gnl|CDD|180169 PRK05625, PRK05625, 5-amino-6-(5-phosphoribosylamino)uracil reductase; Validated Back     alignment and domain information
>gnl|CDD|130572 TIGR01508, rib_reduct_arch, 2, 5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine 1'-reductase, archaeal Back     alignment and domain information
>gnl|CDD|173182 PRK14719, PRK14719, bifunctional RNAse/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional Back     alignment and domain information
>gnl|CDD|178404 PLN02807, PLN02807, diaminohydroxyphosphoribosylaminopyrimidine deaminase Back     alignment and domain information
>gnl|CDD|29827 cd01284, Riboflavin_deaminase-reductase, Riboflavin-specific deaminase Back     alignment and domain information
>gnl|CDD|144101 pfam00383, dCMP_cyt_deam_1, Cytidine and deoxycytidylate deaminase zinc-binding region Back     alignment and domain information
>gnl|CDD|30935 COG0590, CumB, Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29825 cd00786, cytidine_deaminase-like, Cytidine and deoxycytidylate deaminase zinc-binding region Back     alignment and domain information
>gnl|CDD|29829 cd01286, deoxycytidylate_deaminase, Deoxycytidylate deaminase domain Back     alignment and domain information
>gnl|CDD|32314 COG2131, ComEB, Deoxycytidylate deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|29828 cd01285, nucleoside_deaminase, Nucleoside deaminases include adenosine, guanine and cytosine deaminases Back     alignment and domain information
>gnl|CDD|36236 KOG1018, KOG1018, KOG1018, Cytosine deaminase FCY1 and related enzymes [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|182786 PRK10860, PRK10860, tRNA-specific adenosine deaminase; Provisional Back     alignment and domain information
>gnl|CDD|38337 KOG3127, KOG3127, KOG3127, Deoxycytidylate deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30466 COG0117, RibD, Pyrimidine deaminase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184482 PRK14059, PRK14059, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|177417 PHA02588, cd, deoxycytidylate deaminase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 364 5-amino-6-(5-phosphoribosylamino)uracil reductase/diami
PRK10786367 ribD bifunctional diaminohydroxyphosphoribosylaminopyri 100.0
TIGR00326393 eubact_ribD riboflavin biosynthesis protein RibD; Inter 100.0
COG0117146 RibD Pyrimidine deaminase [Coenzyme metabolism] 100.0
cd01284115 Riboflavin_deaminase-reductase Riboflavin-specific deam 100.0
PRK10860178 tRNA-specific adenosine deaminase; Provisional 100.0
COG0590152 CumB Cytosine/adenosine deaminases [Nucleotide transpor 99.9
COG2131164 ComEB Deoxycytidylate deaminase [Nucleotide transport a 99.81
KOG1018169 consensus 99.71
KOG3127230 consensus 99.51
TIGR02571151 ComEB ComE operon protein 2; InterPro: IPR013404 This i 98.79
TIGR00227239 ribD_Cterm riboflavin-specific deaminase C-terminal dom 100.0
PRK05625239 hypothetical protein; Validated 100.0
COG1985218 RibD Pyrimidine reductase, riboflavin biosynthesis [Coe 100.0
TIGR01508224 rib_reduct_arch diaminohydroxyphosphoribosylaminopyrimi 100.0
pfam01872196 RibD_C RibD C-terminal domain. The function of this dom 100.0
COG0262167 FolA Dihydrofolate reductase [Coenzyme metabolism] 98.95
cd00209158 DHFR Dihydrofolate reductase (DHFR). Reduces 7,8-dihydr 97.9
PRK10769159 folA dihydrofolate reductase; Provisional 97.77
pfam00186159 DHFR_1 Dihydrofolate reductase. 97.67
PTZ00164 512 bifunctional dihydrofolate reductase-thymidylate syntha 97.51
pfam00383104 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase 99.88
cd01286131 deoxycytidylate_deaminase Deoxycytidylate deaminase dom 99.86
cd01285109 nucleoside_deaminase Nucleoside deaminases include aden 99.84
cd0078696 cytidine_deaminase-like Cytidine and deoxycytidylate de 99.71
KOG2771344 consensus 97.74
PRK06848139 hypothetical protein; Validated 97.52
cd01283112 cytidine_deaminase Cytidine deaminase zinc-binding doma 96.79
PRK05578132 cytidine deaminase; Validated 95.46
PRK12411132 cytidine deaminase; Provisional 95.07
KOG0833173 consensus 94.33
PRK08298128 cytidine deaminase; Validated 93.06
PRK09027295 cytidine deaminase; Provisional 90.36
KOG1324190 consensus 95.43
>PRK10786 ribD bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase; Provisional Back     alignment and domain information
>TIGR00326 eubact_ribD riboflavin biosynthesis protein RibD; InterPro: IPR004794 This entry describes the riboflavin biosynthesis protein (ribD) as found in Escherichia coli Back     alignment and domain information
>COG0117 RibD Pyrimidine deaminase [Coenzyme metabolism] Back     alignment and domain information
>cd01284 Riboflavin_deaminase-reductase Riboflavin-specific deaminase Back     alignment and domain information
>PRK10860 tRNA-specific adenosine deaminase; Provisional Back     alignment and domain information
>COG0590 CumB Cytosine/adenosine deaminases [Nucleotide transport and metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2131 ComEB Deoxycytidylate deaminase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1018 consensus Back     alignment and domain information
>KOG3127 consensus Back     alignment and domain information
>TIGR02571 ComEB ComE operon protein 2; InterPro: IPR013404 This is encoded in the ComE operon for "late competence" as characterised in B Back     alignment and domain information
>TIGR00227 ribD_Cterm riboflavin-specific deaminase C-terminal domain; InterPro: IPR011549 Eubacterial riboflavin-specific deaminases have a zinc-binding domain, IPR002125 from INTERPRO, toward the N-terminus and this domain toward the C-terminus Back     alignment and domain information
>PRK05625 hypothetical protein; Validated Back     alignment and domain information
>COG1985 RibD Pyrimidine reductase, riboflavin biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR01508 rib_reduct_arch diaminohydroxyphosphoribosylaminopyrimidine reductase; InterPro: IPR006401 These sequences represent a specific reductase of riboflavin biosynthesis in the archaea, diaminohydroxyphosphoribosylaminopyrimidine reductase Back     alignment and domain information
>pfam01872 RibD_C RibD C-terminal domain Back     alignment and domain information
>COG0262 FolA Dihydrofolate reductase [Coenzyme metabolism] Back     alignment and domain information
>cd00209 DHFR Dihydrofolate reductase (DHFR) Back     alignment and domain information
>PRK10769 folA dihydrofolate reductase; Provisional Back     alignment and domain information
>pfam00186 DHFR_1 Dihydrofolate reductase Back     alignment and domain information
>PTZ00164 bifunctional dihydrofolate reductase-thymidylate synthase; Provisional Back     alignment and domain information
>pfam00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region Back     alignment and domain information
>cd01286 deoxycytidylate_deaminase Deoxycytidylate deaminase domain Back     alignment and domain information
>cd01285 nucleoside_deaminase Nucleoside deaminases include adenosine, guanine and cytosine deaminases Back     alignment and domain information
>cd00786 cytidine_deaminase-like Cytidine and deoxycytidylate deaminase zinc-binding region Back     alignment and domain information
>KOG2771 consensus Back     alignment and domain information
>PRK06848 hypothetical protein; Validated Back     alignment and domain information
>cd01283 cytidine_deaminase Cytidine deaminase zinc-binding domain Back     alignment and domain information
>PRK05578 cytidine deaminase; Validated Back     alignment and domain information
>PRK12411 cytidine deaminase; Provisional Back     alignment and domain information
>KOG0833 consensus Back     alignment and domain information
>PRK08298 cytidine deaminase; Validated Back     alignment and domain information
>PRK09027 cytidine deaminase; Provisional Back     alignment and domain information
>KOG1324 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target364 5-amino-6-(5-phosphoribosylamino)uracil reductase/diami
2g6v_A402 The Crystal Structure Of Ribd From Escherichia Coli 1e-61
2o7p_A380 The Crystal Structure Of Ribd From Escherichia Coli 1e-61
2b3z_A373 Crystal Structure Of A Bifunctional Deaminase And R 8e-56
2hxv_A360 Crystal Structure Of A Diaminohydroxyphosphoribosyl 8e-42
1z3a_A168 Crystal Structure Of Trna Adenosine Deaminase Tada 3e-15
3ocq_A183 Crystal Structure Of Trna-Specific Adenosine Deamin 1e-14
1wwr_A171 Crystal Structure Of Trna Adenosine Deaminase Tada 3e-14
2b3j_A159 Crystal Structure Of Staphylococcus Aureus Trna Ade 5e-14
2nx8_A179 The Crystal Structure Of The Trna-Specific Adenosin 1e-12
1tiy_A164 X-Ray Structure Of Guanine Deaminase From Bacillus 1e-11
1wkq_A164 Crystal Structure Of Bacillus Subtilis Guanine Deam 3e-11
2a8n_A144 Biochemical And Structural Studies Of A-To-I Editin 5e-10
3dh1_A189 Crystal Structure Of Human Trna-Specific Adenosine- 5e-08
2w4l_A178 Human Dcmp Deaminase Length = 178 7e-07
2hvv_A184 Crystal Structure Of Dcmp Deaminase From Streptococ 3e-06
2azn_A219 X-Ray Structure Of 2,5-Diamino-6-Ribosylamino-4(3h) 5e-15
1p6o_A161 The Crystal Structure Of Yeast Cytosine Deaminase B 1e-04
1uaq_A158 The Crystal Structure Of Yeast Cytosine Deaminase L 2e-04
1ysb_A161 Yeast Cytosine Deaminase Triple Mutant Length = 161 2e-04
1ysd_A161 Yeast Cytosine Deaminase Double Mutant Length = 161 2e-04
2o3k_A161 Yeast Cytosine Deaminase D92e Triple Mutant Bound T 4e-04
1cz3_A168 Dihydrofolate Reductase From Thermotoga Maritima Le 3e-04
3ky8_A197 Crystal Structure Of Putative Riboflavin Biosynthes 8e-04
2gd9_A189 Crystal Structure Of A Putative Dihydrofolate Reduc 0.001
>gi|126030525|pdb|2G6V|A Chain A, The Crystal Structure Of Ribd From Escherichia Coli Length = 402 Back     alignment and structure
 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 122/366 (33%), Positives = 174/366 (47%), Gaps = 16/366 (4%)

