254780350

254780350

hypothetical protein CLIBASIA_01175

GeneID in NCBI database:8209335Locus tag:CLIBASIA_01175
Protein GI in NCBI database:254780350Protein Accession:YP_003064763.1
Gene range:-(245465, 246760)Protein Length:431aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-
MVGYLKINKILYCFFVYLILPMGLSLVEKPIHASVLDEIINESYHSIVNDRFDNFLARVDMGIDSDIPIISKETIAQTEKAIAFYQDILSRGGWPELPIRPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIVGRVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEVFVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNVVRFETSGCVRVRNIIDLDVWLLKDTPTWSRYHIEEVVKTRKTTPVKLATEVPVHFVYISAWSPKDSIIQFRDDIYGLDNVHVGIIPLPEDHPIDSD
ccEEEEEHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccccEEEcHHHHHHHHHcHHHHHHHHHHcHHHHHHHccccccccEEEEEcccEEEEEEEccEEEEEEEEEEcccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHccHHHHHHcccEEEcccccccccccccHHHccccccccccccccccccEEEEEEccccccEEEcccccHHHccccccccccccEEcccHHHHHHHHHHHcccccHHHHHHHHccccEEEEEEcccccEEEEEEEEEEccccEEEEEccccccHHHHHHHHHcccccccccc
cccEEEEccHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHcccccccccccHHccHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccEEEEEcccEEEEEEEcccEEEEEEEEEEccccccccccHHccEEEEcccccccHHHHHHHHHHHHHHcHHHHHHcccEEEEccccEcccccccHHHccccccccccccccccccEEEEEEcccccEEEEcccccccHccHccccccccEEEEccHHHHHHHHHHccccccHHHHHHHHHccccEEEEccccccEEEEEEEEEEcccccEEEcccHHcHHHHHHHHHccccccccccc
MVGYLKINKILYCFFVYLILpmglslvekpihasVLDEIINESYHSIVNDRFDNFLarvdmgidsdipiiskETIAQTEKAIAFYQDIlsrggwpelpirplhlgnssVSVQRLRERLIIsgdldpskglsVAFDAYVESAVKLFQMrhgldpsgmvdsstleamnvpvDLRIRQLQVNLMRIKKLLEQKMGLRYVLVnipaasleavengkvgLRSTVIVgrvdrqtpilhsrinrimfnpywviprSIIQKDMMALLrqdpqylkdnnihmidEKGKEVFVEevdwnspeppnfifrqdpgkiNAMASTKIEFYsrnntymhdtpepilfnnvvRFETSGCVRVRNIIDLDVwllkdtptwsryHIEEVVKtrkttpvklatevPVHFVYisawspkdsiiqfrddiygldnvhvgiiplpedhpidsd
MVGYLKINKILYCFFVYLILPMGLSLVEKPIHASVLDEIINESYHSIVNDRFDNFLARVDMGIDSDIPIISKETIAQTEKAIAFYQDILSRGGWPELPIRPLHLGNSSVSVQRLRERLIIsgdldpskgLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAasleavengkvglrstvivgrvdrqtpilhsrinrimfnpyWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEVFVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNVVRFETSGCVRVRNIIDldvwllkdtptwsryhieevvktrkttpvklatevPVHFVYISAWSPKDSIIQFRDDIYGLDNVHVGiiplpedhpidsd
MVGYLKINKILYCFFVYLILPMGLSLVEKPIHASVLDEIINESYHSIVNDRFDNFLARVDMGIDSDIPIISKETIAQTEKAIAFYQDILSRGGWPELPIRPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIVGRVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEVFVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNVVRFETSGCVRVRNIIDLDVWLLKDTPTWSRYHIEEVVKTRKTTPVKLATEVPVHFVYISAWSPKDSIIQFRDDIYGLDNVHVGIIPLPEDHPIDSD
MVGYLKINKILYCFFVYLILPMGLSLVEKPIHASVLDEIINESYHSIVNDRFDNFLARVDMGIDSDIPIISKETIAQTEKAIAFYQDILS**************GNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIVGRVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEVFVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNVVRFETSGCVRVRNIIDLDVWLLKDTPTWSRYHI*****T***TPVKLATEVPVHFVYISAWSPKDSIIQFRDDIYGLDNVHVG*************
MVGYLKINKILYCFFVYLILPMGLSLVEKPIHASVLDEIINESYHSIVNDRFDNFLARVDMGIDSDIPIISKETIAQTEKAIAFYQDILSRGGWPELPIRPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIVGRVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEVFVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNVVRFETSGCVRVRNIIDLDVWLLKDTPTWSRYHIEEVVKTRKTTPVKLATEVPVHFVYISAWSPKDSIIQFRDDIYGLDNVHVGIIPLPEDHPIDSD
MVGYLKINKILYCFFVYLILPMGLSLVEKPIHASVLDEIINESYHSIVNDRFDNFLARVDMGIDSDIPIISKETIAQTEKAIAFYQDILSRGGWPELPIRPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIVGRVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEVFVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNVVRFETSGCVRVRNIIDLDVWLLKDTPTWSRYHIEEVVKTRKTTPVKLATEVPVHFVYISAWSPKDSIIQFRDDIYGLDNVHVGIIPLP********
iiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGYLKINKILYCFFVYLILPMGLSLVEKPIHASVLDEIINESYHSIVNDRFDNFLARVDMGIDSDIPIISKETIAQTEKAIAFYQDILSRGGWPELPIRPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIVGRVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEVFVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNVVRFETSGCVRVRNIIDLDVWLLKDTPTWSRYHIEEVVKTRKTTPVKLATEVPVHFVYISAWSPKDSIIQFRDDIYGLDNVHVGIIPLPEDHPIDSD
MVGYLKINKILYCFFVYLILPMGLSLVEKPIHASVLDEIINESYHSIVNDRFDNFLARVDMGIDSDIPIISKETIAQTEKAIAFYQDILSRGGWPELPIRPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIVGRVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEVFVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNVVRFETSGCVRVRNIIDLDVWLLKDTPTWSRYHIEEVVKTRKTTPVKLATEVPVHFVYISAWSPKDSIIQFRDDIYGLDNVHVGIIPLPEDHPIDSD
MVGYLKINKILYCFFVYLILPMGLSLVEKPIHASVLDEIINESYHSIVNDRFDNFLARVDMGIDSDIPIISKETIAQTEKAIAFYQDILSRGGWPELPIRPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIVGRVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEVFVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNVVRFETSGCVRVRNIIDLDVWLLKDTPTWSRYHIEEVVKTRKTTPVKLATEVPVHFVYISAWSPKDSIIQFRDDIYGLDNVHVGIIPLPEDHPIDSD

