254780351

254780351

MarR family transcriptional regulator

GeneID in NCBI database:8209336Locus tag:CLIBASIA_01180
Protein GI in NCBI database:254780351Protein Accession:YP_003064764.1
Gene range:-(246959, 247474)Protein Length:171aa
Gene description:MarR family transcriptional regulator
COG prediction:[K] Transcriptional regulators
KEGG prediction:MarR family transcriptional regulator
SEED prediction:Transcriptional regulator, MarR family
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MNNNIQSKIISDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQALLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSGKEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL
ccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHcccHHHcccHHHHEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHccccEEcccHHHHHHHHHHccHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcc
mnnniqskiisdtdsaigndISGLYVECLRLVERLHRSLLDVTRDEferqgrsdVNAVQALLLFNIGdleltagelrsrgyylgsnvsYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSGKEIAETISQLYQRHIESidkvgglsvDDFIAMNKLLQRLNRFWGDQIAYRL
MNNNIQSKiisdtdsaignDISGLYVECLRLVERLHRSLLDVTRdeferqgrsdvNAVQALLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKhqrsridkrsirisltqsgKEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLnrfwgdqiayrl
MNNNIQSKIISDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQALLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQrsridkrsirisLTQSGKEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL
**********************GLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQALLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSGKEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL
MNNNIQSKIISDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQALLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSGKEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL
**********SDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQALLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSGKEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNNIQSKIISDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQALLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSGKEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL
MNNNIQSKIISDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQALLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSGKEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL
MNNNIQSKIISDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQALLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSGKEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target171 MarR family transcriptional regulator [Candidatus Liber
315122225171 MarR family transcriptional regulator [Candidatus Liber 1 3e-80
116251384171 MarR family transcriptional regulator [Rhizobium legumi 1 1e-65
222085504172 transcriptional regulator protein [Agrobacterium radiob 1 5e-65
86357144171 MarR family transcriptional regulator [Rhizobium etli C 1 3e-64
209548718171 MarR family transcriptional regulator [Rhizobium legumi 1 2e-63
227821528170 putative MarR family transcriptional regulator [Sinorhi 1 2e-63
114704836169 putative transcription regulator protein [Fulvimarina p 1 8e-62
13476930171 transcriptional regulator [Mesorhizobium loti MAFF30309 1 2e-59
260466851171 transcriptional regulator, MarR family [Mesorhizobium o 1 5e-59
163759197174 putative transcription regulator protein [Hoeflea photo 1 1e-58
>gi|315122225|ref|YP_004062714.1| MarR family transcriptional regulator [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 171 Back     alignment and organism information
 Score =  300 bits (769), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 152/171 (88%), Positives = 157/171 (91%)

Query: 1   MNNNIQSKIISDTDSAIGNDISGLYVECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQA 60
           M NNI SKII  TD  + N+IS LYVECLRLVERLHR LLDVTRDEFERQGRSDVNAVQA
Sbjct: 1   MKNNIGSKIILKTDGNMENNISSLYVECLRLVERLHRGLLDVTRDEFERQGRSDVNAVQA 60

Query: 61  LLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSG 120
           LLLFNIGDLELTAGELRSRGYYLGSNVSYNLKK+IDL FIK QRS IDKRSIRISLT SG
Sbjct: 61  LLLFNIGDLELTAGELRSRGYYLGSNVSYNLKKMIDLDFIKCQRSHIDKRSIRISLTPSG 120

Query: 121 KEIAETISQLYQRHIESIDKVGGLSVDDFIAMNKLLQRLNRFWGDQIAYRL 171
           KE+AETIS+LYQRHIESIDKVGGLSVDDFI MNKLLQRLNRFWGDQIAYRL
Sbjct: 121 KEVAETISKLYQRHIESIDKVGGLSVDDFIEMNKLLQRLNRFWGDQIAYRL 171



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116251384|ref|YP_767222.1| MarR family transcriptional regulator [Rhizobium leguminosarum bv. viciae 3841] Length = 171 Back     alignment and organism information
>gi|222085504|ref|YP_002544034.1| transcriptional regulator protein [Agrobacterium radiobacter K84] Length = 172 Back     alignment and organism information
>gi|86357144|ref|YP_469036.1| MarR family transcriptional regulator [Rhizobium etli CFN 42] Length = 171 Back     alignment and organism information
>gi|209548718|ref|YP_002280635.1| MarR family transcriptional regulator [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 171 Back     alignment and organism information
>gi|227821528|ref|YP_002825498.1| putative MarR family transcriptional regulator [Sinorhizobium fredii NGR234] Length = 170 Back     alignment and organism information
>gi|114704836|ref|ZP_01437744.1| putative transcription regulator protein [Fulvimarina pelagi HTCC2506] Length = 169 Back     alignment and organism information
>gi|13476930|ref|NP_108499.1| transcriptional regulator [Mesorhizobium loti MAFF303099] Length = 171 Back     alignment and organism information
>gi|260466851|ref|ZP_05813035.1| transcriptional regulator, MarR family [Mesorhizobium opportunistum WSM2075] Length = 171 Back     alignment and organism information
>gi|163759197|ref|ZP_02166283.1| putative transcription regulator protein [Hoeflea phototrophica DFL-43] Length = 174 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target171 MarR family transcriptional regulator [Candidatus Liber
smart00347101 smart00347, HTH_MARR, helix_turn_helix multiple antibio 6e-09
COG1846126 COG1846, MarR, Transcriptional regulators [Transcriptio 4e-07
>gnl|CDD|128641 smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>gnl|CDD|32031 COG1846, MarR, Transcriptional regulators [Transcription] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 171 MarR family transcriptional regulator [Candidatus Liber
PRK11512144 DNA-binding transcriptional repressor MarR; Provisional 99.89