Query: 6   FDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQALEEAGE 65
            D  + + AL+ ++     T  NP+V C+IVKDG ++G G     G PHAEV AL  AGE
Sbjct: 29  QDEYYXARALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHALRXAGE 88

Query: 66  EARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLSQKGII 125
           +A+GATAYVTLEPCSH+GR+PPC   +I  G+ RVV    DP+ +V+GRGL  L Q GI 
Sbjct: 89  KAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVASXQDPNPQVAGRGLYRLQQAGID 148

Query: 126 VDRMMESEGKIFLHAYL-TRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVH 184
           V   +       L+     R      +I LK+  S D     A   S  IT   ++  V 
Sbjct: 149 VSHGLXXSEAEQLNKGFLKRXRTGFPYIQLKLGASLDGRTAXASGESQWITSPQARRDVQ 208

Query: 185 LLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLAP 244
           LLRAQS AIL    TVLADDP LT R + L E +   +    + +  +   I     + P
Sbjct: 209 LLRAQSHAILTSSATVLADDPALTVRWSELDEQTQA-LYPQQNLRQPIRIVIDSQNRVTP 267

Query: 245 VIIVTENDDPVLALAFRKKNINII----------YCDCRDLKKLLTILVGRGVTSLLVEG 294
           V  + +          ++ +              +    DL  L   L  + + S+ VE 
Sbjct: 268 VHRIVQQPGETWFARTQEDSREWPETVRTLLIPEHKGHLDLVVLXXQLGKQQINSIWVEA 327

Query: 295 GAAVAHSFINSRLVDSIILYRSQIVIGEGGIPS----PLEEGYLEKNFMCVRRDYFGSDV 350
           G  +A + + + LVD +I+Y +  ++G           LE+      F      + G DV
Sbjct: 328 GPTLAGALLQAGLVDELIVYIAPKLLGSDARGLCTLPGLEKLADAPQFKFKEIRHVGPDV 387

Query: 351 CLEYIG 356
           CL  +G
Sbjct: 388 CLHLVG 393


>gi|134105070|pdb|2O7P|A Chain A, The Crystal Structure Of Ribd From Escherichia Coli In Complex With The Oxidised Nadp+ Cofactor In The Active Site Of The Reductase Domain Length = 380 Back     alignment and structure
>gi|83754218|pdb|2B3Z|A Chain A, Crystal Structure Of A Bifunctional Deaminase And Reductase Involved In Riboflavin Biosynthesis Length = 373 Back     alignment and structure
>gi|114794616|pdb|2HXV|A Chain A, Crystal Structure Of A Diaminohydroxyphosphoribosylaminopyrimidine Deaminase 5-Amino-6-(5-Phosphoribosylamino)uracil Reductase (Tm1828) From Thermotoga Maritima At 1.80 A Resolution Length = 360 Back     alignment and structure
>gi|90108580|pdb|1Z3A|A Chain A, Crystal Structure Of Trna Adenosine Deaminase Tada From Escherichia Coli Length = 168 Back     alignment and structure
gi|303325222|pdb|3OCQ|A Chain A, Crystal Structure Of Trna-Specific Adenosine Deaminase From Salmonella Enterica Length = 183 Back     alignment and structure
>gi|60593936|pdb|1WWR|A Chain A, Crystal Structure Of Trna Adenosine Deaminase Tada From Aquifex Aeolicus Length = 171 Back     alignment and structure
>gi|88192205|pdb|2B3J|A Chain A, Crystal Structure Of Staphylococcus Aureus Trna Adenosine Deaminase, Tada, In Complex With Rna Length = 159 Back     alignment and structure
>gi|159794935|pdb|2NX8|A Chain A, The Crystal Structure Of The Trna-Specific Adenosine Deaminase From Streptococcus Pyogenes Length = 179 Back     alignment and structure
>gi|50513754|pdb|1TIY|A Chain A, X-Ray Structure Of Guanine Deaminase From Bacillus Subtilis Northeast Structural Genomics Consortium Target Sr160 Length = 164 Back     alignment and structure
>gi|51248026|pdb|1WKQ|A Chain A, Crystal Structure Of Bacillus Subtilis Guanine Deaminase. The First Domain-Swapped Structure In The Cytidine Deaminase Superfamily Length = 164 Back     alignment and structure
>gi|78101280|pdb|2A8N|A Chain A, Biochemical And Structural Studies Of A-To-I Editing By Trna:a34 Deaminases At The Wobble Position Of Transfer Rna Length = 144 Back     alignment and structure
>gi|198443277|pdb|3DH1|A Chain A, Crystal Structure Of Human Trna-Specific Adenosine-34 Deaminase Subunit Adat2 Length = 189 Back     alignment and structure
>gi|224036452|pdb|2W4L|A Chain A, Human Dcmp Deaminase Length = 178 Back     alignment and structure
>gi|158428667|pdb|2HVV|A Chain A, Crystal Structure Of Dcmp Deaminase From Streptococcus Mutans Length = 184 Back     alignment and structure
>gi|114793489|pdb|2AZN|A Chain A, X-Ray Structure Of 2,5-Diamino-6-Ribosylamino-4(3h)- Pyrimidinone 5-Phosphate Reductase Length = 219 Back     alignment and structure
>gi|34810531|pdb|1P6O|A Chain A, The Crystal Structure Of Yeast Cytosine Deaminase Bound To 4(R)-Hydroxyl-3,4-Dihydropyrimidine At 1.14 Angstroms. Length = 161 Back     alignment and structure
gi|30750134|pdb|1UAQ|A Chain A, The Crystal Structure Of Yeast Cytosine Deaminase Length = 158 Back     alignment and structure
>gi|67464318|pdb|1YSB|A Chain A, Yeast Cytosine Deaminase Triple Mutant Length = 161 Back     alignment and structure
>gi|67464322|pdb|1YSD|A Chain A, Yeast Cytosine Deaminase Double Mutant Length = 161 Back     alignment and structure
>gi|158429187|pdb|2O3K|A Chain A, Yeast Cytosine Deaminase D92e Triple Mutant Bound To Transition State Analogue Hpy Length = 161 Back     alignment and structure
>gi|7546295|pdb|1CZ3|A Chain A, Dihydrofolate Reductase From Thermotoga Maritima Length = 168 Back     alignment and structure
>gi|281501005|pdb|3KY8|A Chain A, Crystal Structure Of Putative Riboflavin Biosynthesis Protein (Yp_001092907.1) From Shewanella Sp. Pv-4 At 2.12 A Resolution Length = 197 Back     alignment and structure
>gi|93279969|pdb|2GD9|A Chain A, Crystal Structure Of A Putative Dihydrofolate Reductase (Bsu40760, Yyap) From Bacillus Subtilis At 2.30 A Resolution Length = 189 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target364 5-amino-6-(5-phosphoribosylamino)uracil reductase/diami
2g6v_A402 Riboflavin biosynthesis protein RIBD; RIBD APO structur 1e-64
2b3z_A373 Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, 2e-57
2hxv_A360 Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 6e-51
2p4g_A270 Hypothetical protein; NP_939744.1, structural genomics, 3e-26
3kgy_A231 Bifunctional deaminase-reductase domain protein; putati 1e-23
2azn_A219 HTP reductase, putative 5-amino-6-(5-phosphoribosylamin 1e-22
3jtw_A178 Dihydrofolate reductase; YP_805003.1, structural genomi 5e-12
2gd9_A189 Hypothetical protein YYAP; 2636623, structural genomics 4e-10
1p6o_A161 Cytosine deaminase; hydrolase, dimer, inhibitor bound; 2e-20
2w4l_A178 DCMP deaminse, deoxycytidylate deaminase; pyrimidine me 5e-17
2hvw_A184 Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwic 2e-15
1z3a_A168 TRNA-specific adenosine deaminase; tRNA adenosine deami 4e-14
3dh1_A189 TRNA-specific adenosine deaminase 2; zinc-binding prote 6e-14
2nx8_A179 TRNA-specific adenosine deaminase; TAD, hydrolase; 2.00 9e-14
1wwr_A171 TRNA adenosine deaminase TADA; homodimer, riken structu 2e-12
1wkq_A164 Guanine deaminase; domain SWAP, the cytidine deaminase 3e-12
2a8n_A144 Cytidine and deoxycytidylate deaminase; RNA editing, RN 2e-11
2b3j_A159 TRNA adenosine deaminase; mixed alpha-beta, protein-RNA 4e-09
2g84_A197 Cytidine and deoxycytidylate deaminase zinc- binding re 1e-08
1vq2_A193 DCMP deaminase, deoxycytidylate deaminase; hydrolase; H 3e-09
3ky8_A197 Putative riboflavin biosynthesis protein; structural ge 1e-07
>2g6v_A Riboflavin biosynthesis protein RIBD; RIBD APO structure, structural genomics, structural proteomics in europe, spine, hydrolase; 2.60A {Escherichia coli} PDB: 2obc_A* 2o7p_A* Length = 402 Back     alignment and structure
 Score =  242 bits (617), Expect = 1e-64
 Identities = 127/372 (34%), Positives = 186/372 (50%), Gaps = 18/372 (4%)