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target431 hypothetical protein CLIBASIA_01175 [Candidatus Liberib
315122226431 hypothetical protein CKC_02390 [Candidatus Liberibacter 1 1e-177
227821529442 putative amidase [Sinorhizobium fredii NGR234] Length = 1 1e-116
15964960443 hypothetical protein SMc01769 [Sinorhizobium meliloti 1 1 1e-116
150396039443 peptidoglycan binding domain-containing protein [Sinorh 1 1e-115
222085506437 peptidoglycan binding protein [Agrobacterium radiobacte 1 1e-114
116251385433 hypothetical protein RL1618A [Rhizobium leguminosarum b 1 1e-114
209548779433 peptidoglycan-binding protein [Rhizobium leguminosarum 1 1e-114
86357145433 putative peptidoglycan binding protein (involved in cel 1 1e-114
190891191434 peptidoglycan binding protein (involved in cell wall de 1 1e-114
241204000433 ErfK/YbiS/YcfS/YnhG family protein [Rhizobium leguminos 1 1e-113
>gi|315122226|ref|YP_004062715.1| hypothetical protein CKC_02390 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 431 Back     alignment and organism information
 Score =  624 bits (1610), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 296/430 (68%), Positives = 360/430 (83%)

Query: 1   MVGYLKINKILYCFFVYLILPMGLSLVEKPIHASVLDEIINESYHSIVNDRFDNFLARVD 60
           M+ YLKI  +++ FF YLIL MGL LV+ P+ A +LDEI  ESYH+ V++RFD  L+R D
Sbjct: 1   MISYLKIINVVHRFFTYLILLMGLFLVKYPVRADILDEITKESYHANVDNRFDTLLSRPD 60

Query: 61  MGIDSDIPIISKETIAQTEKAIAFYQDILSRGGWPELPIRPLHLGNSSVSVQRLRERLII 120
           +GIDS   I+S ETI  TEKAI FYQDI+SRGGW +L  RPL LG+SSV VQ+LRERLII
Sbjct: 61  IGIDSYAAIVSNETITNTEKAIVFYQDIVSRGGWQQLANRPLRLGDSSVLVQKLRERLII 120

Query: 121 SGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVNL 180
           SGDLD SKG S  FD+YVESAVK FQ RHGL P G+VD +TL+A+NVP DLR+RQL+VNL
Sbjct: 121 SGDLDSSKGFSSVFDSYVESAVKFFQARHGLFPDGVVDIATLKAINVPADLRLRQLRVNL 180

Query: 181 MRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIVGRVDRQTPILHSRINRIMF 240
           +RI  LL++KMG RYVL+NIP+AS+EAVEN KV LRS  IVGR+DRQTPILHS+I+RIM 
Sbjct: 181 LRISNLLKRKMGSRYVLINIPSASMEAVENDKVALRSVAIVGRIDRQTPILHSKIDRIML 240

Query: 241 NPYWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEVFVEEVDWNSPEPPNFIFRQ 300
           NPYWVIPRSII+KD++ L+R+ P+YLK++NIH+I++KGKEV  E+VDWNS + P+FIFRQ
Sbjct: 241 NPYWVIPRSIIKKDLVELVRESPEYLKESNIHIINDKGKEVLPEDVDWNSADLPHFIFRQ 300

Query: 301 DPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNVVRFETSGCVRVRNIIDLDVWLLKDT 360
           D GK NAMASTKIEFYS+NN+YMHDTPEP LF+   RFETSGCVRV+NIIDL+VWLLK+ 
Sbjct: 301 DSGKNNAMASTKIEFYSQNNSYMHDTPEPFLFSQTARFETSGCVRVKNIIDLNVWLLKNM 360

Query: 361 PTWSRYHIEEVVKTRKTTPVKLATEVPVHFVYISAWSPKDSIIQFRDDIYGLDNVHVGII 420
           P WSR+ IEEV+KTRKTTPVKL  EV +HFVYISAWS KD ++QFRDD+YGLDNV++  I
Sbjct: 361 PGWSRHDIEEVIKTRKTTPVKLDKEVLIHFVYISAWSTKDLVVQFRDDVYGLDNVYIDSI 420