PRK03573144 transcriptional regulator SlyA; Provisional 99.89
PRK10870176 transcriptional repressor MprA; Provisional 99.88
TIGR02337130 HpaR homoprotocatechuate degradation operon regulator, 99.59
COG5631199 Predicted transcription regulator, contains HTH domain 98.22
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resistanc 99.75
COG1846126 MarR Transcriptional regulators [Transcription] 99.65
PRK11050155 manganese transport regulator MntR; Provisional 98.86
PRK03902142 manganese transport transcriptional regulator; Provisio 98.74
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory elem 98.71
COG1321154 TroR Mn-dependent transcriptional regulator [Transcript 98.68
COG3355126 Predicted transcriptional regulator [Transcription] 98.25
pfam0163890 HxlR HxlR-like helix-turn-helix. HxlR, a member of this 98.16
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and simi 98.11
TIGR01889112 Staph_reg_Sar staphylococcal accessory regulator family 98.05
PRK13777190 transcriptional regulator Hpr; Provisional 98.05
COG2345218 Predicted transcriptional regulator [Transcription] 98.05
pfam03965115 Pencillinase_R Penicillinase repressor. The penicillina 97.91
COG1733120 Predicted transcriptional regulators [Transcription] 97.88
COG1339214 Transcriptional regulator of a riboflavin/FAD biosynthe 97.87
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon 97.86
TIGR03433100 padR_acidobact transcriptional regulator, Acidobacteria 97.81
COG1497 260 Predicted transcriptional regulator [Transcription] 97.8
COG1695138 Predicted transcriptional regulators [Transcription] 97.6
PRK10082 303 putative DNA-binding transcriptional regulator; Provisi 97.45
COG3682123 Predicted transcriptional regulator [Transcription] 97.44
pfam0355181 PadR Transcriptional regulator PadR-like family. Member 97.39
PRK10141106 DNA-binding transcriptional repressor ArsR; Provisional 97.39
PRK12681 324 cysB transcriptional regulator CysB; Reviewed 97.38
TIGR03418 291 chol_sulf_TF putative choline sulfate-utilization trans 97.34
PRK10341 312 DNA-binding transcriptional activator TdcA; Provisional 97.34
PRK12680 327 transcriptional regulator CysB-like protein; Reviewed 97.32
COG4742 260 Predicted transcriptional regulator [Transcription] 97.31
PRK04172 501 pheS phenylalanyl-tRNA synthetase subunit alpha; Provis 97.29
PRK10086 311 DNA-binding transcriptional regulator DsdC; Provisional 97.29
PRK11414221 putative DNA-binding transcriptional regulator; Provisi 97.28
CHL00180 307 rbcR LysR transcriptional regulator; Provisional 97.28
PRK10632 309 putative DNA-binding transcriptional regulator; Provisi 97.27
PRK11074 300 putative DNA-binding transcriptional regulator; Provisi 97.19
PRK09791 302 putative DNA-binding transcriptional regulator; Provisi 97.15
PRK11242 292 DNA-binding transcriptional regulator CynR; Provisional 97.13
PRK11013 309 DNA-binding transcriptional regulator LysR; Provisional 97.12
PRK11139 295 DNA-binding transcriptional activator GcvA; Provisional 97.11
PRK11233 305 nitrogen assimilation transcriptional regulator; Provis 97.11
TIGR03338212 phnR_burk phosphonate utilization associated transcript 97.09
PRK12679 316 cbl transcriptional regulator Cbl; Reviewed 97.06
PRK09801 310 transcriptional activator TtdR; Provisional 97.05
PRK09906 296 DNA-binding transcriptional regulator HcaR; Provisional 97.01
PRK03601 275 transcriptional regulator HdfR; Provisional 97.0
PRK10837 291 putative DNA-binding transcriptional regulator; Provisi 97.0
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulation. 97.0
PRK12682 309 transcriptional regulator CysB-like protein; Reviewed 96.98
PRK12684 313 transcriptional regulator CysB-like protein; Reviewed 96.98
PRK11151 305 DNA-binding transcriptional regulator OxyR; Provisional 96.96
PRK03837243 transcriptional regulator NanR; Provisional 96.93
PRK10094 308 DNA-binding transcriptional activator AllS; Provisional 96.93
COG0583 297 LysR Transcriptional regulator [Transcription] 96.91
TIGR03298 292 argP transcriptional regulator, ArgP family. ArgP used 96.89
TIGR03339 279 phn_lysR aminoethylphosphonate catabolism associated Ly 96.85
PRK03635 295 chromosome replication initiation inhibitor protein; Va 96.77
COG1802230 GntR Transcriptional regulators [Transcription] 96.77
PRK11062 296 nhaR transcriptional activator NhaR; Provisional 96.74
PRK12683 308 transcriptional regulator CysB-like protein; Reviewed 96.67
PRK09986 278 DNA-binding transcriptional activator XapR; Provisional 96.62
PTZ00326 505 phenylalanyl-tRNA synthetase; Provisional 96.52
TIGR02702215 SufR_cyano iron-sulfur cluster biosynthesis transcripti 96.48
PRK13348 294 chromosome replication initiation inhibitor protein; Pr 96.46
COG343295 Predicted transcriptional regulator [Transcription] 96.43
COG1725125 Predicted transcriptional regulators [Transcription] 96.37
PRK10225 257 DNA-binding transcriptional repressor UxuR; Provisional 96.29
PRK11337 293 DNA-binding transcriptional repressor RpiR; Provisional 96.18
PRK09464 254 pdhR transcriptional regulator PdhR; Reviewed 96.11
PRK11302 284 DNA-binding transcriptional regulator HexR; Provisional 96.05
TIGR02698130 CopY_TcrY copper transport repressor, CopY/TcrY family; 95.94
PRK08898393 coproporphyrinogen III oxidase; Provisional 95.87
COG4533 564 ABC-type uncharacterized transport system, periplasmic 95.83
pfam0738190 DUF1495 Winged helix DNA-binding domain (DUF1495). This 95.65
PRK05660378 coproporphyrinogen III oxidase; Provisional 95.62
PRK09508 314 leuO leucine transcriptional activator; Reviewed 95.56
pfam07037122 DUF1323 Putative transcription regulator (DUF1323). Thi 95.5
TIGR00738133 rrf2_super rrf2 family protein (putative transcriptiona 95.45
pfam0344479 DUF293 Domain of unknown function. This domain is alway 95.43
PRK08208436 coproporphyrinogen III oxidase; Validated 95.43
PRK08807385 consensus 95.28
PRK09990 251 DNA-binding transcriptional regulator GlcC; Provisional 95.18
PRK08949378 consensus 94.93
COG1737 281 RpiR Transcriptional regulators [Transcription] 94.63
PRK11523 258 DNA-binding transcriptional repressor ExuR; Provisional 94.48
COG2186241 FadR Transcriptional regulators [Transcription] 94.47
PRK11557 282 putative DNA-binding transcriptional regulator; Provisi 94.3
PRK13347453 coproporphyrinogen III oxidase; Provisional 94.27
PRK05799374 coproporphyrinogen III oxidase; Provisional 94.15
PRK05638443 threonine synthase; Validated 94.01
PRK08599377 coproporphyrinogen III oxidase; Provisional 93.93