Query: 1   MPVSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQAL 60
           + +   D  +M+ AL+ ++     T  NP+V C+IVKDG ++G G     G PHAEV AL
Sbjct: 24  LYIQGQDEYYMARALKLAQRGRFTTHPNPNVGCVIVKDGEIVGEGYHQRAGEPHAEVHAL 83

Query: 61  EEAGEEARGATAYVTLEPCSHYGRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLS 120
             AGE+A+GATAYVTLEPCSH+GR+PPC   +I  G+ RVV  + DP+ +V+GRGL  L 
Sbjct: 84  RMAGEKAKGATAYVTLEPCSHHGRTPPCCDALIAAGVARVVASMQDPNPQVAGRGLYRLQ 143

Query: 121 QKGIIVDRMMESEGKIFLHA-YLTRQVEKRSHITLKIAVSQDNMIGMAGCGSVPITGFIS 179
           Q GI V   +       L+  +L R      +I LK+  S D    MA   S  IT   +
Sbjct: 144 QAGIDVSHGLMMSEAEQLNKGFLKRMRTGFPYIQLKLGASLDGRTAMASGESQWITSPQA 203

Query: 180 KNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHS-----------PMRIILDPHF 228
           +  V LLRAQS AIL    TVLADDP LT R + L E +           P+RI++D   
Sbjct: 204 RRDVQLLRAQSHAILTSSATVLADDPALTVRWSELDEQTQALYPQQNLRQPIRIVIDSQN 263

Query: 229 KLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCDCRDLKKLLTILVGRGVT 288
           +++   +I++             +D        +  +   +    DL  L+  L  + + 
Sbjct: 264 RVTPVHRIVQQP--GETWFARTQEDSREWPETVRTLLIPEHKGHLDLVVLMMQLGKQQIN 321

Query: 289 SLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGEGGIPSPLEEGYLE----KNFMCVRRD 344
           S+ VE G  +A + + + LVD +I+Y +  ++G          G  +      F      
Sbjct: 322 SIWVEAGPTLAGALLQAGLVDELIVYIAPKLLGSDARGLCTLPGLEKLADAPQFKFKEIR 381