Query: 421 PLPEDHPIDS 430
           PLP  +P++S
Sbjct: 421 PLPGKYPVNS 430


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821529|ref|YP_002825499.1| putative amidase [Sinorhizobium fredii NGR234] Length = 442 Back     alignment and organism information
>gi|15964960|ref|NP_385313.1| hypothetical protein SMc01769 [Sinorhizobium meliloti 1021] Length = 443 Back     alignment and organism information
>gi|150396039|ref|YP_001326506.1| peptidoglycan binding domain-containing protein [Sinorhizobium medicae WSM419] Length = 443 Back     alignment and organism information
>gi|222085506|ref|YP_002544036.1| peptidoglycan binding protein [Agrobacterium radiobacter K84] Length = 437 Back     alignment and organism information
>gi|116251385|ref|YP_767223.1| hypothetical protein RL1618A [Rhizobium leguminosarum bv. viciae 3841] Length = 433 Back     alignment and organism information
>gi|209548779|ref|YP_002280696.1| peptidoglycan-binding protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 433 Back     alignment and organism information
>gi|86357145|ref|YP_469037.1| putative peptidoglycan binding protein (involved in cell wall degradation) [Rhizobium etli CFN 42] Length = 433 Back     alignment and organism information
>gi|190891191|ref|YP_001977733.1| peptidoglycan binding protein (involved in cell wall degradation) [Rhizobium etli CIAT 652] Length = 434 Back     alignment and organism information
>gi|241204000|ref|YP_002975096.1| ErfK/YbiS/YcfS/YnhG family protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 433 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target431 hypothetical protein CLIBASIA_01175 [Candidatus Liberib
PRK10594608 PRK10594, PRK10594, murein L,D-transpeptidase; Provisio 4e-42
pfam03734122 pfam03734, YkuD, L,D-transpeptidase catalytic domain 4e-08
pfam0147157 pfam01471, PG_binding_1, Putative peptidoglycan binding 6e-07
COG2989561 COG2989, COG2989, Uncharacterized protein conserved in 1e-102
>gnl|CDD|182576 PRK10594, PRK10594, murein L,D-transpeptidase; Provisional Back     alignment and domain information
>gnl|CDD|146395 pfam03734, YkuD, L,D-transpeptidase catalytic domain Back     alignment and domain information
>gnl|CDD|144895 pfam01471, PG_binding_1, Putative peptidoglycan binding domain Back     alignment and domain information
>gnl|CDD|32808 COG2989, COG2989, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 431 hypothetical protein CLIBASIA_01175 [Candidatus Liberib
PRK10594615 hypothetical protein; Provisional 100.0
COG2989561 Uncharacterized protein conserved in bacteria [Function 100.0
PRK10260306 hypothetical protein; Provisional 99.87
PRK10190310 hypothetical protein; Provisional 99.86
pfam03734122 YkuD L,D-transpeptidase catalytic domain. This family o 99.55
COG1376232 ErfK Uncharacterized protein conserved in bacteria [Fun 99.38
PRK06132 365 hypothetical protein; Provisional 98.85
PRK12472 512 hypothetical protein; Provisional 98.26
TIGR02869232 spore_SleB spore cortex-lytic enzyme; InterPro: IPR0142 99.53
pfam0147157 PG_binding_1 Putative peptidoglycan binding domain. Thi 99.18
COG3409185 Putative peptidoglycan-binding domain-containing protei 98.66
COG3409185 Putative peptidoglycan-binding domain-containing protei 98.13
COG3023257 ampD N-acetyl-anhydromuramyl-L-alanine amidase [Cell en 97.36
pfam0882374 PG_binding_2 Putative peptidoglycan binding domain. Thi 96.06
KOG1565 469 consensus 93.21
pfam0937467 PG_binding_3 Predicted Peptidoglycan domain. This famil 95.85
COG3926252 zliS Lysozyme family protein [General function predicti 91.63
>PRK10594 hypothetical protein; Provisional Back     alignment and domain information
>COG2989 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10260 hypothetical protein; Provisional Back     alignment and domain information
>PRK10190 hypothetical protein; Provisional Back     alignment and domain information
>pfam03734 YkuD L,D-transpeptidase catalytic domain Back     alignment and domain information
>COG1376 ErfK Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK06132 hypothetical protein; Provisional Back     alignment and domain information
>PRK12472 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02869 spore_SleB spore cortex-lytic enzyme; InterPro: IPR014224 The entry represents the spore cortex-lytic enzyme SleB from Bacillus subtilis and other Gram-positive, endospore-forming bacterial species Back     alignment and domain information
>pfam01471 PG_binding_1 Putative peptidoglycan binding domain Back     alignment and domain information
>COG3409 Putative peptidoglycan-binding domain-containing protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3409 Putative peptidoglycan-binding domain-containing protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3023 ampD N-acetyl-anhydromuramyl-L-alanine amidase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam08823 PG_binding_2 Putative peptidoglycan binding domain Back     alignment and domain information
>KOG1565 consensus Back     alignment and domain information
>pfam09374 PG_binding_3 Predicted Peptidoglycan domain Back     alignment and domain information
>COG3926 zliS Lysozyme family protein [General function prediction only] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target431 hypothetical protein CLIBASIA_01175 [Candidatus Liberib
1lbu_A213 Hydrolase Metallo (Zn) Dd-Peptidase Length = 213 9e-07
3bkh_A268 Crystal Structure Of The Bacteriophage Phikz Lytic 4e-05
1y7m_A164 Crystal Structure Of The B. Subtilis Ykud Protein A 4e-06
>gi|157831772|pdb|1LBU|A Chain A, Hydrolase Metallo (Zn) Dd-Peptidase Length = 213 Back     alignment and structure
 Score = 59.7 bits (143), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 31/69 (44%), Gaps = 4/69 (5%)