PRK11920153 rirA iron-responsive transcriptional regulator; Reviewe 93.93
PRK06582390 coproporphyrinogen III oxidase; Provisional 93.91
COG3327 291 PaaX Phenylacetic acid-responsive transcriptional repre 93.81
PRK11014141 transcriptional repressor NsrR; Provisional 93.79
PRK08629424 coproporphyrinogen III oxidase; Provisional 93.52
PRK09249456 coproporphyrinogen III oxidase; Provisional 92.89
TIGR02424 300 TF_pcaQ pca operon transcription factor PcaQ; InterPro: 92.72
cd00186381 TOP1Ac DNA Topoisomerase, subtype IA; DNA-binding, ATP- 92.44
TIGR00331 343 hrcA heat-inducible transcription repressor HrcA; Inter 92.33
PRK09057381 coproporphyrinogen III oxidase; Provisional 92.19
PRK05776675 DNA topoisomerase III; Provisional 91.67
COG1386184 scpB Chromosome segregation and condensation protein B 91.47
COG3398240 Uncharacterized protein conserved in archaea [Function 91.31
PRK00082 339 hrcA heat-inducible transcription repressor; Provisiona 91.12
COG3398240 Uncharacterized protein conserved in archaea [Function 91.05
pfam01131403 Topoisom_bac DNA topoisomerase. This subfamily of topoi 91.0
TIGR02036 302 dsdC D-serine deaminase transcriptional activator; Inte 90.92
PRK05582 692 DNA topoisomerase I; Validated 90.89
pfam04552160 Sigma54_DBD Sigma-54, DNA binding domain. This DNA bind 90.8
PRK05823 691 consensus 90.52
TIGR02431 252 pcaR_pcaU beta-ketoadipate pathway transcriptional regu 90.48
COG1568 354 Predicted methyltransferases [General function predicti 90.45
PRK08413 733 consensus 90.17
PRK07141622 DNA topoisomerase I; Validated 90.01
pfam0104759 MarR MarR family. The Mar proteins are involved in the 99.23
COG1510177 Predicted transcriptional regulators [Transcription] 98.25
COG2512258 Predicted membrane-associated trancriptional regulator 97.83
pfam0132558 Fe_dep_repress Iron dependent repressor, N-terminal DNA 97.55
pfam0197868 TrmB Sugar-specific transcriptional regulator TrmB. One 97.42
pfam0172665 LexA_DNA_bind LexA DNA binding domain. This is the DNA 97.32
pfam0102247 HTH_5 Bacterial regulatory protein, arsR family. Member 97.18
pfam0933952 HTH_IclR IclR helix-turn-helix domain. 97.1
PRK00215204 LexA repressor; Validated 97.04
TIGR01884231 cas_HTH CRISPR locus-related DNA-binding protein; Inter 97.01
PRK09954 362 hypothetical protein; Provisional 96.89
PRK12423202 LexA repressor; Provisional 96.86
PRK09834 264 DNA-binding transcriptional activator MhpR; Provisional 96.86
PRK11569 274 transcriptional repressor IclR; Provisional 96.71
COG4190144 Predicted transcriptional regulator [Transcription] 96.71
PRK10163 271 DNA-binding transcriptional repressor AllR; Provisional 96.68
COG1378 247 Predicted transcriptional regulators [Transcription] 96.63
pfam0418273 B-block_TFIIIC B-block binding subunit of TFIIIC. Yeast 96.63
COG1414 246 IclR Transcriptional regulator [Transcription] 96.44
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 96.44
PRK11169164 leucine-responsive transcriptional regulator; Provision 96.43
PRK11179153 DNA-binding transcriptional regulator AsnC; Provisional 96.38
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an autogenou 96.27
COG1522154 Lrp Transcriptional regulators [Transcription] 96.27
PRK11161235 fumarate/nitrate reduction transcriptional regulator; P 96.25
COG4189 308 Predicted transcriptional regulator [Transcription] 96.17
PRK11753211 cAMP-regulatory protein; Provisional 96.16
COG2390 321 DeoR Transcriptional regulator, contains sigma factor-r 96.11
PRK09391224 fixK transcriptional regulator FixK; Provisional 96.09
PRK11534224 DNA-binding transcriptional regulator CsiR; Provisional 96.08
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-ter 96.05
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor 95.73
PRK10906 252 DNA-binding transcriptional repressor GlpR; Provisional 95.65
PRK09392236 ftrB transcriptional activator FtrB; Provisional 95.55
PRK10411 240 DNA-binding transcriptional activator FucR; Provisional 95.51
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Provisi 95.44
PRK13918201 CRP/FNR family transcriptional regulator; Provisional 95.41
pfam03428177 RP-C Replication protein C N-terminal domain. Replicati 95.36
PRK09802 269 DNA-binding transcriptional regulator AgaR; Provisional 95.32
pfam0822057 HTH_DeoR DeoR-like helix-turn-helix domain. 95.25
COG3888 321 Predicted transcriptional regulator [Transcription] 95.21
PRK13509 251 transcriptional repressor UlaR; Provisional 95.19
COG1349 253 GlpR Transcriptional regulators of sugar metabolism [Tr 95.0
PRK10402213 DNA-binding transcriptional activator YeiL; Provisional 94.82
pfam0901268 FeoC FeoC like transcriptional regulator. This family c 94.8
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcriptio 94.8
pfam0012660 HTH_1 Bacterial regulatory helix-turn-helix protein, ly 94.73
PRK13626 551 transcriptional regulator SgrR; Provisional 94.73
COG1959150 Predicted transcriptional regulator [Transcription] 94.62
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding do 94.59
pfam0039264 GntR Bacterial regulatory proteins, gntR family. This f 94.44
TIGR02719138 repress_PhaQ poly-beta-hydroxybutyrate-responsive repre 94.35
pfam01475120 FUR Ferric uptake regulator family. This family include 94.29
TIGR03337 231 phnR transcriptional regulator protein. This family of 94.19
pfam0827955 HTH_11 HTH domain. This family includes helix-turn-heli 94.13
PRK09462148 fur ferric uptake regulator; Provisional 94.13
PRK11639169 zinc uptake transcriptional repressor; Provisional 94.12
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion 94.02
PRK09764 239 DNA-binding transcriptional repressor MngR; Provisional 93.94
PRK11402 243 DNA-binding transcriptional regulator FrlR; Provisional 93.69
pfam0032532 Crp Bacterial regulatory proteins, crp family. 93.64
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator; Inter 93.55
pfam08784103 RPA_C Replication protein A C terminal. This domain cor 93.42
PRK10079 241 putative transcriptional regulator; Provisional 93.29
COG3413215 Predicted DNA binding protein [General function predict 93.17
COG2188 236 PhnF Transcriptional regulators [Transcription] 93.16
pfam05732165 RepL Firmicute plasmid replication protein (RepL). This 93.07
pfam0208282 Rrf2 Transcriptional regulator. This family is related 92.91
PRK10857164 DNA-binding transcriptional regulator IscR; Provisional 92.89
PRK11886 319 biotin--protein ligase; Provisional 92.71
pfam0496753 HTH_10 HTH DNA binding domain. 92.69
