254780349

254780349

serine hydroxymethyltransferase

GeneID in NCBI database:8209334Locus tag:CLIBASIA_01170
Protein GI in NCBI database:254780349Protein Accession:YP_003064762.1
Gene range:-(244052, 245353)Protein Length:433aa
Gene description:serine hydroxymethyltransferase
COG prediction:[E] Glycine/serine hydroxymethyltransferase
KEGG prediction:glyA; serine hydroxymethyltransferase (EC:2.1.2.1); K00600 glycine hydroxymethyltransferase [EC:2.1.2.1]
SEED prediction:Serine hydroxymethyltransferase (EC 2.1.2.1)
Pathway involved in KEGG:Methane metabolism [PATH:las00680]
Glycine, serine and threonine metabolism [PATH:las00260]
Cyanoamino acid metabolism
One carbon pool by folate [PATH:las00670]
Subsystem involved in SEED:Glycine and Serine Utilization;
Serine Biosynthesis;
Glycine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430---
MTIICKNRFFQQSLIESDPDVFSLIGQESCRQNDEIQLIASENIVSRAVLEAQGSILTNKYAEGYPSKRYYGGCQYVDDIENIAIERAKKLFNVNFVNVQSHSGSQMNQGVFLALMHPGDSFMGLSLDSGGHLTHGSSVNMSGKWFKAIPYNVRKEDGLLDMHEIESLAIEYNPKLIIVGGTAYSRVWDWERFRSIADSIGAYLMADISHISGLVVGGQHPSPVPHCHIVTTTTHKSLRGPRGGLIMTNHADLAKKINSAIFPGLQGGPFMHSIAAKAVAFGEALSSEFRDYAKQIVLNSQALAKKLQFLGFDIVSGGTDNHLMLVDLRSKRMTGKRAESILGRVSITCNKNSIPFDPESPFITSGIRLGTPSGTTRGFKEKDFEYIGELIAQILDGSSSDEENHSLELTVLHKVQEFVHCFPIYDFSASALK
ccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccEEccccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHcccccEEEEcccccccccccccHHHHHHHHcEEEEcccccccccccHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHcccEEEEcccccccEEccccccccccccEEEEEEccccccccccEEEEEcHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccEEEEEEEccccccHHHHHHHHHHHcEEEccccccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHcc
ccccccHHHHcccHHHHcHHHHHHHHHHHHHHHHcEEcccccccccHHHHHHHccHHHHccccEEccEEcccccHHHHHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHcccccEEEEEcHHHcccHHHcccccHHHHHcEEEEEcEccccccEcHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHccEEEEEccccHHHHHccccccccccccEEEEEccccccccccEEEEcccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccEEHHHcccccEEEEEcHHHcccHHHHHHHHHHccEEcEEccccccccccccccEEEEEcHHHHHccccHHHHHHHHHHHHHHHHccccHHccHHHHHHHHHHHHHHHHccccccccHHHcc
mtiicknrffqqsliesdpdvfsligqescrqnDEIQLIASENIVSRAVLEAQGSILtnkyaegypskryyggcqyvdDIENIAIERAKKLFNVNFVNvqshsgsqmnQGVFLALmhpgdsfmglsldsgghlthgssvnmsgkwfkaipynvrkedglldmhEIESLaieynpkliivGGTAYSRVWDWERFRSIADSIGAYLMADISHIsglvvggqhpspvphchivtttthkslrgprgglimtNHADLAKKINsaifpglqggpfmHSIAAKAVAFGEALSSEFRDYAKQIVLNSQALAKKLQFLGfdivsggtdnhLMLVDLRskrmtgkraESILGRVSitcnknsipfdpespfitsgirlgtpsgttrgfkekDFEYIGELIAQIldgsssdeenhslELTVLHKVQEFVHcfpiydfsasalk
mtiicknrffqqsliesDPDVFSLIGQESCRQNDEIQLIASENIVSRAVLEAQGSILTNKYAEGYPSKRYYGGCQYVDDIENIAIERAKKLFNVNFVNVQSHSGSQMNQGVFLALMHPGDSFMGLSLDSGGHLTHGSSVNMSGKWFKAIPYNVRKEDGLLDMHEIESLAieynpkliiVGGTAYSRVWDWERFRSIADSIGAYLMADISHISGLVVGGQHPSPVPHCHIVTTtthkslrgprGGLIMTNHADLAKKINSAIFPGLQGGPFMHSIAAKAVAFGEALSSEFRDYAKQIVLNSQALAKKLQFLGFDivsggtdnHLMLVDLRSKRMTGKRAESILGRVSITCNKNSIPFDPESPFITSGIRLGTPSGTTRGFKEKDFEYIGELIAQILDGSSSDEENHSLELTVLHKVQEFVHCFPIYDFSASALK
MTIICKNRFFQQSLIESDPDVFSLIGQESCRQNDEIQLIASENIVSRAVLEAQGSILTNKYAEGYPSKRYYGGCQYVDDIENIAIERAKKLFNVNFVNVQSHSGSQMNQGVFLALMHPGDSFMGLSLDSGGHLTHGSSVNMSGKWFKAIPYNVRKEDGLLDMHEIESLAIEYNPKLIIVGGTAYSRVWDWERFRSIADSIGAYLMADISHISGLVVGGQHPSPVPHCHIVTTTTHKSLRGPRGGLIMTNHADLAKKINSAIFPGLQGGPFMHSIAAKAVAFGEALSSEFRDYAKQIVLNSQALAKKLQFLGFDIVSGGTDNHLMLVDLRSKRMTGKRAESILGRVSITCNKNSIPFDPESPFITSGIRLGTPSGTTRGFKEKDFEYIGELIAQILDGSSSDEENHSLELTVLHKVQEFVHCFPIYDFSASALK
***********QSLIESDPDVFSLIGQESCRQNDEIQLIASENIVSRAVLEAQGSILTNKYAEGYPSKRYYGGCQYVDDIENIAIERAKKLFNVNFVNVQSHSGSQMNQGVFLALMHPGDSFMGLSLDSGGHLTHGSSVNMSGKWFKAIPYNVRKEDGLLDMHEIESLAIEYNPKLIIVGGTAYSRVWDWERFRSIADSIGAYLMADISHISGLVVGGQHPSPVPHCHIVTTTTHKSLRGPRGGLIMTNHADLAKKINSAIFPGLQGGPFMHSIAAKAVAFGEALSSEFRDYAKQIVLNSQALAKKLQFLGFDIVSGGTDNHLMLVDLRSKRMTGKRAESILGRVSITCNKNSIPFDPESPFITSGIRLGTPSGTTRGFKEKDFEYIGELIAQILDGSSSDEENHSLELTVLHKVQEFVHCFPIYDFSA****
MTIICKNRFFQQSLIESDPDVFSLIGQESCRQNDEIQLIASENIVSRAVLEAQGSILTNKYAEGYPSKRYYGGCQYVDDIENIAIERAKKLFNVNFVNVQSHSGSQMNQGVFLALMHPGDSFMGLSLDSGGHLTHGSSVNMSGKWFKAIPYNVRKEDGLLDMHEIESLAIEYNPKLIIVGGTAYSRVWDWERFRSIADSIGAYLMADISHISGLVVGGQHPSPVPHCHIVTTTTHKSLRGPRGGLIMTNHADLAKKINSAIFPGLQGGPFMHSIAAKAVAFGEALSSEFRDYAKQIVLNSQALAKKLQFLGFDIVSGGTDNHLMLVDLRSKRMTGKRAESILGRVSITCNKNSIPFDPESPFITSGIRLGTPSGTTRGFKEKDFEYIGELIAQILDGSSSDEENHSLELTVLHKVQEFVHCFPIYDFSASALK