Query: 99  IRPLHLGNSSVSVQRLRERLIISGDLDPSK--GLSVAFDAYVESAVKLFQMRHGLDPSGM 156
              L  G+S  +V++L+ R  ++G         +   F    ++AV+ FQ  +GL   G+
Sbjct: 7   SGTLSEGSSGEAVRQLQIR--VAGYPGTGAQLAIDGQFGPATKAAVQRFQSAYGLAADGI 64

Query: 157 VDSSTLEAM 165
              +T   +
Sbjct: 65  AGPATFNKI 73


>gi|164519578|pdb|3BKH|A Chain A, Crystal Structure Of The Bacteriophage Phikz Lytic Transglycosylase, Gp144 Length = 268 Back     alignment and structure
>gi|61680534|pdb|1Y7M|A Chain A, Crystal Structure Of The B. Subtilis Ykud Protein At 2 A Resolution Length = 164 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target431 hypothetical protein CLIBASIA_01175 [Candidatus Liberib
3bkh_A268 Phikz144, lytic transglycosylase; bacteriophage, endoly 2e-15
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, nucl 7e-11
1zat_A250 L,D-transpeptidase; L,D-transpeptidation, peptidoglycan 3e-08
1l6j_A425 Matrix metalloproteinase-9; twisted beta sheet flanked 0.002
1eak_A421 72 kDa type IV collagenase; hydrolyse, matrix metallopr 0.003
1su3_A 450 Interstitial collagenase; prodomain, hemopexin domain, 0.004
>3bkh_A Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A* Length = 268 Back     alignment and structure
 Score = 78.9 bits (193), Expect = 2e-15
 Identities = 32/246 (13%), Positives = 67/246 (27%), Gaps = 23/246 (9%)

Query: 99  IRPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVD 158
           ++ L  G+    V +L+  L + G           F     + V  FQ  + LD  G+V 
Sbjct: 9   MKVLRKGDRGDEVCQLQTLLNLCGYDVGK--PDGIFGNNTFNQVVKFQKDNCLDSDGIVG 66

Query: 159 SSTLEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRST 218
            +T   +       I    + +        +       ++N    +        +   S 
Sbjct: 67  KNTWAELFSKYSPPIPYKTIPMPT----ANKSRAAATPVMNAVENATGVRSQLLLTFASI 122

Query: 219 VIVGRVDRQTPILHSRINRIMFNPYW------VIPRSIIQKDMMALLRQDPQ-------- 264
                 + +     +          W         +  +  D    LR+DP+        
Sbjct: 123 ESAFDYEIKAKTSSATGWFQFLTGTWKTMIENYGMKYGVLTDPTGALRKDPRISALMGAE 182

Query: 265 YLKDNNIHMIDEKGKEVFVEEVDWN---SPEPPNFIFRQDPGKINAMASTKIEFYSRNNT 321
            +K+N   +     +E    ++       P            ++ A    K    + +  
Sbjct: 183 LIKENMNILRPVLKREPTDTDLYLAHFFGPGAARRFLTTGQNELAATHFPKEAQANPSIF 242

Query: 322 YMHDTP 327
           Y  D  
Sbjct: 243 YNKDGS 248


>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus G} SCOP: a.20.1.1 d.65.1.1 Length = 213 Back     alignment and structure
>1zat_A L,D-transpeptidase; L,D-transpeptidation, peptidoglycan, beta-lactam insensitive transpeptidase, antibiotic resistance, transferase; 2.40A {Enterococcus faecium} SCOP: b.160.1.1 d.335.1.1 PDB: 2hkl_A Length = 250 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolyse, matrix metalloproteinase, gelatinase A; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Length = 450 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target431 hypothetical protein CLIBASIA_01175 [Candidatus Liberib
3bkh_A268 Phikz144, lytic transglycosylase; bacteriophage, endoly 99.9
1zat_A250 L,D-transpeptidase; L,D-transpeptidation, peptidoglycan 99.68
1y7m_A164 Hypothetical protein BSU14040; surface mutagenesis, cys 99.66
1lbu_A213 Muramoyl-pentapeptide carboxypeptidase; hydrolase, nucl 99.56
1su3_A 450 Interstitial collagenase; prodomain, hemopexin domain, 97.88
1eak_A421 72 kDa type IV collagenase; hydrolyse, matrix metallopr 97.74
1ck7_A 631 Protein (gelatinase A); hydrolase (metalloprotease), FU 97.64
3d2y_A261 N-acetylmuramoyl-L-alanine amidase AMID; zinc amidase, 96.25
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibroblast, 98.0
1l6j_A 425 Matrix metalloproteinase-9; twisted beta sheet flanked 97.77
2ikb_A167 Hypothetical protein NMB1012; structural genomics, PSI- 96.19
2nr7_A195 Secretion activator protein, putative; APCC85792, struc 95.95
>3bkh_A Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A* Back     alignment and structure
Probab=99.90  E-value=8.4e-30  Score=202.37  Aligned_cols=235  Identities=13%  Similarity=-0.006  Sum_probs=180.7