pfam0784870 PaaX PaaX-like protein. This family contains proteins t 92.48
COG1777217 Predicted transcriptional regulators [Transcription] 92.31
pfam05158 313 RNA_pol_Rpc34 RNA polymerase Rpc34 subunit. Subunit spe 92.25
pfam0454550 Sigma70_r4 Sigma-70, region 4. Region 4 of sigma-70 lik 92.19
PRK00118105 putative DNA-binding protein; Validated 92.09
pfam01418106 HTH_6 Helix-turn-helix domain, rpiR family. This domain 92.08
COG165479 BirA Biotin operon repressor [Transcription] 92.07
TIGR02787255 codY_Gpos GTP-sensing transcriptional pleiotropic repre 91.98
TIGR02937162 sigma70-ECF RNA polymerase sigma factor, sigma-70 famil 91.86
pfam06969118 HemN_C HemN C-terminal region. Members of this family a 91.45
pfam04297101 UPF0122 Putative helix-turn-helix protein, YlxM / p13 l 91.45
pfam04492100 Phage_rep_O Bacteriophage replication protein O. Replic 91.34
TIGR02980229 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subf 91.3
COG5340 269 Predicted transcriptional regulator [Transcription] 91.28
PRK13824 404 replication initiation protein RepC; Provisional 91.18
PRK04984 239 fatty acid metabolism regulator; Provisional 91.17
COG3177348 Fic family protein [Function unknown] 91.14
PRK09775 443 hypothetical protein; Provisional 91.07
smart0084363 Ftsk_gamma This domain directs oriented DNA translocati 90.95
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR-like 90.74
KOG2165765 consensus 90.72
pfam0939767 Ftsk_gamma Ftsk gamma domain. This domain directs orien 90.69
TIGR0260781 antidote_HigA addiction module antidote protein, HigA f 90.43
PRK10360196 DNA-binding transcriptional activator UhpA; Provisional 90.18
PRK06474180 hypothetical protein; Provisional 90.14
PRK11716 269 DNA-binding transcriptional regulator IlvY; Provisional 95.66
PRK11482 266 putative DNA-binding transcriptional regulator; Provisi 91.7
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR; InterPro: IPR012712 This Helix-Turn-Helix transcriptional regulator is a member of the MarR family and is found in association with operons for the degradation of 4-hydroxyphenylacetic acid via homoprotocatechuate Back     alignment and domain information
>COG5631 Predicted transcription regulator, contains HTH domain (MarR family) [Transcription] Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>COG1321 TroR Mn-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>pfam01638 HxlR HxlR-like helix-turn-helix Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family; InterPro: IPR010166 This entry represents a family of transcriptional regulatory proteins in Staphylococcus aureus and Staphylococcus epidermidis Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>COG2345 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>pfam03965 Pencillinase_R Penicillinase repressor Back     alignment and domain information
>COG1733 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon [Transcription / Coenzyme metabolism] Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>TIGR03433 padR_acidobact transcriptional regulator, Acidobacterial, PadR-family Back     alignment and domain information
>COG1497 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1695 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK10082 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>COG3682 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>pfam03551 PadR Transcriptional regulator PadR-like family Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PRK12681 cysB transcriptional regulator CysB; Reviewed Back     alignment and domain information
>TIGR03418 chol_sulf_TF putative choline sulfate-utilization transcription factor Back     alignment and domain information
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional Back     alignment and domain information
>PRK12680 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>COG4742 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PRK10086 DNA-binding transcriptional regulator DsdC; Provisional Back     alignment and domain information
>PRK11414 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>CHL00180 rbcR LysR transcriptional regulator; Provisional Back     alignment and domain information
>PRK10632 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11074 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK09791 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional Back     alignment and domain information
>PRK11013 DNA-binding transcriptional regulator LysR; Provisional Back     alignment and domain information
>PRK11139 DNA-binding transcriptional activator GcvA; Provisional Back     alignment and domain information
>PRK11233 nitrogen assimilation transcriptional regulator; Provisional Back     alignment and domain information
>TIGR03338 phnR_burk phosphonate utilization associated transcriptional regulator Back     alignment and domain information
>PRK12679 cbl transcriptional regulator Cbl; Reviewed Back     alignment and domain information
>PRK09801 transcriptional activator TtdR; Provisional Back     alignment and domain information
>PRK09906 DNA-binding transcriptional regulator HcaR; Provisional Back     alignment and domain information
>PRK03601 transcriptional regulator HdfR; Provisional Back     alignment and domain information
>PRK10837 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PRK12682 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK12684 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional Back     alignment and domain information
>PRK03837 transcriptional regulator NanR; Provisional Back     alignment and domain information
>PRK10094 DNA-binding transcriptional activator AllS; Provisional Back     alignment and domain information
>COG0583 LysR Transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR03298 argP transcriptional regulator, ArgP family Back     alignment and domain information
>TIGR03339 phn_lysR aminoethylphosphonate catabolism associated LysR family transcriptional regulator Back     alignment and domain information
>PRK03635 chromosome replication initiation inhibitor protein; Validated Back     alignment and domain information
>COG1802 GntR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11062 nhaR transcriptional activator NhaR; Provisional Back     alignment and domain information
>PRK12683 transcriptional regulator CysB-like protein; Reviewed Back     alignment and domain information