Query: 345 YFGSDVCLEYIG 356
           + G DVCL  +G
Sbjct: 382 HVGPDVCLHLVG 393


>2b3z_A Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, deaminase domain and reductase domain, hydrolase, oxidoreductase; 2.41A {Bacillus subtilis} SCOP: c.71.1.2 c.97.1.2 PDB: 2d5n_A* 3ex8_A* Length = 373 Back     alignment and structure
>2hxv_A Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil...; TM1828, structural genomics, PSI-2; HET: NDP; 1.80A {Thermotoga maritima} SCOP: c.71.1.2 c.97.1.2 Length = 360 Back     alignment and structure
>2p4g_A Hypothetical protein; NP_939744.1, structural genomics, joint center for structural genomics, JCSG; 2.30A {Corynebacterium diphtheriae NCTC13129} Length = 270 Back     alignment and structure
>3kgy_A Bifunctional deaminase-reductase domain protein; putative dihydrofolate reductase, structural genomics; HET: MSE NDP; 1.50A {Chloroflexus aurantiacus j-10-fl} Length = 231 Back     alignment and structure
>2azn_A HTP reductase, putative 5-amino-6-(5-phosphoribosylamino)uracil reductase; oxidoreductase; HET: MA5 NAP EPE; 2.70A {Methanocaldococcus jannaschii} SCOP: c.71.1.2 Length = 219 Back     alignment and structure
>3jtw_A Dihydrofolate reductase; YP_805003.1, structural genomics, joint center for structural genomics, JCSG; 1.90A {Pediococcus pentosaceus atcc 25745} Length = 178 Back     alignment and structure
>2gd9_A Hypothetical protein YYAP; 2636623, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.30A {Bacillus subtilis} Length = 189 Back     alignment and structure
>1p6o_A Cytosine deaminase; hydrolase, dimer, inhibitor bound; 1.14A {Saccharomyces cerevisiae} SCOP: c.97.1.2 PDB: 1ox7_A 1rb7_A 1ysd_A 1ysb_A 2o3k_A 1uaq_A Length = 161 Back     alignment and structure
>2w4l_A DCMP deaminse, deoxycytidylate deaminase; pyrimidine metabolism, nucleotide biosynthesis, zinc, hexamer, hydrolase, metal-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 178 Back     alignment and structure
>2hvw_A Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwich, protein-liand complex, hydrolase; HET: DCP DDN; 1.67A {Streptococcus mutans} PDB: 2hvv_A* Length = 184 Back     alignment and structure
>1z3a_A TRNA-specific adenosine deaminase; tRNA adenosine deaminase, dimer, zinc, metalloenzyme, structural genomics, PSI, protein structure initiative; 2.03A {Escherichia coli} SCOP: c.97.1.2 Length = 168 Back     alignment and structure
>3dh1_A TRNA-specific adenosine deaminase 2; zinc-binding protein, translation, tRNA processing, hydrolase, structural genomics; 2.80A {Homo sapiens} Length = 189 Back     alignment and structure
>2nx8_A TRNA-specific adenosine deaminase; TAD, hydrolase; 2.00A {Streptococcus pyogenes serotype M6} Length = 179 Back     alignment and structure
>1wwr_A TRNA adenosine deaminase TADA; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.80A {Aquifex aeolicus} SCOP: c.97.1.2 Length = 171 Back     alignment and structure
>1wkq_A Guanine deaminase; domain SWAP, the cytidine deaminase superfamily, substrate specificity, structural plasticity, hydrolase; 1.17A {Bacillus subtilis} SCOP: c.97.1.2 PDB: 1tiy_A Length = 164 Back     alignment and structure
>2a8n_A Cytidine and deoxycytidylate deaminase; RNA editing, RNA binding protein; 1.60A {Agrobacterium tumefaciens} SCOP: c.97.1.2 Length = 144 Back     alignment and structure
>2b3j_A TRNA adenosine deaminase; mixed alpha-beta, protein-RNA complex, RNA stem-loop, hydrolase/RNA complex; HET: P5P; 2.00A {Staphylococcus aureus subsp} SCOP: c.97.1.2 Length = 159 Back     alignment and structure
>2g84_A Cytidine and deoxycytidylate deaminase zinc- binding region; structural genomics, PSI, protein structure initiative; 1.40A {Nitrosomonas europaea atcc 19718} SCOP: c.97.1.2 Length = 197 Back     alignment and structure
>1vq2_A DCMP deaminase, deoxycytidylate deaminase; hydrolase; HET: DDN; 2.20A {Enterobacteria phage T4} SCOP: c.97.1.2 Length = 193 Back     alignment and structure
>3ky8_A Putative riboflavin biosynthesis protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL; 2.12A {Shewanella loihica} Length = 197 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target364 5-amino-6-(5-phosphoribosylamino)uracil reductase/diami
2b3z_A373 Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, 100.0
2g6v_A402 Riboflavin biosynthesis protein RIBD; RIBD APO structur 100.0
2hxv_A360 Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 100.0
2p4g_A270 Hypothetical protein; pyrimidine reductase-like protein 100.0
2azn_A219 HTP reductase, putative 5-amino-6-(5-phosphoribosylamin 100.0
3kgy_A231 Bifunctional deaminase-reductase domain protein; putati 99.97
2gd9_A189 Hypothetical protein YYAP; 2636623, structural genomics 99.96
3jtw_A178 Dihydrofolate reductase; YP_805003.1, structural genomi 99.94
3ky8_A197 Putative riboflavin biosynthesis protein; structural ge 99.94
1cz3_A168 Dihydrofolate reductase; dimer, hyperthermophIle, oxido 99.78
1vdr_A162 DHFR, dihydrofolate reductase; oxidoreductase, halophil 98.55
3dfr_A162 Dihydrofolate reductase; oxido-reductase; HET: NDP MTX; 98.39
3nrr_A 515 Dihydrofolate reductase-thymidylate synthase; structura 98.33
3ix9_A190 Dihydrofolate reductase; central beta sheet surrounded 98.19
1zdr_A164 Dihydrofolate reductase; DHFR, NADP, oxidoreductase; 2. 97.78
3ia4_A162 Dihydrofolate reductase; NADPH, methotrexate, oxidoredu 97.72
3dau_A159 Dihydrofolate reductase; oxidoreductase, pseudo-rossman 97.63
3jwk_A168 Dihydrofolate reductase; oxidoreductase; HET: NAP 5WB; 97.61
2w9h_A159 DHFR, dihydrofolate reductase; NADP, trimethoprim, oxid 97.11
1z3a_A168 TRNA-specific adenosine deaminase; tRNA adenosine deami 100.0
2nx8_A179 TRNA-specific adenosine deaminase; TAD, hydrolase; 2.00 100.0
2b3j_A159 TRNA adenosine deaminase; mixed alpha-beta, protein-RNA 100.0
1wwr_A171 TRNA adenosine deaminase TADA; homodimer, riken structu 100.0
2a8n_A144 Cytidine and deoxycytidylate deaminase; RNA editing, RN 99.97
1p6o_A161 Cytosine deaminase; hydrolase, dimer, inhibitor bound; 99.97
3dh1_A189 TRNA-specific adenosine deaminase 2; zinc-binding prote 99.96
1wkq_A164 Guanine deaminase; domain SWAP, the cytidine deaminase 99.96
1vq2_A193 DCMP deaminase, deoxycytidylate deaminase; hydrolase; H 99.94
2w4l_A178 DCMP deaminse, deoxycytidylate deaminase; pyrimidine me 99.94
2g84_A197 Cytidine and deoxycytidylate deaminase zinc- binding re 99.93
2nyt_A190 Probable C->U-editing enzyme apobec-2; cytidine deamina 95.43
2hvw_A184 Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwic 99.94
3g8q_A278 Predicted RNA-binding protein, contains thump domain; c 95.22
1j3k_A280 Bifunctional dihydrofolate reductase-thymidylate syntha 98.32
2bl9_A238 Dihydrofolate reductase-thymidylate synthase; plamodium 97.97
3jsu_A 608 Dihydrofolate reductase-thymidylate synthase; rossmann 97.94
1kmv_A186 DHFR, dihydrofolate reductase; oxidoreductase, antipara 98.25
2fzi_A206 Dihydrofolate reductase; trimethoprim derivatives, ring 98.22
2w3w_A167 Dihydrofolate reductase; nonclassical antifolates, one- 97.83
3cse_A227 Dihydrofolate reductase; protein-ligand complex, oxidor 97.61
1df7_A159 DHFR, dihydrofolate reductase; structure-based inhibito 97.43
3hj3_A 521 Chain A, crystal structure of DHFR; TS, enzyme, crossov 97.25
1aoe_A192 DHFR, dihydrofolate reductase; oxidoreductase, antifung 97.13
3irm_A 521 Bifunctional dihydrofolate reductase-thymidylate; DHFR- 96.48
1juv_A193 DHFR, dihydrofolate reductase; complexed with NADPH, ox 95.3
2z3g_A130 Blasticidin-S deaminase; hydrolase, cytidine deaminase 97.4
1r5t_A142 Cytidine deaminase; zinc dependent deaminase, RNA editi 96.69
2fr5_A146 Cytidine deaminase; zinc, tetrahydrouridine, protein- i 96.44
3dmo_A138 Cytidine deaminase; structural genomics, seattle struct 96.42
3b8f_A142 Putative blasticidin S deaminase; cytidine deaminase, s 95.87
2d30_A141 Cytidine deaminase; purines, pyrimidines, nucleosides, 95.8
1uwz_A136 Cytidine deaminase; CDD, tetramer, zinc binding, pyrimi 95.4
3mpz_A150 Cytidine deaminase; ssgcid, structu genomics, seattle s 95.29
3oj6_A158 Blasticidin-S deaminase; ssgcid, seattle structural gen 95.12
1ctt_A294 Cytidine deaminase; hydrolase; HET: DHZ; 2.20A {Escheri 94.98
3ir2_A207 DNA DC->DU-editing enzyme apobec-3G; antiviral defense, 94.24
>2b3z_A Riboflavin biosynthesis protein RIBD; alpha/beta/alpha, deaminase domain and reductase domain, hydrolase, oxidoreductase; 2.41A {Bacillus subtilis} SCOP: c.71.1.2 c.97.1.2 PDB: 2d5n_A* 3ex8_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=857.87  Aligned_cols=355  Identities=34%  Similarity=0.527  Sum_probs=331.9

Q ss_pred             CCHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCEEEEEEECCCCCCCHHHHHHHHHHCCHHCCCEEEEECCCCCCC
Q ss_conf             87789999999999998708821888964799986998999984388769848999999730010698899905732115
Q gi|254780348|r    3 VSSFDARFMSAALRFSRWHVGLTSTNPSVACLIVKDGIVIGRGVTAYGGCPHAEVQALEEAGEEARGATAYVTLEPCSHY   82 (364)
Q Consensus         3 ~~~~d~~~m~~a~~~a~~~~g~t~pNP~Vg~viv~~g~ii~~g~~~~~G~~HAE~~al~~~~~~~~~atlyvtLEPC~h~   82 (364)
                      ++++|++||++||++|++++|.|+|||+||||||+||+|||+|||+++|+||||++||++|+++++|||||||||||||+
T Consensus        10 ~~~~d~~~m~~Al~lA~~~~g~t~pNP~VG~viv~~g~ii~~G~h~~~G~~HAEv~Al~~a~~~~~gat~yvTLEPC~h~   89 (373)
T 2b3z_A           10 HGSMEEYYMKLALDLAKQGEGQTESNPLVGAVVVKDGQIVGMGAHLKYGEAHAEVHAIHMAGAHAEGADIYVTLEPCSHY   89 (373)
T ss_dssp             ---CHHHHHHHHHHHHGGGTTSSTTSCCCEEEEESSSSEEEEEECCSTTSCCHHHHHHHHHGGGGTTCEEEESSCCCCCC
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEEECCEEEEEEECCCCCCCCHHHHHHHHHCCCCCCCEEEEECCCCCCC
T ss_conf             66399999999999998547888999989999998998999886899997579999999617002597799983687777