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHH
Q ss_conf             74146888824899999999819866567877645789999999999980888787029999988448988988898640
Q gi|254780350|r  100 RPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVN  179 (431)
Q Consensus       100 ~~L~~G~~~~~V~~Lr~RL~~~Gdl~~~~~~~~~yD~~l~~AVk~FQ~rhGL~~DGvig~~Tl~aLN~~~~~r~~qi~~n  179 (431)
                      +.||+|+++++|..||+||..+||+.  ...+++||+.++.||++||++|||++||++|+.||++|+.+...++.+...+
T Consensus        10 ~~l~~g~~~~~v~~lq~~L~~~g~~~--~~~dg~~~~~t~~av~~fq~~~gl~~~G~~~~~t~~~l~~~~~~~~~~~~~~   87 (268)
T 3bkh_A           10 KVLRKGDRGDEVCQLQTLLNLCGYDV--GKPDGIFGNNTFNQVVKFQKDNCLDSDGIVGKNTWAELFSKYSPPIPYKTIP   87 (268)
T ss_dssp             CCBCTTCBSHHHHHHHHHHHTTTCCC--CSCCSBCCHHHHHHHHHHHHHTTSCCSSCBCHHHHHHHHHHCCCSSCGGGSC
T ss_pred             CCCCCCCCCHHHHHHHHHHHHCCCCC--CCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCC
T ss_conf             60676998678999999999878999--9988988889999999999984999988619999999744034764333310


Q ss_pred             HHHHCCCCCCCCCCHHHHHHCCCEEEEEEEC--CEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCC-CCHHHHHHHHH
Q ss_conf             7753035556765234542045248999988--85555412313887777855421003898448778-87667777777
Q gi|254780350|r  180 LMRIKKLLEQKMGLRYVLVNIPAASLEAVEN--GKVGLRSTVIVGRVDRQTPILHSRINRIMFNPYWV-IPRSIIQKDMM  256 (431)
Q Consensus       180 ler~r~l~~~~~~~~~v~VNip~~~l~~~e~--g~~~~~~~viVGk~~~~TP~~~~~i~~iv~NP~W~-vP~sI~~~eil  256 (431)
                      +++.+|.. ......+..++...+.+..+..  +.......++++.+...++.....+....++|.|. +|.++..++.+
T Consensus        88 ~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~t~sA~~~~q~i~~tw~~~~~~~gp~~~~~~~~~  166 (268)
T 3bkh_A           88 MPTANKSR-AAATPVMNAVENATGVRSQLLLTFASIESAFDYEIKAKTSSATGWFQFLTGTWKTMIENYGMKYGVLTDPT  166 (268)
T ss_dssp             CCSSSSCH-HHHHHHHHHHHHHHCCCHHHHHHHHHHHHTTCSSCBCTTSSCBTTTTBCHHHHHHHHHHHGGGGTCCCCTT
T ss_pred             CCCCCCCC-CCCCCCHHHCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEECHHHHCCCCCCCCCCCCCCCHH
T ss_conf             00123245-67773111012222100111023332235555542577645654212301123022203465201111012


Q ss_pred             HHHHHCHHHHHHCCEEEE--------CCCCCEECCCCCCCCCCC---CCCCCEEECCCCCCCCEEEEEECCCCCEEEECC
Q ss_conf             776418677874993999--------389978350204701044---577224726899986314895315887668138
Q gi|254780350|r  257 ALLRQDPQYLKDNNIHMI--------DEKGKEVFVEEVDWNSPE---PPNFIFRQDPGKINAMASTKIEFYSRNNTYMHD  325 (431)
Q Consensus       257 pk~~~dp~yl~~~~~~i~--------~~~g~~vdp~~i~w~~~~---~~~~~~rQ~PGp~NaLG~vkf~f~N~~~iyLHd  325 (431)
                      |.++.||.+......++.        ...|..+++..+.+...-   .....+.+.++..++.+.-+..+.|+..+|.|+
T Consensus       167 ~~lR~dp~~~a~~~~~~~~~~~~~l~~~~G~~~~~~~~~~a~f~g~~~a~~~l~~~~~~~a~~~~~~~~~an~~~f~~~~  246 (268)
T 3bkh_A          167 GALRKDPRISALMGAELIKENMNILRPVLKREPTDTDLYLAHFFGPGAARRFLTTGQNELAATHFPKEAQANPSIFYNKD  246 (268)
T ss_dssp             CGGGGCHHHHHHHHHHHHHHHHHHHGGGCSSCCCHHHHHHHHHHCHHHHHHHTTSCTTSBHHHHCHHHHHHCHHHHBCTT
T ss_pred             HHHHHCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCHHHHHHCCCCCCHHHHHHHHHHCCCCEEECCC
T ss_conf             56420878999999986420032310035899974456688870864087897628887256663566641876466689


Q ss_pred             CCCHHHCCCCCCCCCCCCEECC
Q ss_conf             8983232865555411503447
Q gi|254780350|r  326 TPEPILFNNVVRFETSGCVRVR  347 (431)
Q Consensus       326 TP~~~lF~~~~Ra~ShGCVRv~  347 (431)
                      ++.+          |.||||..
T Consensus       247 g~~~----------t~~ev~~~  258 (268)
T 3bkh_A          247 GSPK----------TIQEVYNL  258 (268)
T ss_dssp             SCBC----------BHHHHHHH
T ss_pred             CCCC----------CHHHHHHH
T ss_conf             9815----------09999999