>PRK09986 DNA-binding transcriptional activator XapR; Provisional Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR; InterPro: IPR014075 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>PRK13348 chromosome replication initiation inhibitor protein; Provisional Back     alignment and domain information
>COG3432 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1725 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK10225 DNA-binding transcriptional repressor UxuR; Provisional Back     alignment and domain information
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information
>PRK09464 pdhR transcriptional regulator PdhR; Reviewed Back     alignment and domain information
>PRK11302 DNA-binding transcriptional regulator HexR; Provisional Back     alignment and domain information
>TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family; InterPro: IPR014071 This family includes metal-fist type transcriptional repressors of copper transport systems such as copYZAB of Enterococcus hirae and tcrYAZB (transferable copper resistance) of an Enterococcus faecium (Streptococcus faecium) plasmid Back     alignment and domain information
>PRK08898 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG4533 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>pfam07381 DUF1495 Winged helix DNA-binding domain (DUF1495) Back     alignment and domain information
>PRK05660 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09508 leuO leucine transcriptional activator; Reviewed Back     alignment and domain information
>pfam07037 DUF1323 Putative transcription regulator (DUF1323) Back     alignment and domain information
>TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator); InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulphovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis strain PCC 6803 hypothetical protein slr0846 Back     alignment and domain information
>pfam03444 DUF293 Domain of unknown function Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK08807 consensus Back     alignment and domain information
>PRK09990 DNA-binding transcriptional regulator GlcC; Provisional Back     alignment and domain information
>PRK08949 consensus Back     alignment and domain information
>COG1737 RpiR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11523 DNA-binding transcriptional repressor ExuR; Provisional Back     alignment and domain information
>COG2186 FadR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11557 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK11920 rirA iron-responsive transcriptional regulator; Reviewed Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG3327 PaaX Phenylacetic acid-responsive transcriptional repressor [Transcription] Back     alignment and domain information
>PRK11014 transcriptional repressor NsrR; Provisional Back     alignment and domain information
>PRK08629 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR02424 TF_pcaQ pca operon transcription factor PcaQ; InterPro: IPR012787 Members of this family are LysR-family transcription factors associated with operons for catabolism of protocatechuate Back     alignment and domain information
>cd00186 TOP1Ac DNA Topoisomerase, subtype IA; DNA-binding, ATP-binding and catalytic domain of bacterial DNA topoisomerases I and III, and eukaryotic DNA topoisomerase III and eubacterial and archael reverse gyrases Back     alignment and domain information
>TIGR00331 hrcA heat-inducible transcription repressor HrcA; InterPro: IPR002571 In response to elevated temperature, both prokaryotic and eukaryotic cells increase expression of a small family of chaperones Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK05776 DNA topoisomerase III; Provisional Back     alignment and domain information
>COG1386 scpB Chromosome segregation and condensation protein B [DNA replication, recombination and repair] Back     alignment and domain information
>COG3398 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK00082 hrcA heat-inducible transcription repressor; Provisional Back     alignment and domain information
>COG3398 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>pfam01131 Topoisom_bac DNA topoisomerase Back     alignment and domain information
>TIGR02036 dsdC D-serine deaminase transcriptional activator; InterPro: IPR011781 This family, part of the LysR family of transcriptional regulators, activates transcription of the gene for D-serine deaminase, dsdA Back     alignment and domain information
>PRK05582 DNA topoisomerase I; Validated Back     alignment and domain information
>pfam04552 Sigma54_DBD Sigma-54, DNA binding domain Back     alignment and domain information
>PRK05823 consensus Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family; InterPro: IPR012794 Members of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>PRK08413 consensus Back     alignment and domain information
>PRK07141 DNA topoisomerase I; Validated Back     alignment and domain information
>pfam01047 MarR MarR family Back     alignment and domain information
>COG1510 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>COG2512 Predicted membrane-associated trancriptional regulator [Transcription] Back     alignment and domain information
>pfam01325 Fe_dep_repress Iron dependent repressor, N-terminal DNA binding domain Back     alignment and domain information
>pfam01978 TrmB Sugar-specific transcriptional regulator TrmB Back     alignment and domain information
>pfam01726 LexA_DNA_bind LexA DNA binding domain Back     alignment and domain information
>pfam01022 HTH_5 Bacterial regulatory protein, arsR family Back     alignment and domain information
>pfam09339 HTH_IclR IclR helix-turn-helix domain Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein; InterPro: IPR010163 Most but not all examples of this family are associated with CRISPR loci, a combination of DNA repeats and characteristic proteins encoded near the repeat cluster Back     alignment and domain information
>PRK09954 hypothetical protein; Provisional Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>COG4190 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>COG1378 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>pfam04182 B-block_TFIIIC B-block binding subunit of TFIIIC Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>COG4189 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK11753 cAMP-regulatory protein; Provisional Back     alignment and domain information