***ICKNRFFQQSLIESDPDVFSLIGQESCRQNDEIQLIASENIVSRAVLEAQGSILTNKYAEGYPSKRYYGGCQYVDDIENIAIERAKKLFNVNFVNVQSHSGSQMNQGVFLALMHPGDSFMGLSLDSGGHLTHGSSVNMSGKWFKAIPYNVRKEDGLLDMHEIESLAIEYNPKLIIVGGTAYSRVWDWERFRSIADSIGAYLMADISHISGLVVGGQHPSPVPHCHIVTTTTHKSLRGPRGGLIMTNHADLAKKINSAIFPGLQGGPFMHSIAAKAVAFGEALSSEFRDYAKQIVLNSQALAKKLQFLGFDIVSGGTDNHLMLVDLRSKRMTGKRAESILGRVSITCNKNSIPFDPESPFITSGIRLGTPSGTTRGFKEKDFEYIGELIAQILDGSSSDEENHSLELTVLHKVQEFVHCFPIYDFSASALK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIICKNRFFQQSLIESDPDVFSLIGQESCRQNDEIQLIASENIVSRAVLEAQGSILTNKYAEGYPSKRYYGGCQYVDDIENIAIERAKKLFNVNFVNVQSHSGSQMNQGVFLALMHPGDSFMGLSLDSGGHLTHGSSVNMSGKWFKAIPYNVRKEDGLLDMHEIESLAIEYNPKLIIVGGTAYSRVWDWERFRSIADSIGAYLMADISHISGLVVGGQHPSPVPHCHIVTTTTHKSLRGPRGGLIMTNHADLAKKINSAIFPGLQGGPFMHSIAAKAVAFGEALSSEFRDYAKQIVLNSQALAKKLQFLGFDIVSGGTDNHLMLVDLRSKRMTGKRAESILGRVSITCNKNSIPFDPESPFITSGIRLGTPSGTTRGFKEKDFEYIGELIAQILDGSSSDEENHSLELTVLHKVQEFVHCFPIYDFSASALK
MTIICKNRFFQQSLIESDPDVFSLIGQESCRQNDEIQLIASENIVSRAVLEAQGSILTNKYAEGYPSKRYYGGCQYVDDIENIAIERAKKLFNVNFVNVQSHSGSQMNQGVFLALMHPGDSFMGLSLDSGGHLTHGSSVNMSGKWFKAIPYNVRKEDGLLDMHEIESLAIEYNPKLIIVGGTAYSRVWDWERFRSIADSIGAYLMADISHISGLVVGGQHPSPVPHCHIVTTTTHKSLRGPRGGLIMTNHADLAKKINSAIFPGLQGGPFMHSIAAKAVAFGEALSSEFRDYAKQIVLNSQALAKKLQFLGFDIVSGGTDNHLMLVDLRSKRMTGKRAESILGRVSITCNKNSIPFDPESPFITSGIRLGTPSGTTRGFKEKDFEYIGELIAQILDGSSSDEENHSLELTVLHKVQEFVHCFPIYDFSASALK
MTIICKNRFFQQSLIESDPDVFSLIGQESCRQNDEIQLIASENIVSRAVLEAQGSILTNKYAEGYPSKRYYGGCQYVDDIENIAIERAKKLFNVNFVNVQSHSGSQMNQGVFLALMHPGDSFMGLSLDSGGHLTHGSSVNMSGKWFKAIPYNVRKEDGLLDMHEIESLAIEYNPKLIIVGGTAYSRVWDWERFRSIADSIGAYLMADISHISGLVVGGQHPSPVPHCHIVTTTTHKSLRGPRGGLIMTNHADLAKKINSAIFPGLQGGPFMHSIAAKAVAFGEALSSEFRDYAKQIVLNSQALAKKLQFLGFDIVSGGTDNHLMLVDLRSKRMTGKRAESILGRVSITCNKNSIPFDPESPFITSGIRLGTPSGTTRGFKEKDFEYIGELIAQILDGSSSDEENHSLELTVLHKVQEFVHCFPIYDFSASALK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target433 serine hydroxymethyltransferase [Candidatus Liberibacte
315122227433 serine hydroxymethyltransferase [Candidatus Liberibacte 1 0.0
209548780432 serine hydroxymethyltransferase [Rhizobium leguminosaru 1 1e-180
327192106432 serine hydroxymethyltransferase protein [Rhizobium etli 1 1e-179
222085507432 serine hydroxymethyltransferase 1 protein [Agrobacteriu 1 1e-179
159184645429 serine hydroxymethyltransferase [Agrobacterium tumefaci 1 1e-179
86357146432 serine hydroxymethyltransferase [Rhizobium etli CFN 42] 1 1e-179
190891192432 serine hydroxymethyltransferase [Rhizobium etli CIAT 65 1 1e-178
325292540429 serine hydroxymethyltransferase [Agrobacterium sp. H13- 1 1e-178
116251386432 serine hydroxymethyltransferase [Rhizobium leguminosaru 1 1e-178
227821530459 serine hydroxymethyltransferase [Sinorhizobium fredii N 1 1e-178
>gi|315122227|ref|YP_004062716.1| serine hydroxymethyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 433 Back     alignment and organism information
 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/433 (84%), Positives = 399/433 (92%)

Query: 1   MTIICKNRFFQQSLIESDPDVFSLIGQESCRQNDEIQLIASENIVSRAVLEAQGSILTNK 60
           M ++CKN FF QSL ESDPD+FSLIG+E+ RQN EIQLIASEN+VSRAVLEAQGSILTNK
Sbjct: 1   MVVMCKNNFFNQSLAESDPDIFSLIGKEASRQNHEIQLIASENMVSRAVLEAQGSILTNK 60

Query: 61  YAEGYPSKRYYGGCQYVDDIENIAIERAKKLFNVNFVNVQSHSGSQMNQGVFLALMHPGD 120
           YAEGYP  RYYGGCQYVD IE+IAIERAKKLF+VNFVNVQ HSGSQMNQ VFLALM PGD
Sbjct: 61  YAEGYPGNRYYGGCQYVDYIEDIAIERAKKLFDVNFVNVQPHSGSQMNQAVFLALMQPGD 120

Query: 121 SFMGLSLDSGGHLTHGSSVNMSGKWFKAIPYNVRKEDGLLDMHEIESLAIEYNPKLIIVG 180
           SFMGLSL+SGGHLTHGS VNMSGKWFK+IPYNVR+ DGLLDM E++SLA  + PKLIIVG
Sbjct: 121 SFMGLSLNSGGHLTHGSPVNMSGKWFKSIPYNVREADGLLDMDEVKSLAFSHKPKLIIVG 180

Query: 181 GTAYSRVWDWERFRSIADSIGAYLMADISHISGLVVGGQHPSPVPHCHIVTTTTHKSLRG 240
           GTAYSR WDWE FRSIADS+GAYLMADISH+SGLVVGGQHPSPVPHCHIVTTTTHKSLRG
Sbjct: 181 GTAYSRFWDWEHFRSIADSVGAYLMADISHVSGLVVGGQHPSPVPHCHIVTTTTHKSLRG 240

Query: 241 PRGGLIMTNHADLAKKINSAIFPGLQGGPFMHSIAAKAVAFGEALSSEFRDYAKQIVLNS 300
           PRGGL+MTNHA+LAKKINSA+FPGLQGGPFMHSIAAKAVAFGEALS  F+DYAKQI LNS
Sbjct: 241 PRGGLVMTNHAELAKKINSAVFPGLQGGPFMHSIAAKAVAFGEALSPGFKDYAKQITLNS 300

Query: 301 QALAKKLQFLGFDIVSGGTDNHLMLVDLRSKRMTGKRAESILGRVSITCNKNSIPFDPES 360
           QALAKK+Q LGFDIVSGGTDNHLMLVDLR+K+MTGK AESILGRVSITCNKNS+PFDPES
Sbjct: 301 QALAKKMQVLGFDIVSGGTDNHLMLVDLRTKKMTGKNAESILGRVSITCNKNSVPFDPES 360

Query: 361 PFITSGIRLGTPSGTTRGFKEKDFEYIGELIAQILDGSSSDEENHSLELTVLHKVQEFVH 420
           PF+TSGIRLGTPSGTTRGFKEKDFEYIGELIA+ LDG SS E NHS+EL+VLHKV+EF+ 
Sbjct: 361 PFVTSGIRLGTPSGTTRGFKEKDFEYIGELIAEALDGFSSGELNHSVELSVLHKVKEFIS 420