>1zat_A L,D-transpeptidase; L,D-transpeptidation, peptidoglycan, beta-lactam insensitive transpeptidase, antibiotic resistance, transferase; 2.40A {Enterococcus faecium} SCOP: b.160.1.1 d.335.1.1 PDB: 2hkl_A Back     alignment and structure
>1y7m_A Hypothetical protein BSU14040; surface mutagenesis, cysteine proteases, cell WALL catabolism, structural genomics, PSI; 2.05A {Bacillus subtilis subsp} SCOP: b.160.1.1 d.7.1.1 Back     alignment and structure
>1lbu_A Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus G} SCOP: a.20.1.1 d.65.1.1 Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolyse, matrix metalloproteinase, gelatinase A; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Back     alignment and structure
>1ck7_A Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1gxd_A Back     alignment and structure
>3d2y_A N-acetylmuramoyl-L-alanine amidase AMID; zinc amidase, PGRP, peptidoglycan recognizing protein, AMPD; HET: AH0; 1.75A {Escherichia coli str} PDB: 2bh7_A 2wkx_A 2bgx_A* 3d2z_A Back     alignment and structure
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Back     alignment and structure
>2ikb_A Hypothetical protein NMB1012; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics; 1.70A {Neisseria meningitidis MC58} SCOP: d.2.1.9 PDB: 2is5_A* Back     alignment and structure
>2nr7_A Secretion activator protein, putative; APCC85792, structural genomics, PSI-2, protein structure initiative, MCSG; 1.30A {Porphyromonas gingivalis W83} SCOP: d.2.1.9 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 431 hypothetical protein CLIBASIA_01175 [Candidatus Liberib
d1lbua183 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal 1e-08
d1l6ja177 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo s 6e-04
>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]} Length = 83 Back     information, alignment and structure

class: All alpha proteins
fold: PGBD-like
superfamily: PGBD-like
family: Peptidoglycan binding domain, PGBD
domain: Zn2+ DD-carboxypeptidase, N-terminal domain
species: Streptomyces albus G [TaxId: 1962]
 Score = 54.6 bits (131), Expect = 1e-08
 Identities = 16/73 (21%), Positives = 30/73 (41%), Gaps = 4/73 (5%)

Query: 94  WPELPIRPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDP 153
           W       L  G+S  +V++L+ R+           +   F    ++AV+ FQ  +GL  
Sbjct: 6   WS----GTLSEGSSGEAVRQLQIRVAGYPGTGAQLAIDGQFGPATKAAVQRFQSAYGLAA 61

Query: 154 SGMVDSSTLEAMN 166
            G+   +T   + 
Sbjct: 62  DGIAGPATFNKIY 74


>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target431 hypothetical protein CLIBASIA_01175 [Candidatus Liberib
d1lbua183 Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyc 99.55
d1l6ja177 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606 98.11
d1su3a167 Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [T 97.88
d1slma165 Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast 97.87
d1eaka176 Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606 97.72
d2bgxa181 Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-ter 96.18
d1zata1128 L,D-transpeptidase, C-terminal, catalytic domain {Enter 99.45
d1y7ma1116 Hypothetical protein YkuD, C-terminal domain {Bacillus 99.35
d2ikba1163 Hypothetical protein NMB1012 {Neisseria meningitidis [T 96.06
d2nr7a1192 Putative secretion activator PG0293 {Porphyromonas ging 95.83
>d1lbua1 a.20.1.1 (A:1-83) Zn2+ DD-carboxypeptidase, N-terminal domain {Streptomyces albus G [TaxId: 1962]} Back     information, alignment and structure
class: All alpha proteins
fold: PGBD-like
superfamily: PGBD-like
family: Peptidoglycan binding domain, PGBD
domain: Zn2+ DD-carboxypeptidase, N-terminal domain
species: Streptomyces albus G [TaxId: 1962]
Probab=99.55  E-value=3.4e-15  Score=110.64  Aligned_cols=68  Identities=22%  Similarity=0.288  Sum_probs=63.1

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCC
Q ss_conf             74146888824899999999819866567877645789999999999980888787029999988448
Q gi|254780350|r  100 RPLHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNV  167 (431)
Q Consensus       100 ~~L~~G~~~~~V~~Lr~RL~~~Gdl~~~~~~~~~yD~~l~~AVk~FQ~rhGL~~DGvig~~Tl~aLN~  167 (431)
                      ++|++|+++++|..|+++|...|+.......+++||+.+++||++||++|||++||++|+.||++||.
T Consensus         8 ~~L~~G~~g~~V~~lQ~~L~~~g~~~~~~~~dg~fg~~t~~AV~~FQ~~~gL~~dGivg~~T~~~L~~   75 (83)
T d1lbua1           8 GTLSEGSSGEAVRQLQIRVAGYPGTGAQLAIDGQFGPATKAAVQRFQSAYGLAADGIAGPATFNKIYQ   75 (83)
T ss_dssp             SCBCTTCBSHHHHHHHHHTTTCSCTTCCCCCSSBCCHHHHHHHHHHHHHTTSCCSSCBCHHHHHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
T ss_conf             78989997089999999998359987876889832889999999999994999988389999999997



>d1l6ja1 a.20.1.2 (A:29-105) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1su3a1 a.20.1.2 (A:32-98) Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1slma1 a.20.1.2 (A:16-80) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} Back     information, alignment and structure
>d1eaka1 a.20.1.2 (A:32-107) Gelatinase A (MMP-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zata1 b.160.1.1 (A:339-466) L,D-transpeptidase, C-terminal, catalytic domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1y7ma1 b.160.1.1 (A:49-164) Hypothetical protein YkuD, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ikba1 d.2.1.9 (A:1-163) Hypothetical protein NMB1012 {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2nr7a1 d.2.1.9 (A:1-192) Putative secretion activator PG0293 {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 431 hypothetical protein CLIBASIA_01175 [Candidatus Li
1zat_A_250 (A:) L,D-transpeptidase; L,D-transpeptidation, pep 2e-17
1lbu_A_1-9090 (A:1-90) Muramoyl-pentapeptide carboxypeptidase; h 2e-14
3bkh_A_1-8787 (A:1-87) Phikz144, lytic transglycosylase; bacteri 1e-12
1y7m_A_51-164114 (A:51-164) Hypothetical protein BSU14040; surface 0.002
>1zat_A (A:) L,D-transpeptidase; L,D-transpeptidation, peptidoglycan, beta-lactam insensitive transpeptidase, antibiotic resistance, transferase; 2.40A {Enterococcus faecium}Length = 250 Back     alignment and structure
 Score = 85.0 bits (209), Expect = 2e-17
 Identities = 21/228 (9%), Positives = 54/228 (23%), Gaps = 21/228 (9%)