Q ss_pred             CCCCHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCCCCCCEEE-ECCCCHHHHHHHHHHHHCCCCCCHHHHHHCCCHH
Q ss_conf             752105556530134324663010121101243311001898896-2221012320012222011342220110102787
Q gi|254780348|r   83 GRSPPCAQFIIECGIRRVVVCVDDPDVRVSGRGLQWLSQKGIIVD-RMMESEGKIFLHAYLTRQVEKRSHITLKIAVSQD  161 (364)
Q Consensus        83 GktppC~~~ii~~gIk~Vvi~~~DPnp~v~gkGi~~L~~~GI~V~-~~~~~~~~~ln~~f~~~~~~~rP~V~lK~A~SlD  161 (364)
                      |||||||++||++||||||||+.||||+|+|||+++|+++||+|+ +++++||.++|++||++++++||||++|+|+|+|
T Consensus        90 GktppC~~~ii~~gikrVv~~~~DPnp~v~g~g~~~L~~~gI~V~~g~~~~~~~~ln~~f~~~~~~~rP~V~lK~A~SlD  169 (373)
T 2b3z_A           90 GKTPPCAELIINSGIKRVFVAMRDPNPLVAGRGISMMKEAGIEVREGILADQAERLNEKFLHFMRTGLPYVTLKAAASLD  169 (373)
T ss_dssp             SSSCCHHHHHHHHTCCEEEESSCCSCTTTTTHHHHHHHTTTCEEEECTTHHHHHHHTHHHHHHHHHSSCEEEEEEEEETT
T ss_pred             CCCCHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHCCCEEEECCCHHHHHHHHHHHHHHHHCCCCEEEEEEEECCC
T ss_conf             88717889999709999999556578354885289998789989857218988876665556522589769999985687


Q ss_pred             HHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEHHHHCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHCCCCC
Q ss_conf             72021136532222101356667642014403663122013454235443444434421576446689980221003444
Q gi|254780348|r  162 NMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTAL  241 (364)
Q Consensus       162 GkIa~~~g~s~wIT~~~sr~~vh~lRa~~DaIlvG~~Tv~~DnP~Lt~R~~~~~~~~P~riVld~~l~i~~~~~l~~~~~  241 (364)
                      ||||..+|+|+||||++||.++|+||+++||||||++|++.|||+||||..+. .+||+|||+|+++++|.++++|++..
T Consensus       170 Gkia~~~g~s~wIT~~~sr~~vh~lRa~~DAIlvG~~Tv~~DnP~Lt~R~~~~-~~~P~riV~d~~l~~~~~~~i~~~~~  248 (373)
T 2b3z_A          170 GKIATSTGDSKWITSEAARQDAQQYRKTHQSILVGVGTVKADNPSLTCRLPNV-TKQPVRVILDTVLSIPEDAKVICDQI  248 (373)
T ss_dssp             SBSSCTTSCCTTSSCHHHHHHHTTHHHHSSEEEEEHHHHHHHCCCCCCCSTTC-CSCCEEEEECTTCCCCTTCHHHHSCS
T ss_pred             CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCCCCCCCCCCC-CCCCEEEEECCCCCCCCHHHEECCCC
T ss_conf             65333468740157777889998755525358982288445387022457775-67981898435554241233000478


Q ss_pred             CCEEEEECCCCCCCHHHHCCCCCCCCCCCC--CCCHHHHHHHHHHCCCCEEEECCHHHHHHHHHHCCCCCEEEEEEECEE
Q ss_conf             670798546554210110022322222333--222788999986079969998123899999997889889999960743
Q gi|254780348|r  242 LAPVIIVTENDDPVLALAFRKKNINIIYCD--CRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIV  319 (364)
Q Consensus       242 ~~~~ii~~~~~~~~~~~~~~~~~v~vi~~~--~~dl~~iL~~L~~~gi~~iLVEGG~~l~~sfl~~~LvDEl~ifiaP~i  319 (364)
                      ...+++++.+.+..+...+...++.++...  ..++.++|+.|+++||++||||||++|+++||+++||||+++|+||++
T Consensus       249 ~~~~i~~~~~~~~~~~~~l~~~~~~vi~~~~~~l~l~~il~~L~~~Gi~~lLVEGG~~L~~sfL~~~LvDEl~l~iAPki  328 (373)
T 2b3z_A          249 APTWIFTTARADEEKKKRLSAFGVNIFTLETERIQIPDVLKILAEEGIMSVYVEGGSAVHGSFVKEGCFQEIIFYFAPKL  328 (373)
T ss_dssp             SCEEEEECTTSCHHHHHHHHTTTCEEEECSSSSCCHHHHHHHHHHTTCCEEEEEECHHHHHHHHHHTCCSEEEEEEESBC
T ss_pred             CCEEEEECCCCCHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHCCCCEEEEEEHHHHHHHHHHCCCHHEEEEEECCCE
T ss_conf             87035513665467789888618714431001345799999987759888999057999999997776108876887831


Q ss_pred             ECCCCCCCCCCCCCC-----CCCCEEEEEEEECCCEEEEEEECC
Q ss_conf             268875233345454-----446405446886793699995074
Q gi|254780348|r  320 IGEGGIPSPLEEGYL-----EKNFMCVRRDYFGSDVCLEYIGKN  358 (364)
Q Consensus       320 lG~~g~~s~~~~~~~-----~~~~~l~~~~~ig~Dv~~~y~~k~  358 (364)
                      +|+++.++++.....     ...|++++++++|+|++++|++..
T Consensus       329 lGg~~~~~~~~~~~~~~l~~a~~l~l~~~~~~G~Di~i~~rP~k  372 (373)
T 2b3z_A          329 IGGTHAPSLISGEGFQSMKDVPLLQFTDITQIGRDIKLTAKPTK  372 (373)
T ss_dssp             CCCSSSCBSSCSSCCSSTTSSCBEEEEEEEEETTEEEEEEEEC-
T ss_pred             ECCCCCCCCCCCCCCCCHHHCCCCEEEEEEEECCEEEEEEEECC
T ss_conf             07888777557656358756666666479998985999999787