Query: 421 CFPIYDFSASALK 433
            FP YDF+ S +K
Sbjct: 421 LFPTYDFACSEVK 433


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209548780|ref|YP_002280697.1| serine hydroxymethyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 432 Back     alignment and organism information
>gi|327192106|gb|EGE59083.1| serine hydroxymethyltransferase protein [Rhizobium etli CNPAF512] Length = 432 Back     alignment and organism information
>gi|222085507|ref|YP_002544037.1| serine hydroxymethyltransferase 1 protein [Agrobacterium radiobacter K84] Length = 432 Back     alignment and organism information
>gi|159184645|ref|NP_354184.2| serine hydroxymethyltransferase [Agrobacterium tumefaciens str. C58] Length = 429 Back     alignment and organism information
>gi|86357146|ref|YP_469038.1| serine hydroxymethyltransferase [Rhizobium etli CFN 42] Length = 432 Back     alignment and organism information
>gi|190891192|ref|YP_001977734.1| serine hydroxymethyltransferase [Rhizobium etli CIAT 652] Length = 432 Back     alignment and organism information
>gi|325292540|ref|YP_004278404.1| serine hydroxymethyltransferase [Agrobacterium sp. H13-3] Length = 429 Back     alignment and organism information
>gi|116251386|ref|YP_767224.1| serine hydroxymethyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 432 Back     alignment and organism information
>gi|227821530|ref|YP_002825500.1| serine hydroxymethyltransferase [Sinorhizobium fredii NGR234] Length = 459 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target433 serine hydroxymethyltransferase [Candidatus Liberibacte
pfam00464380 pfam00464, SHMT, Serine hydroxymethyltransferase 0.0
cd00378402 cd00378, SHMT, Serine-glycine hydroxymethyltransferase 1e-176
PTZ00094452 PTZ00094, PTZ00094, serine hydroxymethyltransferase; Pr 1e-151
PLN02271586 PLN02271, PLN02271, serine hydroxymethyltransferase 1e-105
PRK00011416 PRK00011, glyA, serine hydroxymethyltransferase; Review 0.0
PRK13034416 PRK13034, PRK13034, serine hydroxymethyltransferase; Re 0.0
PLN03226475 PLN03226, PLN03226, serine hydroxymethyltransferase; Pr 1e-137
KOG2467477 KOG2467, KOG2467, KOG2467, Glycine/serine hydroxymethyl 1e-136
PRK13580493 PRK13580, PRK13580, serine hydroxymethyltransferase; Pr 1e-117
COG0112413 COG0112, GlyA, Glycine/serine hydroxymethyltransferase 0.0
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) superf 7e-18
cd00609350 cd00609, AAT_like, Aspartate aminotransferase family 2e-07
COG0399374 COG0399, WecE, Predicted pyridoxal phosphate-dependent 2e-05
>gnl|CDD|109518 pfam00464, SHMT, Serine hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|99733 cd00378, SHMT, Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>gnl|CDD|185441 PTZ00094, PTZ00094, serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|177911 PLN02271, PLN02271, serine hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|178792 PRK00011, glyA, serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|183853 PRK13034, PRK13034, serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|178765 PLN03226, PLN03226, serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|37678 KOG2467, KOG2467, KOG2467, Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184161 PRK13580, PRK13580, serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30461 COG0112, GlyA, Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|30748 COG0399, WecE, Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 433 serine hydroxymethyltransferase [Candidatus Liberibacte
PRK13034422 serine hydroxymethyltransferase; Reviewed 100.0
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amino aci 100.0
PRK13580493 serine hydroxymethyltransferase; Provisional 100.0
PRK00011415 glyA serine hydroxymethyltransferase; Reviewed 100.0
PTZ00094450 serine hydroxymethyltransferase; Provisional 100.0
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT). Th 100.0
KOG2467477 consensus 100.0
pfam00464380 SHMT Serine hydroxymethyltransferase. 100.0
PRK05958387 8-amino-7-oxononanoate synthase; Reviewed 99.88
PRK13392410 5-aminolevulinate synthase; Provisional 99.88
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) fa 99.88
PRK13393404 5-aminolevulinate synthase; Provisional 99.87
PRK07179408 hypothetical protein; Provisional 99.86
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.85
PRK06939395 2-amino-3-ketobutyrate coenzyme A ligase; Provisional 99.85