Query: 102 LHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSST 161
            + G   +  +++R+ +   G    +      F +     V +    +        ++  
Sbjct: 37  YNDGKVDLDTEQVRQYVTDLGTKYNTSTNDTKFKSTKRGEVTVPVGTYSWTIQTDSETEA 96

Query: 162 LEAMNVPVDLRIRQLQVNLMRIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIV 221
           L+   +      R   V            +   Y+ V++    +   ++GKV L + ++ 
Sbjct: 97  LKKAILAGQDFTRSPIVQ--GGTTADHPLIEDTYIEVDLENQHMWYYKDGKVALETDIVS 154

Query: 222 GRVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQDPQYLKDNNIHMIDEKGKEV 281
           G+    TP     +     +                        +    +          
Sbjct: 155 GKPTTPTPAGVFYVWNKEEDATLKGTNDDG--TPYESPVNYWMPIDWTGVG--------- 203

Query: 282 FVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEP 329
                  +S   P            +     I         +    E 
Sbjct: 204 -----IHDSDWQPE-YGGDLWKTRGSHG--CINTPPSVMKELFGMVEK 243


>1lbu_A (A:1-90) Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus G}Length = 90 Back     alignment and structure
>3bkh_A (A:1-87) Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A*Length = 87 Back     alignment and structure
>1y7m_A (A:51-164) Hypothetical protein BSU14040; surface mutagenesis, cysteine proteases, cell WALL catabolism, structural genomics, PSI; 2.05A {Bacillus subtilis subsp}Length = 114 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target431 hypothetical protein CLIBASIA_01175 [Candidatus Liberib
1zat_A_250 L,D-transpeptidase; L,D-transpeptidation, peptidog 99.84
1lbu_A_1-9090 Muramoyl-pentapeptide carboxypeptidase; hydrolase, 99.71
3bkh_A_1-8787 Phikz144, lytic transglycosylase; bacteriophage, e 99.5
1l6j_A_1-8888 Matrix metalloproteinase-9; twisted beta sheet fla 98.38
1slm_A_1-8383 Stromelysin-1; hydrolase, metalloprotease, fibrobl 98.09
1ck7_A_1-8181 Protein (gelatinase A); hydrolase (metalloprotease 98.01
1eak_A_1-7979 72 kDa type IV collagenase; hydrolyse, matrix meta 97.99
1su3_A_1-8181 Interstitial collagenase; prodomain, hemopexin dom 97.99
3d2y_A_179-26183 N-acetylmuramoyl-L-alanine amidase AMID; zinc amid 97.06
1y7m_A_51-164114 Hypothetical protein BSU14040; surface mutagenesis 99.38
2ikb_A_70-16798 Hypothetical protein NMB1012; structural genomics, 96.75
2nr7_A_80-195116 Secretion activator protein, putative; APCC85792, 96.43
>1zat_A (A:) L,D-transpeptidase; L,D-transpeptidation, peptidoglycan, beta-lactam insensitive transpeptidase, antibiotic resistance, transferase; 2.40A {Enterococcus faecium} Back     alignment and structure
Probab=99.84  E-value=4.7e-24  Score=167.79  Aligned_cols=201  Identities=11%  Similarity=0.033  Sum_probs=160.9

Q ss_pred             CCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             14688882489999999981986656787764578999999999998088878702999998844898898889864077
Q gi|254780350|r  102 LHLGNSSVSVQRLRERLIISGDLDPSKGLSVAFDAYVESAVKLFQMRHGLDPSGMVDSSTLEAMNVPVDLRIRQLQVNLM  181 (431)
Q Consensus       102 L~~G~~~~~V~~Lr~RL~~~Gdl~~~~~~~~~yD~~l~~AVk~FQ~rhGL~~DGvig~~Tl~aLN~~~~~r~~qi~~nle  181 (431)
                      ...|.-......++.++...++..........|+.....+|+.||.+||+..++.....++.+++.+...+..... .++
T Consensus        37 ~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~  115 (250)
T 1zat_A           37 YNDGKVDLDTEQVRQYVTDLGTKYNTSTNDTKFKSTKRGEVTVPVGTYSWTIQTDSETEALKKAILAGQDFTRSPI-VQG  115 (250)
T ss_dssp             EETTEEEECHHHHHHHHHHHHHHHCTTTSCEEEECSSSSEEEECCCSSCEEECHHHHHHHHHHHHHHTSCEEECCC-EEE
T ss_pred             ECCCEEEECHHHHHHHHHHHHHHEEECCCCEEEEECCCCEEEEECCCCCEEECHHHHHHHHHHHHHCCCCEEECEE-EEE
T ss_conf             8699699879999999998766427378526999279978999168644697428999999999873897476527-873