>COG2390 DeoR Transcriptional regulator, contains sigma factor-related N-terminal domain [Transcription] Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK11534 DNA-binding transcriptional regulator CsiR; Provisional Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>pfam03428 RP-C Replication protein C N-terminal domain Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>pfam08220 HTH_DeoR DeoR-like helix-turn-helix domain Back     alignment and domain information
>COG3888 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>pfam09012 FeoC FeoC like transcriptional regulator Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>pfam00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family Back     alignment and domain information
>PRK13626 transcriptional regulator SgrR; Provisional Back     alignment and domain information
>COG1959 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>pfam00392 GntR Bacterial regulatory proteins, gntR family Back     alignment and domain information
>TIGR02719 repress_PhaQ poly-beta-hydroxybutyrate-responsive repressor; InterPro: IPR014091 Members of this family are transcriptional regulatory proteins found in the vicinity of poly-beta-hydroxybutyrate (PHB) operons in several species of Bacillus Back     alignment and domain information
>pfam01475 FUR Ferric uptake regulator family Back     alignment and domain information
>TIGR03337 phnR transcriptional regulator protein Back     alignment and domain information
>pfam08279 HTH_11 HTH domain Back     alignment and domain information
>PRK09462 fur ferric uptake regulator; Provisional Back     alignment and domain information
>PRK11639 zinc uptake transcriptional repressor; Provisional Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09764 DNA-binding transcriptional repressor MngR; Provisional Back     alignment and domain information
>PRK11402 DNA-binding transcriptional regulator FrlR; Provisional Back     alignment and domain information
>pfam00325 Crp Bacterial regulatory proteins, crp family Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator; InterPro: IPR014290 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>pfam08784 RPA_C Replication protein A C terminal Back     alignment and domain information
>PRK10079 putative transcriptional regulator; Provisional Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>COG2188 PhnF Transcriptional regulators [Transcription] Back     alignment and domain information
>pfam05732 RepL Firmicute plasmid replication protein (RepL) Back     alignment and domain information
>pfam02082 Rrf2 Transcriptional regulator Back     alignment and domain information
>PRK10857 DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>PRK11886 biotin--protein ligase; Provisional Back     alignment and domain information
>pfam04967 HTH_10 HTH DNA binding domain Back     alignment and domain information
>pfam07848 PaaX PaaX-like protein Back     alignment and domain information
>COG1777 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>pfam05158 RNA_pol_Rpc34 RNA polymerase Rpc34 subunit Back     alignment and domain information
>pfam04545 Sigma70_r4 Sigma-70, region 4 Back     alignment and domain information
>PRK00118 putative DNA-binding protein; Validated Back     alignment and domain information
>pfam01418 HTH_6 Helix-turn-helix domain, rpiR family Back     alignment and domain information
>COG1654 BirA Biotin operon repressor [Transcription] Back     alignment and domain information
>TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY; InterPro: IPR014154 This entry represents pleiotropic repressors in Bacillus subtilis, CodY, and other Firmicutes (low-GC Gram-positive bacteria) that respond to intracellular levels of GTP and branched chain amino acids Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family; InterPro: IPR014284 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>pfam06969 HemN_C HemN C-terminal region Back     alignment and domain information
>pfam04297 UPF0122 Putative helix-turn-helix protein, YlxM / p13 like Back     alignment and domain information
>pfam04492 Phage_rep_O Bacteriophage replication protein O Back     alignment and domain information
>TIGR02980 SigBFG RNA polymerase sigma-70 factor, sigma-B/F/G subfamily; InterPro: IPR014322 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>COG5340 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13824 replication initiation protein RepC; Provisional Back     alignment and domain information
>PRK04984 fatty acid metabolism regulator; Provisional Back     alignment and domain information
>COG3177 Fic family protein [Function unknown] Back     alignment and domain information
>PRK09775 hypothetical protein; Provisional Back     alignment and domain information
>smart00843 Ftsk_gamma This domain directs oriented DNA translocation and forms a winged helix structure Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>KOG2165 consensus Back     alignment and domain information
>pfam09397 Ftsk_gamma Ftsk gamma domain Back     alignment and domain information
>TIGR02607 antidote_HigA addiction module antidote protein, HigA family; InterPro: IPR013430 Proteins in this entry form a distinct group of helix-turn-helix proteins, which are strictly bacterial and nearly always shorter than 110 amino acids Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK06474 hypothetical protein; Provisional Back     alignment and domain information
>PRK11716 DNA-binding transcriptional regulator IlvY; Provisional Back     alignment and domain information
>PRK11482 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target171 MarR family transcriptional regulator [Candidatus Liber
2a61_A145 The Crystal Structure Of Transcriptional Regulator 2e-15
3gfl_A146 Crystal Structure Of The St1710 Mutant (R90a) Prote 7e-14
3gfj_A146 Crystal Structure Of The St1710 Mutant (R89a) Prote 2e-13
1jgs_A138 Multiple Antibiotic Resistance Repressor, Marr Leng 2e-13
2rdp_A150 The Structure Of A Marr Family Protein From Bacillu 2e-12
2pex_A153 Structure Of Reduced C22s Ohrr From Xanthamonas Cam 3e-12
2pfb_A153 Structure Of Oxidized Ohrr From Xanthamonas Campest 7e-12
3f3x_A144 Crystal Structure Of The Transcriptional Regulator 2e-11
3qpt_A147 Crystal Structure Of The Salmonella Transcriptional 3e-11
3q5f_A147 Crystal Structure Of The Salmonella Transcriptional 3e-11
1lj9_A144 The Crystal Structure Of The Transcriptional Regula 3e-11
1z91_A147 X-Ray Crystal Structure Of Apo-Ohrrc15s In Reduced 7e-11