>2g6v_A Riboflavin biosynthesis protein RIBD; RIBD APO structure, structural genomics, structural proteomics in europe, spine, hydrolase; 2.60A {Escherichia coli} PDB: 2obc_A* 2o7p_A* Back     alignment and structure
>2hxv_A Diaminohydroxyphosphoribosylaminopyrimidine deaminase/ 5-amino-6-(5-phosphoribosylamino)uracil...; TM1828, structural genomics, PSI-2; HET: NDP; 1.80A {Thermotoga maritima} SCOP: c.71.1.2 c.97.1.2 Back     alignment and structure
>2p4g_A Hypothetical protein; pyrimidine reductase-like protein, structural genomics, JOIN for structural genomics; 2.30A {Corynebacterium diphtheriae nctc 13129ORGANISM_TAXID} Back     alignment and structure
>2azn_A HTP reductase, putative 5-amino-6-(5-phosphoribosylamino)uracil reductase; oxidoreductase; HET: MA5 NAP EPE; 2.70A {Methanocaldococcus jannaschii} SCOP: c.71.1.2 Back     alignment and structure
>3kgy_A Bifunctional deaminase-reductase domain protein; putative dihydrofolate reductase, structural genomics; HET: MSE NDP; 1.50A {Chloroflexus aurantiacus j-10-fl} Back     alignment and structure
>2gd9_A Hypothetical protein YYAP; 2636623, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.30A {Bacillus subtilis} Back     alignment and structure
>3jtw_A Dihydrofolate reductase; YP_805003.1, structural genomics, joint center for structural genomics, JCSG; 1.90A {Pediococcus pentosaceus atcc 25745} Back     alignment and structure
>3ky8_A Putative riboflavin biosynthesis protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL; 2.12A {Shewanella loihica} Back     alignment and structure
>1cz3_A Dihydrofolate reductase; dimer, hyperthermophIle, oxidoreductase; 2.10A {Thermotoga maritima} SCOP: c.71.1.1 PDB: 1d1g_A* Back     alignment and structure
>1vdr_A DHFR, dihydrofolate reductase; oxidoreductase, halophilic enzyme; 2.55A {Haloferax volcanii} SCOP: c.71.1.1 PDB: 2ith_A 2jyb_A Back     alignment and structure
>3dfr_A Dihydrofolate reductase; oxido-reductase; HET: NDP MTX; 1.70A {Lactobacillus casei} SCOP: c.71.1.1 PDB: 1ao8_A* 1bzf_A* 1dis_A* 1diu_A* 1lud_A* 2hm9_A* 2hqp_A* Back     alignment and structure
>3nrr_A Dihydrofolate reductase-thymidylate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, niaid, DHFR; HET: NAP D16 UMP; 1.80A {Babesia bovis} PDB: 3kjr_A* 3i3r_A* 3k2h_A* Back     alignment and structure
>3ix9_A Dihydrofolate reductase; central beta sheet surrounded by 4 alpha helices, oxidoreductase; HET: NDP MTX; 1.95A {Streptococcus pneumoniae} Back     alignment and structure
>1zdr_A Dihydrofolate reductase; DHFR, NADP, oxidoreductase; 2.00A {Geobacillus stearothermophilus} Back     alignment and structure
>3ia4_A Dihydrofolate reductase; NADPH, methotrexate, oxidoreductase; HET: NDP MTX; 1.70A {Moritella profunda} PDB: 3ia5_A 2zza_A* Back     alignment and structure
>3dau_A Dihydrofolate reductase; oxidoreductase, pseudo-rossmann fold, adenine nucleotide binding domain, antibiotic resistance; HET: MTX NAP; 1.50A {Escherichia coli K12} PDB: 1ddr_A* 1dds_A* 3k74_A 1ra9_A* 1dre_A* 1drh_A* 1dyi_A* 1dyh_A* 1jol_A* 1jom_A* 1ra1_A* 1dyj_A* 1ra3_A* 1ra8_A* 1ra2_A* 1rb2_A* 1rb3_A* 1rc4_A* 1rd7_A* 1re7_A* ... Back     alignment and structure
>3jwk_A Dihydrofolate reductase; oxidoreductase; HET: NAP 5WB; 2.08A {Bacillus anthracis} PDB: 3jw5_A* 3jwf_A* 3jwc_A* 3jvx_A* 3jwm_A* 3jw3_A* 3e0b_A* 3dat_A* 2qk8_A* 3fl8_A* 3fl9_A* 2kgk_A* Back     alignment and structure
>2w9h_A DHFR, dihydrofolate reductase; NADP, trimethoprim, oxidoreductase, one-carbon metabolism; HET: TOP; 1.48A {Staphylococcus aureus} PDB: 2w9g_A* 3frd_X* 3fre_X* 3frf_X* 3fyv_X* 3fyw_X* 3frb_X* 3fra_X* 3fy8_X* 3fy9_X* 3fq0_A* 3f0b_X* 3f0s_X* 3f0q_X* 3fqc_A* 3fqz_A* 3m08_A* 3f0u_X* 3f0v_X* 3f0x_X* ... Back     alignment and structure
>1z3a_A TRNA-specific adenosine deaminase; tRNA adenosine deaminase, dimer, zinc, metalloenzyme, structural genomics, PSI, protein structure initiative; 2.03A {Escherichia coli} SCOP: c.97.1.2 Back     alignment and structure
>2nx8_A TRNA-specific adenosine deaminase; TAD, hydrolase; 2.00A {Streptococcus pyogenes serotype M6} Back     alignment and structure
>2b3j_A TRNA adenosine deaminase; mixed alpha-beta, protein-RNA complex, RNA stem-loop, hydrolase/RNA complex; HET: P5P; 2.00A {Staphylococcus aureus subsp} SCOP: c.97.1.2 Back     alignment and structure
>1wwr_A TRNA adenosine deaminase TADA; homodimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.80A {Aquifex aeolicus} SCOP: c.97.1.2 Back     alignment and structure
>2a8n_A Cytidine and deoxycytidylate deaminase; RNA editing, RNA binding protein; 1.60A {Agrobacterium tumefaciens} SCOP: c.97.1.2 Back     alignment and structure
>1p6o_A Cytosine deaminase; hydrolase, dimer, inhibitor bound; 1.14A {Saccharomyces cerevisiae} SCOP: c.97.1.2 PDB: 1ox7_A 1rb7_A 1ysd_A 1ysb_A 2o3k_A 1uaq_A Back     alignment and structure
>3dh1_A TRNA-specific adenosine deaminase 2; zinc-binding protein, translation, tRNA processing, hydrolase, structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>1wkq_A Guanine deaminase; domain SWAP, the cytidine deaminase superfamily, substrate specificity, structural plasticity, hydrolase; 1.17A {Bacillus subtilis} SCOP: c.97.1.2 PDB: 1tiy_A Back     alignment and structure
>1vq2_A DCMP deaminase, deoxycytidylate deaminase; hydrolase; HET: DDN; 2.20A {Enterobacteria phage T4} SCOP: c.97.1.2 Back     alignment and structure
>2w4l_A DCMP deaminse, deoxycytidylate deaminase; pyrimidine metabolism, nucleotide biosynthesis, zinc, hexamer, hydrolase, metal-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2g84_A Cytidine and deoxycytidylate deaminase zinc- binding region; structural genomics, PSI, protein structure initiative; 1.40A {Nitrosomonas europaea atcc 19718} SCOP: c.97.1.2 Back     alignment and structure
>2nyt_A Probable C->U-editing enzyme apobec-2; cytidine deaminase, zinc-ION binding, hydrolase; 2.50A {Homo sapiens} PDB: 2rpz_A Back     alignment and structure
>2hvw_A Deoxycytidylate deaminase; 3-layer (alpha-beta)-sandwich, protein-liand complex, hydrolase; HET: DCP DDN; 1.67A {Streptococcus mutans} PDB: 2hvv_A* Back     alignment and structure
>3g8q_A Predicted RNA-binding protein, contains thump domain; cytidine deaminase, ferredoxin-like domain; 2.40A {Methanopyrus kandleri} Back     alignment and structure
>1j3k_A Bifunctional dihydrofolate reductase-thymidylate synthase; oxidoreductase, transferase; HET: WRA NDP UMP; 2.10A {Plasmodium falciparum} SCOP: c.71.1.1 PDB: 3dg8_A* 1j3j_A* 1j3i_A* 3dga_A* Back     alignment and structure
>2bl9_A Dihydrofolate reductase-thymidylate synthase; plamodium vivax, pyrimethamine, malaria, drug resistance, oxidoreductase; HET: NDP CP6; 1.9A {Plasmodium vivax} PDB: 2blb_A* 2blc_A* 2bla_A* Back     alignment and structure
>3jsu_A Dihydrofolate reductase-thymidylate synthase; rossmann fold, oxidoreductase, transferase; HET: KA5 NDP UMP; 2.70A {Plasmodium falciparum} Back     alignment and structure
>1kmv_A DHFR, dihydrofolate reductase; oxidoreductase, antiparasitic drugs, lipophilic antifolates; HET: LII NDP; 1.05A {Homo sapiens} SCOP: c.71.1.1 PDB: 1dhf_A* 1hfr_A* 1drf_A* 1kms_A* 1ohj_A* 1ohk_A* 1pd8_A* 1pd9_A* 1pdb_A 1s3u_A* 1s3v_A* 1s3w_A* 1u72_A* 1yho_A* 2c2s_A* 2c2t_A* 2dhf_A* 3ghw_A* 3fs6_A* 1mvs_A* ... Back     alignment and structure
>2fzi_A Dihydrofolate reductase; trimethoprim derivatives, ring stacking interactions, oxidoreductase; HET: NAP DH3; 1.60A {Pneumocystis carinii} SCOP: c.71.1.1 PDB: 1daj_A* 1cd2_A* 1e26_A* 1klk_A* 1ly3_A* 1ly4_A* 1s3y_A* 2cd2_A* 2fzh_A* 1dyr_A* 3cd2_A* 4cd2_A* 1vj3_A* Back     alignment and structure
>2w3w_A Dihydrofolate reductase; nonclassical antifolates, one-carbon metabolism, lipophilic antifolates, NADP, oxidoreductase; HET: VG9 NDP; 1.60A {Mycobacterium avium} PDB: 2w3v_A* Back     alignment and structure
>3cse_A Dihydrofolate reductase; protein-ligand complex, oxidoreductase; HET: NAP N22; 1.60A {Candida glabrata} PDB: 3eej_A* 3eek_A* 3eel_A* 3eem_A* Back     alignment and structure
>1df7_A DHFR, dihydrofolate reductase; structure-based inhibitor design, folateanalogs, rossmann fold, nicotinamide adenine dinucleotide; HET: NDP MTX; 1.70A {Mycobacterium tuberculosis} SCOP: c.71.1.1 PDB: 1dg5_A* 1dg7_A* 1dg8_A* 2cig_A* Back     alignment and structure
>3hj3_A Chain A, crystal structure of DHFR; TS, enzyme, crossover, non-active site, oxidoreductase; HET: UMP CB3 MTX NDP; 2.70A {Cryptosporidium hominis} PDB: 1qzf_A* 1sej_A* 3dl5_A* 3dl6_A* 2oip_A* Back     alignment and structure
>1aoe_A DHFR, dihydrofolate reductase; oxidoreductase, antifungal target; HET: NDP GW3; 1.60A {Candida albicans} SCOP: c.71.1.1 PDB: 1ai9_A* 1ia1_A* 1ia2_A* 1ia3_A* 1ia4_A* 1m78_A* 1m79_A* 1m7a_A* Back     alignment and structure
>3irm_A Bifunctional dihydrofolate reductase-thymidylate; DHFR-TS antifolate complex, methyltransfe multifunctional enzyme, NADP; HET: 1CY; 2.10A {Trypanosoma cruzi} PDB: 3inv_A* 3irn_A* 3iro_A* 2h2q_A* 3cl9_A* 3clb_A* 3hbb_A* 3kjs_A* Back     alignment and structure
>1juv_A DHFR, dihydrofolate reductase; complexed with NADPH, oxidoreductase; HET: NDP; 1.70A {Enterobacteria phage T4} SCOP: c.71.1.1 Back     alignment and structure
>2z3g_A Blasticidin-S deaminase; hydrolase, cytidine deaminase family, zinc, tetramer; HET: TRE; 1.50A {Aspergillus terreus} SCOP: c.97.1.1 PDB: 1wn6_A* 1wn5_A* 2z3h_A* 2z3j_A 2z3i_A* Back     alignment and structure
>1r5t_A Cytidine deaminase; zinc dependent deaminase, RNA editing, apobec-1 related protein, hydrolase; 2.00A {Saccharomyces cerevisiae} SCOP: c.97.1.1 Back     alignment and structure
>2fr5_A Cytidine deaminase; zinc, tetrahydrouridine, protein- inhibitor complex, alternate conformation of Arg68, hydrolase; HET: TYU; 1.48A {Mus musculus} SCOP: c.97.1.1 PDB: 1zab_A* 2fr6_A* 1mq0_A* Back     alignment and structure
>3dmo_A Cytidine deaminase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3b8f_A Putative blasticidin S deaminase; cytidine deaminase, structural genomics, PSI-2, MCSG, protein structure initiative; 1.90A {Bacillus anthracis} Back     alignment and structure
>2d30_A Cytidine deaminase; purines, pyrimidines, nucleosides, nucleotides, salvage of nucleosides and nucleotides, structural genomics; 2.40A {Bacillus anthracis} SCOP: c.97.1.1 Back     alignment and structure
>1uwz_A Cytidine deaminase; CDD, tetramer, zinc binding, pyrimidine metabolism, salvage, hydrolase; HET: THU; 1.99A {Bacillus subtilis} SCOP: c.97.1.1 PDB: 1ux0_A* 1jtk_A* 1ux1_A* Back     alignment and structure
>3mpz_A Cytidine deaminase; ssgcid, structu genomics, seattle structural genomics center for infectious hydrolase; 1.70A {Mycobacterium smegmatis} PDB: 3ijf_X Back     alignment and structure
>3oj6_A Blasticidin-S deaminase; ssgcid, seattle structural genomics for infectious disease, hydrolase; 1.70A {Coccidioides immitis} Back     alignment and structure
>1ctt_A Cytidine deaminase; hydrolase; HET: DHZ; 2.20A {Escherichia coli} SCOP: c.97.1.1 c.97.1.1 PDB: 1aln_A* 1af2_A* 1ctu_A* Back     alignment and structure
>3ir2_A DNA DC->DU-editing enzyme apobec-3G; antiviral defense, HOST-virus interaction, hydrolase, metal-binding, zinc, alternative splicing, cytoplasm; HET: DNA; 2.25A {Homo sapiens} PDB: 2kem_A* 2jyw_A* 2kbo_A* 3e1u_A* 3iqs_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 364 5-amino-6-(5-phosphoribosylamino)uracil reductase/diami
d2azna1219 c.71.1.2 (A:6-224) HTP reductase {Methanococcus jannasc 2e-24
d2hxva1198 c.71.1.2 (A:148-345) Riboflavin biosynthesis protein Ri 4e-20
d2b3za1214 c.71.1.2 (A:146-359) Riboflavin biosynthesis protein Ri 2e-16
d2b3za2145 c.97.1.2 (A:1-145) Riboflavin biosynthesis protein RibD 7e-18
d2hxva2147 c.97.1.2 (A:1-147) Riboflavin biosynthesis protein RibD 2e-17
d1z3aa1156 c.97.1.2 (A:13-168) tRNA adenosine deaminase TadA {Esch 1e-11
d1wwra1151 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Aquif 2e-11
d1wkqa_158 c.97.1.2 (A:) Guanine deaminase GuaD {Bacillus subtilis 3e-11
d2a8na1130 c.97.1.2 (A:2-131) Cytidine and deoxycytidylate deamina 4e-11
d2b3ja1151 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Staph 4e-10
d1p6oa_156 c.97.1.2 (A:) Cytosine deaminase {Baker's yeast (Saccha 8e-10
d2g84a1189 c.97.1.2 (A:1-189) Putative deaminase NE0047 {Nitrosomo 1e-09
d1vq2a_193 c.97.1.2 (A:) Deoxycytidylate deaminase {Bacteriophage 3e-10
>d2azna1 c.71.1.2 (A:6-224) HTP reductase {Methanococcus jannaschii [TaxId: 2190]} Length = 219 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Dihydrofolate reductase-like
superfamily: Dihydrofolate reductase-like
family: RibD C-terminal domain-like
domain: HTP reductase
species: Methanococcus jannaschii [TaxId: 2190]
 Score =  107 bits (267), Expect = 2e-24
 Identities = 51/217 (23%), Positives = 96/217 (44%), Gaps = 11/217 (5%)