Q ss_pred             HHCCCCCCCCCCHHHHHHCCCEEEEEEECCEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             53035556765234542045248999988855554123138877778554210038984487788766777777777641
Q gi|254780350|r  182 RIKKLLEQKMGLRYVLVNIPAASLEAVENGKVGLRSTVIVGRVDRQTPILHSRINRIMFNPYWVIPRSIIQKDMMALLRQ  261 (431)
Q Consensus       182 r~r~l~~~~~~~~~v~VNip~~~l~~~e~g~~~~~~~viVGk~~~~TP~~~~~i~~iv~NP~W~vP~sI~~~eilpk~~~  261 (431)
                      ++++.+ ...+.++|+||+++++|.++++|+.++.++|++|+++++||.+...|..++.||.|+.|.+            
T Consensus       116 ~~~~~~-~~~~~~~I~Vd~~~~~l~~~~~g~~v~~~~v~~G~~~~~Tp~G~~~i~~k~~~~~~~~~~~------------  182 (250)
T 1zat_A          116 GTTADH-PLIEDTYIEVDLENQHMWYYKDGKVALETDIVSGKPTTPTPAGVFYVWNKEEDATLKGTND------------  182 (250)
T ss_dssp             SSCSSS-CSSCSCEEEEETTTTEEEEEETTEEEEEEECBCBCTTSCCCCEEEECCCCEEEEECCBCC-------------
T ss_pred             CCCCCC-CCCCCCEEEEECCCCEEEEEECCEEEEEEEEECCCCCCCCCCEEEEEEEEECCCEEECCCC------------
T ss_conf             421478-9878839999973699999999999999988717897989956999999855977841588------------


Q ss_pred             CHHHHHHCCEEEECCCCCEECCCCCCCCCCCCCCCCEEECCCCCCCCEEEEEECCCCCEEEECCCCCHHHCCCC--CCCC
Q ss_conf             86778749939993899783502047010445772247268999863148953158876681388983232865--5554
Q gi|254780350|r  262 DPQYLKDNNIHMIDEKGKEVFVEEVDWNSPEPPNFIFRQDPGKINAMASTKIEFYSRNNTYMHDTPEPILFNNV--VRFE  339 (431)
Q Consensus       262 dp~yl~~~~~~i~~~~g~~vdp~~i~w~~~~~~~~~~rQ~PGp~NaLG~vkf~f~N~~~iyLHdTP~~~lF~~~--~Ra~  339 (431)
                                                             ..++.++.|..++.|... ++++|+++..+.+...  ....
T Consensus       183 ---------------------------------------~~~~~~~~~~~~~~~~~~-g~~~h~~~~~~~~~~~~~G~~~  222 (250)
T 1zat_A          183 ---------------------------------------DGTPYESPVNYWMPIDWT-GVGIHDSDWQPEYGGDLWKTRG  222 (250)
T ss_dssp             ----------------------------------------CCCBCCEEEEEEECSSS-SCEEEECTTCSCCSTTHHHHHC
T ss_pred             ---------------------------------------CCCCCCCCCCEEEECCCC-EEEEECCCCCCCCCCCCCCCCC
T ss_conf             ---------------------------------------888867654368862798-7999789975332424589978


Q ss_pred             CCCCEECCCHHHHHHHHHC
Q ss_conf             1150344798999999840
Q gi|254780350|r  340 TSGCVRVRNIIDLDVWLLK  358 (431)
Q Consensus       340 ShGCVRv~np~~La~~ll~  358 (431)
                      |||||||.|.  -|.||..
T Consensus       223 ShGCIrl~~~--da~~l~~  239 (250)
T 1zat_A          223 SHGCINTPPS--VMKELFG  239 (250)
T ss_dssp             BSSSEEECHH--HHHHHHH
T ss_pred             CCCEECCCHH--HHHHHHH
T ss_conf             8868587989--9999995



>1lbu_A (A:1-90) Muramoyl-pentapeptide carboxypeptidase; hydrolase, nuclear receptor; 1.80A {Streptomyces albus G} Back     alignment and structure
>3bkh_A (A:1-87) Phikz144, lytic transglycosylase; bacteriophage, endolysin, peptidoglycan, cell WALL degradation, lysozyme, hydrolase; 2.50A {Pseudomonas phage phikz} PDB: 3bkv_A* Back     alignment and structure
>1l6j_A (A:1-88) Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} Back     alignment and structure
>1slm_A (A:1-83) Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} Back     alignment and structure
>1ck7_A (A:1-81) Protein (gelatinase A); hydrolase (metalloprotease), FULL-length, metalloproteinase; 2.80A {Homo sapiens} Back     alignment and structure
>1eak_A (A:1-79) 72 kDa type IV collagenase; hydrolyse, matrix metalloproteinase, gelatinase A; 2.66A {Homo sapiens} Back     alignment and structure
>1su3_A (A:1-81) Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} Back     alignment and structure
>3d2y_A (A:179-261) N-acetylmuramoyl-L-alanine amidase AMID; zinc amidase, PGRP, peptidoglycan recognizing protein, AMPD; HET: AH0; 1.75A {Escherichia coli str} PDB: 2bh7_A 2bgx_A* 3d2z_A Back     alignment and structure
>1y7m_A (A:51-164) Hypothetical protein BSU14040; surface mutagenesis, cysteine proteases, cell WALL catabolism, structural genomics, PSI; 2.05A {Bacillus subtilis subsp} Back     alignment and structure
>2ikb_A (A:70-167) Hypothetical protein NMB1012; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics; 1.70A {Neisseria meningitidis MC58} Back     alignment and structure
>2nr7_A (A:80-195) Secretion activator protein, putative; APCC85792, structural genomics, PSI-2, protein structure initiative, MCSG; 1.30A {Porphyromonas gingivalis W83} Back     alignment and structure