3deu_A166 Crystal Structure Of Transcription Regulatory Prote 7e-11
2eth_A154 Crystal Structure Of A Marr-Like Transcriptional Re 8e-11
2nnn_A140 Crystal Structure Of Probable Transcriptional Regul 1e-10
3bpx_A148 Crystal Structure Of Marr Length = 148 1e-10
3bpv_A138 Crystal Structure Of Marr Length = 138 3e-10
3jw4_A148 The Structure Of A Putative Marr Family Transcripti 5e-10
3gfm_A146 Crystal Structure Of The St1710 Mutant (K91a) Prote 7e-10
2gxg_A146 Crystal Structure Of Emrr Homolog From Hyperthermop 9e-10
3eco_A139 Crystal Structure Of Mepr, A Transcription Regulato 1e-09
2fa5_A162 The Crystal Structure Of An Unliganded Multiple Ant 3e-09
3nqo_A189 Crystal Structure Of A Marr Family Transcriptional 3e-09
2bv6_A142 Crystal Structure Of Mgra, A Global Regulator And M 3e-09
3hse_A140 Crystal Structure Of Staphylococcus Aureus Protein 9e-09
1s3j_A155 X-Ray Crystal Structure Of Yuso Protein From Bacill 1e-08
3mex_A142 Crystal Structure Of Mexr In Oxidized State Length 1e-08
3cjn_A162 Crystal Structure Of Transcriptional Regulator, Mar 2e-08
3hrm_A140 Crystal Structure Of Staphylococcus Aureus Protein 2e-08
1lnw_A147 Crystal Structure Of The Mexr Repressor Of The Mexa 2e-08
3oop_A143 The Structure Of A Protein With Unknown Function Fr 3e-08
3nrv_A148 Crystal Structure Of MarrEMRR FAMILY TRANSCRIPTIONA 3e-08
3e6m_A161 The Crystal Structure Of A Marr Family Transcriptio 3e-08
3ech_A142 The Marr-Family Repressor Mexr In Complex With Its 1e-07
3bdd_A142 Crystal Structure Of A Putative Multiple Antibiotic 4e-07
>gi|73536140|pdb|2A61|A Chain A, The Crystal Structure Of Transcriptional Regulator Tm0710 From Thermotoga Maritima Length = 145 Back     alignment and structure 
 Score = 85.8 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/140 (20%), Positives = 56/140 (40%), Gaps = 8/140 (5%)

Query: 33  ERLHRSLLDVTRDEFER-QGRSDVNAVQALLLFNIG-DLELTAGELRSRGYYLGSNVSYN 90
           ER+ R +  + + E  +      +   Q  +L  I  +     GEL        S V+  
Sbjct: 8   ERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGL 67

Query: 91  LKKLIDLGFIKHQRSRIDKRSIRISLTQSGKEIAETISQLYQRHIESIDKVGGLSVDDFI 150
           +K+L   G++       D+R+  + +T+ G+E+ E + +  +  IE I     L  +   
Sbjct: 68  VKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKI--TSDLGKEKSS 125

Query: 151 AMNKLLQRL----NRFWGDQ 166
            +   L+ L     R +  Q
Sbjct: 126 KILDYLKELKGVMERNFSKQ 145
>gi|256599697|pdb|3GFL|A Chain A, Crystal Structure Of The St1710 Mutant (R90a) Protein Length = 146 Back     alignment and structure
>gi|256599696|pdb|3GFJ|A Chain A, Crystal Structure Of The St1710 Mutant (R89a) Protein Length = 146 Back     alignment and structure
>gi|18158791|pdb|1JGS|A Chain A, Multiple Antibiotic Resistance Repressor, Marr Length = 138 Back     alignment and structure
>gi|160286073|pdb|2RDP|A Chain A, The Structure Of A Marr Family Protein From Bacillus Stearothermophilus Length = 150 Back     alignment and structure
>gi|162329954|pdb|2PEX|A Chain A, Structure Of Reduced C22s Ohrr From Xanthamonas Campestris Length = 153 Back     alignment and structure
>gi|162329956|pdb|2PFB|A Chain A, Structure Of Oxidized Ohrr From Xanthamonas Campestris Length = 153 Back     alignment and structure
gi|229597846|pdb|3F3X|A Chain A, Crystal Structure Of The Transcriptional Regulator Bldr From Sulfolobus Solfataricus Length = 144 Back     alignment and structure
>gi|332138245|pdb|3QPT|A Chain A, Crystal Structure Of The Salmonella Transcriptional Regulator Slya Length = 147 Back     alignment and structure
>gi|332138206|pdb|3Q5F|A Chain A, Crystal Structure Of The Salmonella Transcriptional Regulator Slya In Complex With Dna Length = 147 Back     alignment and structure
>gi|28373542|pdb|1LJ9|A Chain A, The Crystal Structure Of The Transcriptional Regulator Slya Length = 144 Back     alignment and structure
>gi|82407566|pdb|1Z91|A Chain A, X-Ray Crystal Structure Of Apo-Ohrrc15s In Reduced Form: Marr Family Protein Length = 147 Back     alignment and structure
>gi|192988596|pdb|3DEU|A Chain A, Crystal Structure Of Transcription Regulatory Protein Slya From Salmonella Typhimurium In Complex With Salicylate Ligands Length = 166 Back     alignment and structure
>gi|83754961|pdb|2ETH|A Chain A, Crystal Structure Of A Marr-Like Transcriptional Regulator (Tm0816) From Thermotoga Maritima At 2.50 A Resolution Length = 154 Back     alignment and structure
>gi|119390485|pdb|2NNN|A Chain A, Crystal Structure Of Probable Transcriptional Regulator From Pseudomonas Aeruginosa Length = 140 Back     alignment and structure
>gi|188595948|pdb|3BPX|A Chain A, Crystal Structure Of Marr Length = 148 Back     alignment and structure
>gi|188595947|pdb|3BPV|A Chain A, Crystal Structure Of Marr Length = 138 Back     alignment and structure
>gi|281500789|pdb|3JW4|A Chain A, The Structure Of A Putative Marr Family Transcriptional Regulator From Clostridium Acetobutylicum Length = 148 Back     alignment and structure
>gi|256599698|pdb|3GFM|A Chain A, Crystal Structure Of The St1710 Mutant (K91a) Protein Length = 146 Back     alignment and structure
gi|145579472|pdb|2GXG|A Chain A, Crystal Structure Of Emrr Homolog From Hyperthermophilic Archaea Sulfolobus Tokodaii Strain7 Length = 146 Back     alignment and structure
gi|223365857|pdb|3ECO|A Chain A, Crystal Structure Of Mepr, A Transcription Regulator Of The Staphylococcus Aureus Multidrug Efflux Pump Mepa Length = 139 Back     alignment and structure
>gi|119389448|pdb|2FA5|A Chain A, The Crystal Structure Of An Unliganded Multiple Antibiotic- Resistance Repressor (Marr) From Xanthomonas Campestris Length = 162 Back     alignment and structure
>gi|301016100|pdb|3NQO|A Chain A, Crystal Structure Of A Marr Family Transcriptional Regulator (Cd1569) From Clostridium Difficile 630 At 2.20 A Resolution Length = 189 Back     alignment and structure
>gi|116666838|pdb|2BV6|A Chain A, Crystal Structure Of Mgra, A Global Regulator And Major Virulence Determinant In Staphylococcus Aureus Length = 142 Back     alignment and structure
>gi|251837069|pdb|3HSE|A Chain A, Crystal Structure Of Staphylococcus Aureus Protein Sarz In Reduced Form Length = 140 Back     alignment and structure
>gi|48425545|pdb|1S3J|A Chain A, X-Ray Crystal Structure Of Yuso Protein From Bacillus Subtilis Length = 155 Back     alignment and structure
>gi|301598581|pdb|3MEX|A Chain A, Crystal Structure Of Mexr In Oxidized State Length = 142 Back     alignment and structure
>gi|170785279|pdb|3CJN|A Chain A, Crystal Structure Of Transcriptional Regulator, Marr Family, From Silicibacter Pomeroyi Length = 162 Back     alignment and structure
>gi|251837055|pdb|3HRM|A Chain A, Crystal Structure Of Staphylococcus Aureus Protein Sarz In Sulfenic Acid Form Length = 140 Back     alignment and structure
>gi|24158873|pdb|1LNW|A Chain A, Crystal Structure Of The Mexr Repressor Of The Mexab-Oprm Multidrug Efflux Operon Of Pseudomonas Aeruginosa Length = 147 Back     alignment and structure
>gi|307568447|pdb|3OOP|A Chain A, The Structure Of A Protein With Unknown Function From Listeria Innocua Clip11262 Length = 143 Back     alignment and structure
>gi|306991857|pdb|3NRV|A Chain A, Crystal Structure Of MarrEMRR FAMILY TRANSCRIPTIONAL REGULATOR FROM Acinetobacter Sp. Adp1 Length = 148 Back     alignment and structure
>gi|197725351|pdb|3E6M|A Chain A, The Crystal Structure Of A Marr Family Transcriptional Regulator From Silicibacter Pomeroyi Dss. Length = 161 Back     alignment and structure
>gi|209870500|pdb|3ECH|A Chain A, The Marr-Family Repressor Mexr In Complex With Its Antirepressor Armr Length = 142 Back     alignment and structure
>gi|161761215|pdb|3BDD|A Chain A, Crystal Structure Of A Putative Multiple Antibiotic-Resistance Repressor (Ssu05_1136) From Streptococcus Suis 891591 AT 2.20 A Resolution Length = 142 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target171 MarR family transcriptional regulator [Candidatus Liber
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding protein 9e-12
3nqo_A189 MARR-family transcriptional regulator; structural genom 3e-11
3bpv_A138 Transcriptional regulator; MARR, DNA binding, transcrip 1e-10
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, trans 2e-10
3oop_A143 LIN2960 protein; protein structure initiative, PSI-2, s 3e-10
1jgs_A138 Multiple antibiotic resistance protein MARR; transcript 6e-10
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, midwes 6e-10
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; PSI- 1e-09
3e6m_A161 MARR family transcriptional regulator; APC88769, silici 1e-09
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-bindin 1e-09
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, stru 2e-09
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; multidru 4e-09
2pex_A153 Transcriptional regulator OHRR; transcription regulator 4e-09
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix-turn 7e-09
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-turn-hel 7e-09
3bj6_A152 Transcriptional regulator, MARR family; helix-turn-heli 1e-08
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MARR, st 2e-08
3boq_A160 Transcriptional regulator, MARR family; structural geno 2e-08
2nnn_A140 Probable transcriptional regulator; structural genomics 2e-08
2gxg_A146 146AA long hypothetical transcriptional regulator; wing 2e-08
3ech_A142 MEXR, multidrug resistance operon repressor; winged hel 4e-08
1s3j_A155 YUSO protein; structural genomics, MARR transcriptional 4e-08
3kp7_A151 Transcriptional regulator TCAR; multiple drug resistanc 6e-08
2nyx_A168 Probable transcriptional regulatory protein, RV1404; al 9e-08
3bdd_A142 Regulatory protein MARR; ZP_00875883.1, putative multip 1e-07
1z91_A147 Organic hydroperoxide resistance transcriptional regula 1e-07
3bja_A139 Transcriptional regulator, MARR family, putative; NP_97 2e-07
2fa5_A162 Transcriptional regulator MARR/EMRR family; multiple an 2e-07
2fbh_A146 Transcriptional regulator PA3341; MARR, transcription r 2e-07
1ku9_A152 Hypothetical protein MJ223; putative transcription fact 2e-07
3f3x_A144 Transcriptional regulator, MARR family, putative; DNA b 3e-07
2fxa_A207 Protease production regulatory protein HPR; protease po 5e-07
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01047, 6e-07
3g3z_A145 NMB1585, transcriptional regulator, MARR family; transc 3e-06
1p4x_A250 Staphylococcal accessory regulator A homologue; winged- 6e-06
2qww_A154 Transcriptional regulator, MARR family; YP_013417.1, mu 0.002
2frh_A127 SARA, staphylococcal accessory regulator A; winged-heli 0.004
1p4x_A250 Staphylococcal accessory regulator A homologue; winged- 7e-05
3cta_A 230 Riboflavin kinase; structural genomics, transferase, PS 0.004
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Length = 144 Back     alignment and structure
 Score = 64.9 bits (158), Expect = 9e-12
 Identities = 28/136 (20%), Positives = 57/136 (41%), Gaps = 6/136 (4%)

Query: 27  ECLRLVERLHRSLLDVTRDEFERQGRSDVNAVQALLLFNIGDLE-LTAGELRSRGYYLGS 85
           + LR +  + R+L  ++  EF+      +   Q L L  + +   +   ++        +
Sbjct: 2   DILREIGMIARALDSISNIEFKELS---LTRGQYLYLVRVCENPGIIQEKIAELIKVDRT 58

Query: 86  NVSYNLKKLIDLGFIKHQRSRIDKRSIRISLTQSGKEIAETISQLYQRHIESIDKVGGLS 145
             +  +K+L + GFI  Q    +K+  RI  T+ GK +   I +  Q   +    + GLS
Sbjct: 59  TAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVA--LQGLS 116

Query: 146 VDDFIAMNKLLQRLNR 161
             +   +   L R+ +
Sbjct: 117 EVEISQLADYLVRMRK 132
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Length = 189 Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Length = 138 Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Length = 166 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Length = 143 Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Length = 138 Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Length = 145 Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Length = 148 Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Length = 161 Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} Length = 148 Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomics, PSI, protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Length = 142 Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Length = 142 Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Length = 153 Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} Length = 139 Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcriptional regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A Length = 140 Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, structural genomics, PSI-2; 2.01A {Silicibacter pomeroyi dss-3} Length = 152 Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structural genomics, protein structure initiative; HET: GOL; 2.00A {Rhodococcus jostii RHA1} Length = 150 Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Length = 160 Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} Length = 140 Back