PRK09064406 5-aminolevulinate synthase; Validated 99.84
PRK07505405 hypothetical protein; Provisional 99.83
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subunit Cs 99.83
TIGR00858378 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR0047 99.79
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase. Thi 99.78
pfam00155351 Aminotran_1_2 Aminotransferase class I and II. 99.78
PRK06220384 consensus 99.78
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Provisi 99.77
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartate ami 99.77
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and related e 99.75
PRK08912387 hypothetical protein; Provisional 99.75
PRK08443388 consensus 99.74
PRK13520375 L-tyrosine decarboxylase; Provisional 99.74
PRK09276385 aspartate aminotransferase; Provisional 99.73
PRK08362389 consensus 99.73
PRK05764389 aspartate aminotransferase; Provisional 99.72
PRK07212378 consensus 99.72
PRK07778386 consensus 99.71
PRK06108382 aspartate aminotransferase; Provisional 99.71
PRK08361390 aspartate aminotransferase; Provisional 99.71
PRK09331386 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.71
PRK08960387 hypothetical protein; Provisional 99.7
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.69
PRK05957389 aspartate aminotransferase; Provisional 99.69
PRK07683387 aminotransferase A; Validated 99.69
PRK07550387 hypothetical protein; Provisional 99.69
PRK05166374 histidinol-phosphate aminotransferase; Provisional 99.69
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. This c 99.69
PRK06348383 aspartate aminotransferase; Provisional 99.69
PRK07309390 aromatic amino acid aminotransferase; Validated 99.68
PRK09082386 putative aminotransferase; Validated 99.68
PRK07681399 aspartate aminotransferase; Provisional 99.68
PRK07682378 hypothetical protein; Validated 99.68
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.67
PRK08363398 alanine aminotransferase; Validated 99.67
PRK08068389 transaminase; Reviewed 99.67
PRK05942394 aspartate aminotransferase; Provisional 99.66
PRK07777386 aminotransferase; Validated 99.66
PRK03317369 histidinol-phosphate aminotransferase; Provisional 99.66
PRK07310395 consensus 99.65
PRK03566365 consensus 99.65
PRK08636403 aspartate aminotransferase; Provisional 99.65
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.65
PRK00950369 histidinol-phosphate aminotransferase; Validated 99.64
PRK08175395 aminotransferase; Validated 99.64
PRK07337388 aminotransferase; Validated 99.64
PRK07810406 O-succinylhomoserine sulfhydrylase; Provisional 99.64
PRK06225375 aspartate aminotransferase; Provisional 99.63
PRK07367385 consensus 99.63
PRK06107402 aspartate aminotransferase; Provisional 99.62
PRK03321352 putative aminotransferase; Provisional 99.61
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amino aci 99.6
PRK06507400 consensus 99.6
PRK06056402 consensus 99.6
PRK06375381 consensus 99.6
PRK08069390 consensus 99.59
PRK05794397 consensus 99.59
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.58
PRK06290411 aspartate aminotransferase; Provisional 99.58
PRK07543400 consensus 99.58
PRK12414384 putative aminotransferase; Provisional 99.58
PRK08153370 histidinol-phosphate aminotransferase; Provisional 99.57
PRK09105374 putative aminotransferase; Provisional 99.57
PRK04152364 consensus 99.55
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.54
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.53
PRK06836396 aspartate aminotransferase; Provisional 99.53
PRK07568396 aspartate aminotransferase; Provisional 99.53
PRK09148406 aminotransferase; Validated 99.51
PRK02610369 histidinol-phosphate aminotransferase; Provisional 99.5
TIGR01822395 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase; 99.5
PRK06575399 consensus 99.49
PRK09147397 aminotransferase; Provisional 99.46
KOG2862385 consensus 99.45
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.44
TIGR01141377 hisC histidinol-phosphate aminotransferase; InterPro: I 99.42
PRK09265404 aminotransferase AlaT; Validated 99.41
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. This c 99.41
PRK01688355 histidinol-phosphate aminotransferase; Provisional 99.37
TIGR01825392 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransfe 99.37
PRK04781362 histidinol-phosphate aminotransferase; Provisional 99.36
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferase and 99.35
TIGR03538394 DapC_gpp succinyldiaminopimelate transaminase. This fam 99.34
PRK06855433 aminotransferase; Validated 99.32
PRK07392358 threonine-phosphate decarboxylase; Validated 99.32
PRK09257397 aromatic amino acid aminotransferase; Provisional 99.29
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. This 99.27
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer selenium tr 99.25
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.24
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.23
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.23
PRK03262355 consensus 99.22
PRK07908346 hypothetical protein; Provisional 99.21
PRK04635346 histidinol-phosphate aminotransferase; Provisional 99.21
PRK07865364 N-succinyldiaminopimelate aminotransferase; Reviewed 99.13
COG1103382 Archaea-specific pyridoxal phosphate-dependent enzymes 99.0
KOG0257420 consensus 98.98
PRK05839376 hypothetical protein; Provisional 98.97
PRK06959339 putative threonine-phosphate decarboxylase; Provisional 98.93
TIGR02539381 SepCysS Sep-tRNA:Cys-tRNA synthase; InterPro: IPR013375 98.91
PRK09440416 avtA valine--pyruvate transaminase; Provisional 98.9
PRK05664330 threonine-phosphate decarboxylase; Reviewed 98.88
TIGR02326366 transamin_PhnW 2-aminoethylphosphonate--pyruvate transa 98.74
PRK08354312 putative aminotransferase; Provisional 98.7
) it is a pyridoxal 5'-phosphate (PLP)-dependent enzyme, which catalyses the irreversible alpha-decarboxylation of L-glutamate to gamma-aminobutyrate (GABA). This enzyme is widely distributed amongst eukaryotes and prokaryotes, but its function varies in different organisms . Gad has a crucial role in the vertebrate central nervous system where it is responsible for the synthesis of GABA, the major inhibitory neurotransmitter. In the majority of vertebrates Gad occurs in two isoforms, GAD65 and GAD67, both active at neutral pH . Gad isoforms (GadA and GadB) have also been reported in some bacterial species, including the Gram-negative bacterium and Gram-positive bacterium . A unique feature of plant and yeast Gad is the presence of a calmodulin (CaM)-binding domain in the C-terminal region. In Saccharomyces cerevisiae, Gad expression is required for normal oxidative stress tolerance . In plants, Gad is thought to be a stress-adapter chaperonin sensing Ca2+ signals.; GO: 0004351 glutamate decarboxylase activity, 0030170 pyridoxal phosphate binding, 0006536 glutamate metabolic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01788">TIGR01788493 Glu-decarb-GAD glutamate decarboxylase; InterPro: IPR01 98.54
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase; InterPro: IPR01344 98.52
TIGR02617468 tnaA_trp_ase tryptophanase; InterPro: IPR013440 Protein 98.47
TIGR00474448 selA L-seryl-tRNA selenium transferase; InterPro: IPR00 98.44
TIGR01264415 tyr_amTase_E tyrosine aminotransferase; InterPro: IPR00 97.88
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) family. 97.86
KOG1358467 consensus 97.7
PRK12462364 phosphoserine aminotransferase; Provisional 97.11
KOG1405484 consensus 96.95
PRK05355360 phosphoserine aminotransferase; Provisional 96.49
cd06454349 KBL_like KBL_like; this family belongs to the pyridoxal 99.93
pfam00266371 Aminotran_5 Aminotransferase class-V. This domain is fo 99.88
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family belongs 99.86
PRK02948381 cysteine desulfurase; Provisional 99.86
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of this pro 99.84
cd06502338 TA_like Low-specificity threonine aldolase (TA). This f 99.84
PRK09295406 selenocysteine lyase; Validated 99.83
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This family 99.82
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Posttra 99.82
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, epsilon 99.81
TIGR03235354 DNA_S_dndA cysteine desulfurase DndA. This model descri 99.77
PRK10534333 L-threonine aldolase; Provisional 99.77
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.75
COG2008342 GLY1 Threonine aldolase [Amino acid transport and metab 99.7
cd00617431 Tnase_like Tryptophanase family (Tnase). This family be 99.68
TIGR01977384 am_tr_V_EF2568 cysteine desulfurase family protein; Int 99.65
PRK13237459 tyrosine phenol-lyase; Provisional 99.64
PRK13578 720 ornithine decarboxylase; Provisional 99.64
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desulfuras 99.56
PRK13238461 tnaA tryptophanase; Provisional 99.53
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- and bet 99.44
TIGR01821427 5aminolev_synth 5-aminolevulinic acid synthase; InterPr 99.43
TIGR01325386 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase; Inter 99.42
KOG1549428 consensus 99.42
COG3033471 TnaA Tryptophanase [Amino acid transport and metabolism 99.37
KOG1360570 consensus 99.36
TIGR01979409 sufS cysteine desulfurases, SufS subfamily; InterPro: I 99.26
KOG1359417 consensus 99.23
KOG1368384 consensus 99.18
TIGR01976410 am_tr_V_VC1184 cysteine desulfurase family protein; Int 99.1
PRK04311465 selenocysteine synthase; Provisional 99.1
KOG1357519 consensus 99.06
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amin 98.98
pfam02347429 GDC-P Glycine cleavage system P-protein. This family co 98.81
TIGR01265424 tyr_nico_aTase tyrosine/nicotianamine aminotransferases 98.67
COG3844407 Kynureninase [Amino acid transport and metabolism] 98.3
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transfe 98.18
KOG0259447 consensus 97.82
KOG1411427 consensus 97.81
pfam05889389 SLA_LP_auto_ag Soluble liver antigen/liver pancreas ant 97.77
TIGR02006404 IscS cysteine desulfurase IscS; InterPro: IPR010240 Thi 97.64
TIGR01437391 selA_rel pyridoxal phosphate-dependent enzyme, putative 94.88
KOG3846465 consensus 94.09
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) amin 91.84
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotran 99.86
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzyme app 99.8
cd00609350 AAT_like Aspartate aminotransferase family. This family 99.71
PRK07324373 transaminase; Validated 99.65
PRK00451449 glycine dehydrogenase subunit 1; Validated 99.61
PRK04366490 glycine dehydrogenase subunit 2; Validated 99.6
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: the de 99.58
PRK06207406 aspartate aminotransferase; Provisional 99.55
cd06450345 DOPA_deC_like DOPA decarboxylase family. This family be 99.5
COG1167459 ARO8 Transcriptional regulators containing a DNA-bindin 99.37
TIGR02080383 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase; Inte 99.34
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 famil 99.32
PRK08637386 hypothetical protein; Provisional 99.26
PRK13355518 bifunctional HTH-domain containing protein/aminotransfe 99.17
PRK06425332 histidinol-phosphate aminotransferase; Validated 98.96
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 98.96
PTZ00125415 ornithine aminotransferase; Provisional 98.94
PRK08593448 4-aminobutyrate aminotransferase; Provisional 98.93
PRK05965459 hypothetical protein; Provisional 98.86
PRK00854404 rocD ornithine--oxo-acid transaminase; Reviewed 98.84
cd00610413 OAT_like Acetyl ornithine aminotransferase family. This 98.81
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [Amino 98.8
PRK05964421 adenosylmethionine--8-amino-7-oxononanoate transaminase 98.76
PRK06917447 hypothetical protein; Provisional 98.68
PRK08466430 consensus 98.67
PRK09044418 consensus 98.64
PRK06777421 4-aminobutyrate aminotransferase; Provisional 98.56
PRK02627398 acetylornithine aminotransferase; Provisional 98.54
PRK07482461 hypothetical protein; Provisional 98.54
PRK07495422 4-aminobutyrate aminotransferase; Provisional 98.53
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferase; Pr 98.49
PRK07036466 hypothetical protein; Provisional 98.49
PRK07678451 aminotransferase; Validated 98.41
PRK07046452 aminotransferase; Validated 98.4
PRK12566 954 glycine dehydrogenase; Provisional 98.39
PRK07483443 hypothetical protein; Provisional 98.37
PRK05367 955 glycine dehydrogenase; Provisional 98.37
PRK06916462 adenosylmethionine--8-amino-7-oxononanoate transaminase 98.33
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase; Int 98.22
PRK12389429 glutamate-1-semialdehyde aminotransferase; Provisional 98.22
PRK07480459 putative aminotransferase; Validated 98.22
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.09
KOG0256471 consensus 97.98
PRK06942425 glutamate-1-semialdehyde 2,1-aminomutase; Validated 97.98
PRK06082460 4-aminobutyrate aminotransferase; Provisional 97.95
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme metabolis 97.77
KOG0633375 consensus 97.7
TIGR00707402 argD acetylornithine and succinylornithine aminotransfe 97.65
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisional 97.61
PRK00062429 glutamate-1-semialdehyde aminotransferase; Provisional 97.57
PRK03080381 phosphoserine aminotransferase; Provisional 97.4
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Coenzym 97.38
TIGR01814444 kynureninase kynureninase; InterPro: IPR010111 This ent 96.97
COG0160447 GabT 4-aminobutyrate aminotransferase and related amino 96.58
TIGR00713434 hemL glutamate-1-semialdehyde-2,1-aminomutase; InterPro 96.39
KOG1412410 consensus 95.97
KOG0628511 consensus 95.47
KOG0258475 consensus 91.09
KOG1402427 consensus 90.25
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotran 99.83
PRK08776405 cystathionine gamma-synthase; Provisional 99.7
PRK07504397 O-succinylhomoserine sulfhydrylase; Reviewed 99.68
PRK05968389 hypothetical protein; Provisional 99.67
PRK07503403 methionine gamma-lyase; Provisional 99.64
PRK06767386 methionine gamma-lyase; Provisional 99.62
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.58
PRK06434384 cystathionine gamma-lyase; Validated 99.54
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-cystat 99.5
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal-bindi 99.45
pfam03841367 SelA L-seryl-tRNA selenium transferase. 98.97
TIGR00699469 GABAtrns_euk 4-aminobutyrate aminotransferase; InterPro 96.93
TIGR01140349 CobD L-threonine-O-3-phosphate decarboxylase, putative; 94.98
pfam01276417 OKR_DC_1 Orn/Lys/Arg decarboxylase, major domain. 99.82
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family 99.81
pfam01041363 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase f 99.81
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional 99.78
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Amino ac 99.74
PRK08045386 cystathionine gamma-synthase; Provisional 99.73
PRK08574384 cystathionine gamma-synthase; Provisional 99.69
PRK06460375 hypothetical protein; Provisional 99.69
PRK06176379 cystathionine gamma-synthase/cystathionine beta-lyase; 99.68
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is a PL 99.67
PRK07671377 cystathionine beta-lyase; Provisional 99.65
PRK08861388 cystathionine gamma-synthase; Provisional 99.65
PRK08114395 cystathionine beta-lyase; Provisional 99.63
pfam01053381 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 99.63
PRK07582370 cystathionine gamma-lyase; Validated 99.63
PRK08064390 cystathionine beta-lyase; Provisional 99.62
PRK05967392 cystathionine beta-lyase; Provisional 99.62
PRK08247366 cystathionine gamma-synthase; Reviewed 99.59
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma-synt 99.58
PRK05939396 hypothetical protein; Provisional 99.57
PRK07269364 cystathionine gamma-synthase; Reviewed 99.55
PRK05367955 glycine dehydrogenase; Provisional 99.38
PRK12566954 glycine dehydrogenase; Provisional 99.37
pfam06838405 Alum_res Aluminium resistance protein. This family repr 99.12
KOG20401001 consensus 98.92
KOG1383491 consensus 98.67
pfam00202338 Aminotran_3 Aminotransferase class-III. 98.21
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily (fol 99.82
TIGR01324389 cysta_beta_ly_B cystathionine beta-lyase; InterPro: IPR 97.92
pfam01212288 Beta_elim_lyase Beta-eliminating lyase. 99.76
PRK07050394 cystathionine beta-lyase; Provisional 99.66
PRK02769380 histidine decarboxylase; Provisional 99.63
PRK08133391 O-succinylhomoserine sulfhydrylase; Validated 99.63
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.62
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.6
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.6
PRK07049427 methionine gamma-lyase; Validated 99.58
PRK05994426 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.54
PRK06084424 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.54
KOG0053409 consensus 99.5
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal-bindi 98.74
cd00615294 Orn_deC_like Ornithine decarboxylase family. This famil 99.75
PRK07811386 cystathionine gamma-synthase; Provisional 99.66
PRK09028394 cystathionine beta-lyase; Provisional 99.63
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.63
pfam00282370 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserv 99.48
TIGR01326434 OAH_OAS_sulfhy O-acetylhomoserine aminocarboxypropyltra 99.17
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid tran 99.13
TIGR01328392 met_gam_lyase methionine gamma-lyase; InterPro: IPR0062 99.11
TIGR01329415 cysta_beta_ly_E cystathionine beta-lyase; InterPro: IPR 99.1
KOG0629510 consensus 98.2
KOG1401433 consensus 94.7
KOG2040 1001 consensus 93.79
COG0076460 GadB Glutamate decarboxylase and related PLP-dependent 99.75
PRK06234399 methionine gamma-lyase; Provisional 99.65
PRK08249398 cystathionine gamma-synthase; Provisional 99.64
TIGR00461965 gcvP glycine dehydrogenase; InterPro: IPR003437 This fa 98.07
PRK11522468 putrescine--2-oxoglutarate aminotransferase; Provisiona 98.93
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 98.86
PRK03244398 argD acetylornithine aminotransferase; Provisional 98.82
PRK12381406 bifunctional succinylornithine transaminase/acetylornit 98.81
PRK09264426 diaminobutyrate--2-oxoglutarate aminotransferase; Valid 98.75
TIGR03246397 arg_catab_astC succinylornithine transaminase family. M 98.75
PRK02936377 argD acetylornithine aminotransferase; Provisional 98.71
PRK13360441 omega amino acid--pyruvate transaminase; Provisional 98.68
PRK04612408 argD bifunctional N-succinyldiaminopimelate-aminotransf 98.67
PRK08117429 4-aminobutyrate aminotransferase; Provisional 98.64
PRK04260375 acetylornithine aminotransferase; Provisional 98.63
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transaminase 98.62
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transaminase 98.61
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminotransf 98.57
PRK01278389 argD bifunctional N-succinyldiaminopimelate-aminotransf 98.55
PRK09792421 PLP-dependent GABA aminotransferase; Provisional 98.49
PRK07894430 consensus 98.46
PRK07481448 hypothetical protein; Provisional 98.33
TIGR03372442 putres_am_tran putrescine aminotransferase. Members of 98.28
PRK07323443 consensus 98.22
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisional 98.17
PRK03715395 argD bifunctional N-succinyldiaminopimelate-aminotransf 97.95
PRK06062434 hypothetical protein; Provisional 98.61
PRK06931454 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 98.57
PRK06541460 hypothetical protein; Provisional 98.49
PRK06058446 4-aminobutyrate aminotransferase; Provisional 98.48
PRK06943452 adenosylmethionine--8-amino-7-oxononanoate transaminase 98.47
PRK06918454 4-aminobutyrate aminotransferase; Reviewed 98.46
PRK06105460 aminotransferase; Provisional 98.45
PRK05639457 4-aminobutyrate aminotransferase; Provisional 98.44
PRK09221445 beta alanine--pyruvate transaminase; Provisional 98.41
PRK08088426 4-aminobutyrate aminotransferase; Validated 98.38
PRK08297449 L-lysine aminotransferase; Provisional 98.22
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized members 97.93
KOG1404442 consensus 97.77
PRK12403460 putative aminotransferase; Provisional 97.69
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transaminase 97.54
PRK08360443 4-aminobutyrate aminotransferase; Provisional 98.59
PRK08555443 consensus 98.53
PRK05769442 4-aminobutyrate aminotransferase; Provisional 98.35
PRK05630423 adenosylmethionine--8-amino-7-oxononanoate transaminase 98.16
PRK061481015 hypothetical protein; Provisional 98.16
PRK06149972 hypothetical protein; Provisional 97.59
PRK07030467 adenosylmethionine--8-amino-7-oxononanoate transaminase 98.53
COG4100416 Cystathionine beta-lyase family protein involved in alu 98.52
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>KOG2467 consensus Back     alignment and domain information
>pfam00464 SHMT Serine hydroxymethyltransferase Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR004723 8-amino-7-oxononanoate synthase (2 Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>pfam00155 Aminotran_1_2 Aminotransferase class I and II Back     alignment and domain information
>PRK06220 consensus Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK08443 consensus Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK09276 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08362 consensus Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07212 consensus Back     alignment and domain information
>PRK07778 consensus Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK09082 putative aminotransferase; Validated Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07310 consensus Back     alignment and domain information
>PRK03566 consensus Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07367 consensus Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06507 consensus Back     alignment and domain information
>PRK06056 consensus Back     alignment and domain information
>PRK06375 consensus Back     alignment and domain information
>PRK08069 consensus Back     alignment and domain information
>PRK05794 consensus Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information