Query: 147 EKRSHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPE 206
           EK+ +I   + ++ D  +         I+      +VH +RA  D I+VGIGTVL DDP 
Sbjct: 1   EKKPYIISNVGMTLDGKLATIN-NDSRISCEEDLIRVHKIRANVDGIMVGIGTVLKDDPR 59

Query: 207 LTCRLNGLQEHSPMRIILDPHFKLSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNIN 266
           LT        + P+RI++D   ++ L+++++       +    + ++         +++ 
Sbjct: 60  LTVHKIKSDRN-PVRIVVDSKLRVPLNARVLNKDAKTIIATTEDTNEEKEKKIKILEDMG 118

Query: 267 IIYCDCR----DLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRLVDSIILYRSQIVIGE 322
           +    C     DLKKL+ IL  +G+ S+L+EGG  +        LVD + +Y +  + G 
Sbjct: 119 VEVVKCGRGKVDLKKLMDILYDKGIKSILLEGGGTLNWGMFKEGLVDEVSVYIAPKIFGG 178

Query: 323 GGIPSPLEEGYLEK-----NFMCVRRDYFGSDVCLEY 354
              P+ ++    +                G  + LE+
Sbjct: 179 KEAPTYVDGEGFKTVDECVKLELKNFYRLGEGIVLEF 215


>d2hxva1 c.71.1.2 (A:148-345) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]} Length = 198 Back     information, alignment and structure
>d2b3za1 c.71.1.2 (A:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} Length = 214 Back     information, alignment and structure
>d2b3za2 c.97.1.2 (A:1-145) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} Length = 145 Back     information, alignment and structure
>d2hxva2 c.97.1.2 (A:1-147) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]} Length = 147 Back     information, alignment and structure
>d1z3aa1 c.97.1.2 (A:13-168) tRNA adenosine deaminase TadA {Escherichia coli [TaxId: 562]} Length = 156 Back     information, alignment and structure
>d1wwra1 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 63363]} Length = 151 Back     information, alignment and structure
>d1wkqa_ c.97.1.2 (A:) Guanine deaminase GuaD {Bacillus subtilis [TaxId: 1423]} Length = 158 Back     information, alignment and structure
>d2a8na1 c.97.1.2 (A:2-131) Cytidine and deoxycytidylate deaminase CodA {Agrobacterium tumefaciens [TaxId: 358]} Length = 130 Back     information, alignment and structure
>d2b3ja1 c.97.1.2 (A:1-151) tRNA adenosine deaminase TadA {Staphylococcus aureus [TaxId: 1280]} Length = 151 Back     information, alignment and structure
>d1p6oa_ c.97.1.2 (A:) Cytosine deaminase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 156 Back     information, alignment and structure
>d2g84a1 c.97.1.2 (A:1-189) Putative deaminase NE0047 {Nitrosomonas europaea [TaxId: 915]} Length = 189 Back     information, alignment and structure
>d1vq2a_ c.97.1.2 (A:) Deoxycytidylate deaminase {Bacteriophage T4 [TaxId: 10665]} Length = 193 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target364 5-amino-6-(5-phosphoribosylamino)uracil reductase/diami
d2b3za1214 Riboflavin biosynthesis protein RibD {Bacillus subtilis 100.0
d2azna1219 HTP reductase {Methanococcus jannaschii [TaxId: 2190]} 100.0
d2hxva1198 Riboflavin biosynthesis protein RibD {Thermotoga mariti 100.0
d1d1ga_164 Dihydrofolate reductase, prokaryotic type {Thermotoga m 99.81
d1seja1178 Bifunctional enzyme dihydrofolate reductase-thymidylate 98.42
d1vdra_157 Dihydrofolate reductase, prokaryotic type {Haloferax vo 98.38
d3dfra_162 Dihydrofolate reductase, prokaryotic type {Lactobacillu 98.34
d1kmva_186 Dihydrofolate reductases, eukaryotic type {Human (Homo 98.17
d1ra9a_159 Dihydrofolate reductase, prokaryotic type {Escherichia 97.89
d2hxva2147 Riboflavin biosynthesis protein RibD {Thermotoga mariti 100.0
d2b3za2145 Riboflavin biosynthesis protein RibD {Bacillus subtilis 100.0
d1z3aa1156 tRNA adenosine deaminase TadA {Escherichia coli [TaxId: 100.0
d2b3ja1151 tRNA adenosine deaminase TadA {Staphylococcus aureus [T 100.0
d1wwra1151 tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 100.0
d1p6oa_156 Cytosine deaminase {Baker's yeast (Saccharomyces cerevi 99.97
d1wkqa_158 Guanine deaminase GuaD {Bacillus subtilis [TaxId: 1423] 99.97
d1vq2a_193 Deoxycytidylate deaminase {Bacteriophage T4 [TaxId: 106 99.95
d2a8na1130 Cytidine and deoxycytidylate deaminase CodA {Agrobacter 99.94
d2g84a1189 Putative deaminase NE0047 {Nitrosomonas europaea [TaxId 99.93
d1j3ka_231 Bifunctional enzyme dihydrofolate reductase-thymidylate 98.35
d2fzia1206 Dihydrofolate reductases, eukaryotic type {Fungus (Pneu 98.3
d1df7a_159 Dihydrofolate reductase, prokaryotic type {Mycobacteriu 97.34
d1aoea_192 Dihydrofolate reductases, eukaryotic type {Yeast (Candi 97.27
d1alna2144 Two-domain cytidine deaminase {Escherichia coli [TaxId: 97.79
d2z3ga1123 Blasticidin-S deaminase {Aspergillus terreus [TaxId: 33 96.67
d1r5ta_141 mono-domain cytidine deaminase {Baker's yeast (Saccharo 96.39
d2fr5a1136 mono-domain cytidine deaminase {Mouse (Mus musculus) [T 96.03
d1uwza_130 mono-domain cytidine deaminase {Bacillus subtilis [TaxI 95.92
d2d30a1124 mono-domain cytidine deaminase {Bacillus anthracis [Tax 95.65
d1alna1150 Two-domain cytidine deaminase {Escherichia coli [TaxId: 95.61
d1juva_193 Dihydrofolate reductase, prokaryotic type {Bacteriophag 94.71
>d2b3za1 c.71.1.2 (A:146-359) Riboflavin biosynthesis protein RibD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Dihydrofolate reductase-like
superfamily: Dihydrofolate reductase-like
family: RibD C-terminal domain-like
domain: Riboflavin biosynthesis protein RibD
species: Bacillus subtilis [TaxId: 1423]
Probab=100.00  E-value=0  Score=355.15  Aligned_cols=206  Identities=30%  Similarity=0.412  Sum_probs=186.1

Q ss_pred             CHHHHHHCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEHHHHCCCCCCCCCCCCCCCCCCCEEEEECCCCC
Q ss_conf             22011010278772021136532222101356667642014403663122013454235443444434421576446689
Q gi|254780348|r  150 SHITLKIAVSQDNMIGMAGCGSVPITGFISKNQVHLLRAQSDAILVGIGTVLADDPELTCRLNGLQEHSPMRIILDPHFK  229 (364)
Q Consensus       150 P~V~lK~A~SlDGkIa~~~g~s~wIT~~~sr~~vh~lRa~~DaIlvG~~Tv~~DnP~Lt~R~~~~~~~~P~riVld~~l~  229 (364)
                      |||++|+|+|+|||||..+|+++||||++||+++|+||+++||||+|++|++.|||+||+|.++. .++|.+||+|++++
T Consensus         1 P~V~~k~A~SlDG~Ia~~~g~s~wit~~~sr~~~h~lR~~~dailvG~~Tv~~D~p~l~~R~~~~-~~~p~~vv~d~~l~   79 (214)
T d2b3za1           1 PYVTLKAAASLDGKIATSTGDSKWITSEAARQDAQQYRKTHQSILVGVGTVKADNPSLTCRLPNV-TKQPVRVILDTVLS   79 (214)
T ss_dssp             CEEEEEEEEETTSBSSCTTSCCTTSSCHHHHHHHTTHHHHSSEEEEEHHHHHHHCCCCCCCSTTC-CSCCEEEEECTTCC
T ss_pred             CEEEEEEEECCCCCEECCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHCCCCCCCCHHCCCCCCC-CCCCCCCCCCCCCC
T ss_conf             97999998879788788899667889989999999999861211233053101320000246543-23330211133455


Q ss_pred             CCHHHHHCCCCCCCEEEEECCCCCCCHHHHCCCCCCCCCCCC--CCCHHHHHHHHHHCCCCEEEECCHHHHHHHHHHCCC
Q ss_conf             980221003444670798546554210110022322222333--222788999986079969998123899999997889
Q gi|254780348|r  230 LSLDSKIIKTALLAPVIIVTENDDPVLALAFRKKNINIIYCD--CRDLKKLLTILVGRGVTSLLVEGGAAVAHSFINSRL  307 (364)
Q Consensus       230 i~~~~~l~~~~~~~~~ii~~~~~~~~~~~~~~~~~v~vi~~~--~~dl~~iL~~L~~~gi~~iLVEGG~~l~~sfl~~~L  307 (364)
                      +++++++|.......+++++...+..+...+...++.++...  ..|++++++.|+++||++||||||++++++||++||
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~L~~~gi~~ilvEGG~~l~~sfl~~~L  159 (214)
T d2b3za1          80 IPEDAKVICDQIAPTWIFTTARADEEKKKRLSAFGVNIFTLETERIQIPDVLKILAEEGIMSVYVEGGSAVHGSFVKEGC  159 (214)
T ss_dssp             CCTTCHHHHSCSSCEEEEECTTSCHHHHHHHHTTTCEEEECSSSSCCHHHHHHHHHHTTCCEEEEEECHHHHHHHHHHTC
T ss_pred             CCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCC
T ss_conf             35211278740356411111112344555553036542112111212389999998779977999726788899985574


Q ss_pred             CCEEEEEEECEEECCCCCCCCCCCCCC-----CCCCEEEEEEEECCCEEEEEEE
Q ss_conf             889999960743268875233345454-----4464054468867936999950
Q gi|254780348|r  308 VDSIILYRSQIVIGEGGIPSPLEEGYL-----EKNFMCVRRDYFGSDVCLEYIG  356 (364)
Q Consensus       308 vDEl~ifiaP~ilG~~g~~s~~~~~~~-----~~~~~l~~~~~ig~Dv~~~y~~  356 (364)
                      |||+++|+||+++|+++.+++++....     ...|++++++++|+|++++|++
T Consensus       160 vDEl~l~iaP~ilG~~~~~~~~~~~~~~~l~~~~~l~l~~~~~~g~Di~l~~~p  213 (214)
T d2b3za1         160 FQEIIFYFAPKLIGGTHAPSLISGEGFQSMKDVPLLQFTDITQIGRDIKLTAKP  213 (214)
T ss_dssp             CSEEEEEEESBCCCCSSSCBSSCSSCCSSTTSSCBEEEEEEEEETTEEEEEEEE
T ss_pred             HHEEEEEECCEEECCCCCCCCCCCCCCCCHHHCCCCEEEEEEEECCEEEEEEEE
T ss_conf             213656887756558887654477571284446265864689989829999997



>d2azna1 c.71.1.2 (A:6-224) HTP reductase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hxva1 c.71.1.2 (A:148-345) Riboflavin biosynthesis protein RibD {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d1ga_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure