254780355

254780355

type II citrate synthase

GeneID in NCBI database:8209340Locus tag:CLIBASIA_01200
Protein GI in NCBI database:254780355Protein Accession:YP_003064768.1
Gene range:-(251721, 253010)Protein Length:429aa
Gene description:type II citrate synthase
COG prediction:[C] Citrate synthase
KEGG prediction:gltA; type II citrate synthase (EC:2.3.3.1); K01647 citrate synthase [EC:2.3.3.1]
SEED prediction:Citrate synthase (si) (EC 2.3.3.1)
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Glyoxylate and dicarboxylate metabolism [PATH:las00630]
Subsystem involved in SEED:Biogenesis of c-type cytochromes;
TCA Cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MTDKFAKLHLGHEEIDLPIKEGSLGSSVLDISFLHKNGIFTYDPAFSSTASCKSKITFIDGNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKYSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPFRIMGFGHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYPNVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVDPSRRIGRPRQLYTGALKRDYVPLEERE
ccccEEEEEEccEEEEEEEcccccccccEEEEEEcccccEEEcccccccEEEEEEEEEEEccccEEEEccEEHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEccccccccccHHHcc
ccccccEEEccccEEEEEEEcccccccEEEccccHHHccEEEccccccEEEEEEccEEEEccccEEEEccEEHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHcccccccHHHHHHHHHccHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcEccEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccHHHcccccccccccccccccccccccccccEcccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcHHHHHccccEcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccHHHcc
MTDKFaklhlgheeidlpikegslgssvLDISFlhkngiftydpafsstasckskitfidgnngillyrgypieqlsekSDFLEVCYLLLHGElanvsqqkdfndKISRHALLNENMSrffmgfpssahPMAMLVSAVGALssfyyspsgvqdleQCVNVSLRMIAKISTIAAMIYKYSigqpfvyprsdldyasNFLHMcfsvpcaeyqvnpLLARAMNRIFILHadheqnaststvrlagssgadpfACIAAGVAclggrahgganEEALNMLMEigsleriphyimrakdkndpfrimgfghrvyrnhdprcrIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIerklypnvdfysgitlralgfptNLFTVLFAVARTAGWVSQWTEMivdpsrrigrprqlytgalkrdyvpleere
mtdkfaklhlgheeidlpikegSLGSSVLDISFLHKNGIFTYDPAFSSTASCKSKITFIDGNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKYSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAkdkndpfrimgfghrvyrnhdprcRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYPNVDFYSGITLRALGFPTNLFTVLFAVARTagwvsqwtemivdpsrrigrprqlytgalkrdyvpleere
MTDKFAKLHLGHEEIDLPIKEGSLGSSVLDISFLHKNGIFTYDPAFSSTASCKSKITFIDGNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKYSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPFRIMGFGHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYPNVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVDPSRRIGRPRQLYTGALKRDYVPLEERE
***KFAK*HLGHEEIDLPIKEGSLGSSVLDISFLHKNGIFTYDPAFSSTASCKSKITFIDGNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKYSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPFRIMGFGHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYPNVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVDPSRRIGRPRQLYTGALKRDYVP*****
MTDKFAKLHLGHEEIDLPIKEGSLGSSVLDISFLHKNGIFTYDPAFSSTASCKSKITFIDGNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKYSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPFRIMGFGHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYPNVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVDPSRRIGRPRQLYTGALKRDYVPLEERE
***KFAKLHLGHEEIDLPIKEGSLGSSVLDISFLHKNGIFTYDPAFSSTASCKSKITFIDGNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKYSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPFRIMGFGHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYPNVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVDPSRRIGRPRQLYTGALKRDYVPL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTDKFAKLHLGHEEIDLPIKEGSLGSSVLDISFLHKNGIFTYDPAFSSTASCKSKITFIDGNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKYSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPFRIMGFGHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYPNVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVDPSRRIGRPRQLYTGALKRDYVPLEERE
MTDKFAKLHLGHEEIDLPIKEGSLGSSVLDISFLHKNGIFTYDPAFSSTASCKSKITFIDGNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKYSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPFRIMGFGHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYPNVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVDPSRRIGRPRQLYTGALKRDYVPLEERE
MTDKFAKLHLGHEEIDLPIKEGSLGSSVLDISFLHKNGIFTYDPAFSSTASCKSKITFIDGNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKYSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPFRIMGFGHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYPNVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVDPSRRIGRPRQLYTGALKRDYVPLEERE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target429 type II citrate synthase [Candidatus Liberibacter asiat
315122222432 type II citrate synthase [Candidatus Liberibacter solan 1 0.0
325292750429 type II citrate synthase [Agrobacterium sp. H13-3] Leng 1 0.0
15888718429 type II citrate synthase [Agrobacterium tumefaciens str 1 0.0
222148890429 type II citrate synthase [Agrobacterium vitis S4] Lengt 1 0.0
328543725430 citrate synthase, chromosomal [polymorphum gilvum SL003 1 0.0
294852488430 citrate (Si)-synthase [Brucella sp. NVSL 07-0026] Lengt 1 1e-180
148559633435 type II citrate synthase [Brucella ovis ATCC 25840] Len 1 1e-180
225627616437 citrate synthase I [Brucella ceti str. Cudo] Length = 4 1 1e-180
23502026430 type II citrate synthase [Brucella suis 1330] Length = 1 1e-180
163843413430 type II citrate synthase [Brucella suis ATCC 23445] Len 1 1e-180
>gi|315122222|ref|YP_004062711.1| type II citrate synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 432 Back     alignment and organism information
 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/428 (85%), Positives = 401/428 (93%)

Query: 1   MTDKFAKLHLGHEEIDLPIKEGSLGSSVLDISFLHKNGIFTYDPAFSSTASCKSKITFID 60
           M DKFAKL+L +E++DL I+ GSLGSSV+DIS L+K+GIFTYDPAFS+TASC+SKITFID
Sbjct: 1   MMDKFAKLYLENEQMDLLIRRGSLGSSVIDISSLNKSGIFTYDPAFSATASCESKITFID 60

Query: 61  GNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRF 120
           GNNG LLYRGYPIEQLSEKSDFLEVCYLLLHGEL +  Q+KDF+ KISRH LLNENMSRF
Sbjct: 61  GNNGTLLYRGYPIEQLSEKSDFLEVCYLLLHGELPDAEQKKDFDYKISRHTLLNENMSRF 120

Query: 121 FMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKYSI 180
           F GFPS+AHP+AMLVSAVGALS+FYYSPS VQDLEQCV VSLRMIAKISTI AMIYK+SI
Sbjct: 121 FTGFPSNAHPVAMLVSAVGALSAFYYSPSDVQDLEQCVTVSLRMIAKISTIVAMIYKHSI 180

Query: 181 GQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRL 240
           GQPFV+P+++LDYASNFLHMCFSVPC EY VNPLLARAM+RIFILHADHEQNASTSTVRL
Sbjct: 181 GQPFVFPKNNLDYASNFLHMCFSVPCEEYHVNPLLARAMDRIFILHADHEQNASTSTVRL 240

Query: 241 AGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPFRI 300
           AGSSGADPFACIAAG+ACLGGRAHGGANEEALNML EIGS ERIP YIMRAKDKND FRI
Sbjct: 241 AGSSGADPFACIAAGIACLGGRAHGGANEEALNMLKEIGSPERIPQYIMRAKDKNDSFRI 300

Query: 301 MGFGHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYP 360
           MGFGHR+Y+N+DPRCRIMRETMYEVLE TG  NDPIAQVAIELE+IAL DEYFIERKLYP
Sbjct: 301 MGFGHRIYKNYDPRCRIMRETMYEVLEATGNINDPIAQVAIELEKIALSDEYFIERKLYP 360

Query: 361 NVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVDPSRRIGRPRQLYTGALKR 420
           NVDFYSGITL++LGFPTNLFT LFA+ARTAGWV+QW EMI+DPSRRIGRPRQLYTG++KR
Sbjct: 361 NVDFYSGITLKSLGFPTNLFTALFALARTAGWVAQWKEMIMDPSRRIGRPRQLYTGSVKR 420

Query: 421 DYVPLEER 428
           DYVPLEER
Sbjct: 421 DYVPLEER 428


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325292750|ref|YP_004278614.1| type II citrate synthase [Agrobacterium sp. H13-3] Length = 429 Back     alignment and organism information
>gi|15888718|ref|NP_354399.1| type II citrate synthase [Agrobacterium tumefaciens str. C58] Length = 429 Back     alignment and organism information
>gi|222148890|ref|YP_002549847.1| type II citrate synthase [Agrobacterium vitis S4] Length = 429 Back     alignment and organism information
>gi|328543725|ref|YP_004303834.1| citrate synthase, chromosomal [polymorphum gilvum SL003B-26A1] Length = 430 Back     alignment and organism information
>gi|294852488|ref|ZP_06793161.1| citrate (Si)-synthase [Brucella sp. NVSL 07-0026] Length = 430 Back     alignment and organism information
>gi|148559633|ref|YP_001259067.1| type II citrate synthase [Brucella ovis ATCC 25840] Length = 435 Back     alignment and organism information
>gi|225627616|ref|ZP_03785653.1| citrate synthase I [Brucella ceti str. Cudo] Length = 437 Back     alignment and organism information
>gi|23502026|ref|NP_698153.1| type II citrate synthase [Brucella suis 1330] Length = 430 Back     alignment and organism information
>gi|163843413|ref|YP_001627817.1| type II citrate synthase [Brucella suis ATCC 23445] Length = 430 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target429 type II citrate synthase [Candidatus Liberibacter asiat
PRK05614419 PRK05614, gltA, type II citrate synthase; Reviewed 0.0
TIGR01798412 TIGR01798, cit_synth_I, citrate synthase I (hexameric t 0.0
KOG2617458 KOG2617, KOG2617, KOG2617, Citrate synthase [Energy pro 1e-61
cd06114400 cd06114, EcCS_like, Escherichia coli (Ec) citrate synth 0.0
cd06107382 cd06107, EcCS_AthCS-per_like, Escherichia coli (Ec) cit 1e-145
cd06116384 cd06116, CaCS_like, Chloroflexus aurantiacus (Ca) citra 1e-143
PLN02456455 PLN02456, PLN02456, citrate synthase 1e-141
pfam00285352 pfam00285, Citrate_synt, Citrate synthase 1e-134
cd06115410 cd06115, AthCS_per_like, Arabidopsis thaliana (Ath) per 1e-132
COG0372390 COG0372, GltA, Citrate synthase [Energy production and 1e-131
cd06118358 cd06118, citrate_synt_like_1, Citrate synthase (CS) cat 1e-126
PRK14036377 PRK14036, PRK14036, citrate synthase; Provisional 1e-99
cd06112373 cd06112, citrate_synt_like_1_1, Citrate synthase (CS) c 2e-95
TIGR01800368 TIGR01800, cit_synth_II, 2-methylcitrate synthase/citra 6e-91
cd06110356 cd06110, BSuCS-II_like, Bacillus subtilis (Bs) citrate 3e-84
PRK14037377 PRK14037, PRK14037, citrate synthase; Provisional 7e-73
PRK14035371 PRK14035, PRK14035, citrate synthase; Provisional 9e-70
cd06111362 cd06111, DsCS_like, Cold-active citrate synthase (CS) f 3e-69
PRK14034372 PRK14034, PRK14034, citrate synthase; Provisional 1e-68
PRK14033375 PRK14033, PRK14033, citrate synthase; Provisional 5e-66
cd06109349 cd06109, BsCS-I_like, Bacillus subtilis (Bs) citrate sy 3e-60
cd06108363 cd06108, Ec2MCS_like, Escherichia coli (Ec) 2-methylcit 6e-58
PRK12349369 PRK12349, PRK12349, citrate synthase 3; Provisional 5e-54
PRK12351378 PRK12351, PRK12351, methylcitrate synthase; Provisional 2e-51
PRK14032447 PRK14032, PRK14032, citrate synthase; Provisional 3e-50
cd06117366 cd06117, Ec2MCS_like_1, Subgroup of Escherichia coli (E 7e-48
cd06113406 cd06113, citrate_synt_like_1_2, Citrate synthase (CS) c 6e-46
PRK12350353 PRK12350, PRK12350, citrate synthase 2; Provisional 5e-42
cd06103426 cd06103, ScCS-like, Saccharomyces cerevisiae (Sc) citra 2e-37
PRK09569437 PRK09569, PRK09569, type I citrate synthase; Reviewed 9e-36
cd06105427 cd06105, ScCit1-2_like, Saccharomyces cerevisiae (Sc) c 2e-33
cd06101265 cd06101, citrate_synt, Citrate synthase (CS) catalyzes 1e-77
cd06099213 cd06099, CS_ACL-C_CCL, Citrate synthase (CS), citryl-Co 5e-76
cd06102282 cd06102, citrate_synt_like_2, Citrate synthase (CS) cat 2e-30
cd06100227 cd06100, CCL_ACL-C, Citryl-CoA lyase (CCL), the C-termi 4e-15
PRK06224263 PRK06224, PRK06224, citrate synthase; Provisional 2e-14
TIGR01793427 TIGR01793, cit_synth_euk, citrate (Si)-synthase, eukary 5e-34
cd06106428 cd06106, ScCit3_like, Saccharomyces cerevisiae (Sc) 2-m 1e-27
cd06101265 cd06101, citrate_synt, Citrate synthase (CS) catalyzes 2e-15
PLN02522608 PLN02522, PLN02522, ATP citrate (pro-S)-lyase 6e-04
>gnl|CDD|180164 PRK05614, gltA, type II citrate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|162539 TIGR01798, cit_synth_I, citrate synthase I (hexameric type) Back     alignment and domain information
>gnl|CDD|37828 KOG2617, KOG2617, KOG2617, Citrate synthase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|99867 cd06114, EcCS_like, Escherichia coli (Ec) citrate synthase (CS) GltA_like Back     alignment and domain information
>gnl|CDD|99860 cd06107, EcCS_AthCS-per_like, Escherichia coli (Ec) citrate synthase (CS) gltA and Arabidopsis thaliana (Ath) peroxisomal (Per) CS_like Back     alignment and domain information
>gnl|CDD|99869 cd06116, CaCS_like, Chloroflexus aurantiacus (Ca) citrate synthase (CS)_like Back     alignment and domain information
>gnl|CDD|178075 PLN02456, PLN02456, citrate synthase Back     alignment and domain information
>gnl|CDD|144026 pfam00285, Citrate_synt, Citrate synthase Back     alignment and domain information
>gnl|CDD|99868 cd06115, AthCS_per_like, Arabidopsis thaliana (Ath) peroxisomal (Per) CS_like Back     alignment and domain information
>gnl|CDD|30721 COG0372, GltA, Citrate synthase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|99871 cd06118, citrate_synt_like_1, Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle) Back     alignment and domain information
>gnl|CDD|184469 PRK14036, PRK14036, citrate synthase; Provisional Back     alignment and domain information
>gnl|CDD|99865 cd06112, citrate_synt_like_1_1, Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle) Back     alignment and domain information
>gnl|CDD|130859 TIGR01800, cit_synth_II, 2-methylcitrate synthase/citrate synthase II Back     alignment and domain information
>gnl|CDD|99863 cd06110, BSuCS-II_like, Bacillus subtilis (Bs) citrate synthase (CS)-II_like Back     alignment and domain information
>gnl|CDD|184470 PRK14037, PRK14037, citrate synthase; Provisional Back     alignment and domain information
>gnl|CDD|184468 PRK14035, PRK14035, citrate synthase; Provisional Back     alignment and domain information
>gnl|CDD|99864 cd06111, DsCS_like, Cold-active citrate synthase (CS) from an Antarctic bacterial strain DS2-3R (Ds)-like Back     alignment and domain information
>gnl|CDD|184467 PRK14034, PRK14034, citrate synthase; Provisional Back     alignment and domain information
>gnl|CDD|184466 PRK14033, PRK14033, citrate synthase; Provisional Back     alignment and domain information
>gnl|CDD|99862 cd06109, BsCS-I_like, Bacillus subtilis (Bs) citrate synthase CS-I_like Back     alignment and domain information
>gnl|CDD|99861 cd06108, Ec2MCS_like, Escherichia coli (Ec) 2-methylcitrate synthase (2MCS)_like Back     alignment and domain information
>gnl|CDD|183461 PRK12349, PRK12349, citrate synthase 3; Provisional Back     alignment and domain information
>gnl|CDD|183463 PRK12351, PRK12351, methylcitrate synthase; Provisional Back     alignment and domain information
>gnl|CDD|184465 PRK14032, PRK14032, citrate synthase; Provisional Back     alignment and domain information
>gnl|CDD|99870 cd06117, Ec2MCS_like_1, Subgroup of Escherichia coli (Ec) 2-methylcitrate synthase (2MCS)_like Back     alignment and domain information
>gnl|CDD|99866 cd06113, citrate_synt_like_1_2, Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle) Back     alignment and domain information
>gnl|CDD|183462 PRK12350, PRK12350, citrate synthase 2; Provisional Back     alignment and domain information
>gnl|CDD|99857 cd06103, ScCS-like, Saccharomyces cerevisiae (Sc) citrate synthase (CS)-like Back     alignment and domain information
>gnl|CDD|181961 PRK09569, PRK09569, type I citrate synthase; Reviewed Back     alignment and domain information
>gnl|CDD|99858 cd06105, ScCit1-2_like, Saccharomyces cerevisiae (Sc) citrate synthases Cit1-2_like Back     alignment and domain information
>gnl|CDD|99855 cd06101, citrate_synt, Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle) Back     alignment and domain information
>gnl|CDD|99853 cd06099, CS_ACL-C_CCL, Citrate synthase (CS), citryl-CoA lyase (CCL), the C-terminal portion of the single-subunit type ATP-citrate lyase (ACL) and the C-terminal portion of the large subunit of the two-subunit type ACL Back     alignment and domain information
>gnl|CDD|99856 cd06102, citrate_synt_like_2, Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle) Back     alignment and domain information
>gnl|CDD|99854 cd06100, CCL_ACL-C, Citryl-CoA lyase (CCL), the C-terminal portion of the single-subunit type ATP-citrate lyase (ACL) and the C-terminal portion of the large subunit of the two-subunit type ACL Back     alignment and domain information
>gnl|CDD|180478 PRK06224, PRK06224, citrate synthase; Provisional Back     alignment and domain information
>gnl|CDD|130853 TIGR01793, cit_synth_euk, citrate (Si)-synthase, eukaryotic Back     alignment and domain information
>gnl|CDD|99859 cd06106, ScCit3_like, Saccharomyces cerevisiae (Sc) 2-methylcitrate synthase Cit3-like Back     alignment and domain information
>gnl|CDD|99855 cd06101, citrate_synt, Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle) Back     alignment and domain information
>gnl|CDD|178137 PLN02522, PLN02522, ATP citrate (pro-S)-lyase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 429 type II citrate synthase [Candidatus Liberibacter asiat
PRK05614414 gltA type II citrate synthase; Reviewed 100.0
cd06114400 EcCS_like Escherichia coli (Ec) citrate synthase (CS) G 100.0
cd06115410 AthCS_per_like Arabidopsis thaliana (Ath) peroxisomal ( 100.0
COG0372390 GltA Citrate synthase [Energy production and conversion 100.0
cd06103426 ScCS-like Saccharomyces cerevisiae (Sc) citrate synthas 100.0
TIGR01798413 cit_synth_I citrate synthase I; InterPro: IPR010953 Cit 100.0
KOG2617458 consensus 100.0
TIGR01800386 cit_synth_II 2-methylcitrate synthase/citrate synthase 100.0
cd06116384 CaCS_like Chloroflexus aurantiacus (Ca) citrate synthas 100.0
cd06107382 EcCS_AthCS-per_like Escherichia coli (Ec) citrate synth 100.0
PRK12351377 methylcitrate synthase; Provisional 100.0
cd06112373 citrate_synt_like_1_1 Citrate synthase (CS) catalyzes t 100.0
PRK12349365 citrate synthase 3; Provisional 100.0
cd06111362 DsCS_like Cold-active citrate synthase (CS) from an Ant 100.0
cd06113406 citrate_synt_like_1_2 Citrate synthase (CS) catalyzes t 100.0
cd06110356 BSuCS-II_like Bacillus subtilis (Bs) citrate synthase ( 100.0
cd06117366 Ec2MCS_like_1 Subgroup of Escherichia coli (Ec) 2-methy 100.0
cd06105427 ScCit1-2_like Saccharomyces cerevisiae (Sc) citrate syn 100.0
cd06108363 Ec2MCS_like Escherichia coli (Ec) 2-methylcitrate synth 100.0
pfam00285352 Citrate_synt Citrate synthase. 100.0
cd06118358 citrate_synt_like_1 Citrate synthase (CS) catalyzes the 100.0
cd06109349 BsCS-I_like Bacillus subtilis (Bs) citrate synthase CS- 100.0
PRK09569437 type I citrate synthase; Reviewed 100.0
PRK12350352 citrate synthase 2; Provisional 100.0
cd06106428 ScCit3_like Saccharomyces cerevisiae (Sc) 2-methylcitra 100.0
cd06101265 citrate_synt Citrate synthase (CS) catalyzes the conden 100.0
cd06102282 citrate_synt_like_2 Citrate synthase (CS) catalyzes the 100.0
TIGR01793430 cit_synth_euk citrate (Si)-synthase, eukaryotic; InterP 100.0
PRK06224265 citrate synthase; Provisional 100.0
cd06099213 CS_ACL-C_CCL Citrate synthase (CS), citryl-CoA lyase (C 100.0
cd06100227 CCL_ACL-C Citryl-CoA lyase (CCL), the C-terminal portio 100.0
KOG1254600 consensus 99.48
cd06100227 CCL_ACL-C Citryl-CoA lyase (CCL), the C-terminal portio 97.65
>PRK05614 gltA type II citrate synthase; Reviewed Back     alignment and domain information
>cd06114 EcCS_like Escherichia coli (Ec) citrate synthase (CS) GltA_like Back     alignment and domain information
>cd06115 AthCS_per_like Arabidopsis thaliana (Ath) peroxisomal (Per) CS_like Back     alignment and domain information
>COG0372 GltA Citrate synthase [Energy production and conversion] Back     alignment and domain information
>cd06103 ScCS-like Saccharomyces cerevisiae (Sc) citrate synthase (CS)-like Back     alignment and domain information
>TIGR01798 cit_synth_I citrate synthase I; InterPro: IPR010953 Citrate synthase 2 Back     alignment and domain information
>KOG2617 consensus Back     alignment and domain information
>TIGR01800 cit_synth_II 2-methylcitrate synthase/citrate synthase II; InterPro: IPR011278 Citrate synthase 2 Back     alignment and domain information
>cd06116 CaCS_like Chloroflexus aurantiacus (Ca) citrate synthase (CS)_like Back     alignment and domain information
>cd06107 EcCS_AthCS-per_like Escherichia coli (Ec) citrate synthase (CS) gltA and Arabidopsis thaliana (Ath) peroxisomal (Per) CS_like Back     alignment and domain information
>PRK12351 methylcitrate synthase; Provisional Back     alignment and domain information
>cd06112 citrate_synt_like_1_1 Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle) Back     alignment and domain information
>PRK12349 citrate synthase 3; Provisional Back     alignment and domain information
>cd06111 DsCS_like Cold-active citrate synthase (CS) from an Antarctic bacterial strain DS2-3R (Ds)-like Back     alignment and domain information
>cd06113 citrate_synt_like_1_2 Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle) Back     alignment and domain information
>cd06110 BSuCS-II_like Bacillus subtilis (Bs) citrate synthase (CS)-II_like Back     alignment and domain information
>cd06117 Ec2MCS_like_1 Subgroup of Escherichia coli (Ec) 2-methylcitrate synthase (2MCS)_like Back     alignment and domain information
>cd06105 ScCit1-2_like Saccharomyces cerevisiae (Sc) citrate synthases Cit1-2_like Back     alignment and domain information
>cd06108 Ec2MCS_like Escherichia coli (Ec) 2-methylcitrate synthase (2MCS)_like Back     alignment and domain information
>pfam00285 Citrate_synt Citrate synthase Back     alignment and domain information
>cd06118 citrate_synt_like_1 Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle) Back     alignment and domain information
>cd06109 BsCS-I_like Bacillus subtilis (Bs) citrate synthase CS-I_like Back     alignment and domain information
>PRK09569 type I citrate synthase; Reviewed Back     alignment and domain information
>PRK12350 citrate synthase 2; Provisional Back     alignment and domain information
>cd06106 ScCit3_like Saccharomyces cerevisiae (Sc) 2-methylcitrate synthase Cit3-like Back     alignment and domain information
>cd06101 citrate_synt Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle) Back     alignment and domain information
>cd06102 citrate_synt_like_2 Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle) Back     alignment and domain information
>TIGR01793 cit_synth_euk citrate (Si)-synthase, eukaryotic; InterPro: IPR010109 Citrate synthase 2 Back     alignment and domain information
>PRK06224 citrate synthase; Provisional Back     alignment and domain information
>cd06099 CS_ACL-C_CCL Citrate synthase (CS), citryl-CoA lyase (CCL), the C-terminal portion of the single-subunit type ATP-citrate lyase (ACL) and the C-terminal portion of the large subunit of the two-subunit type ACL Back     alignment and domain information
>cd06100 CCL_ACL-C Citryl-CoA lyase (CCL), the C-terminal portion of the single-subunit type ATP-citrate lyase (ACL) and the C-terminal portion of the large subunit of the two-subunit type ACL Back     alignment and domain information
>KOG1254 consensus Back     alignment and domain information
>cd06100 CCL_ACL-C Citryl-CoA lyase (CCL), the C-terminal portion of the single-subunit type ATP-citrate lyase (ACL) and the C-terminal portion of the large subunit of the two-subunit type ACL Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target429 type II citrate synthase [Candidatus Liberibacter asiat
2h12_A436 Structure Of Acetobacter Aceti Citrate Synthase Com 1e-143
3l96_A426 Structural Determination Of The A50t:s279g:s280k:v2 1e-137
1owb_A427 Three Dimensional Structure Analysis Of The Variant 1e-137
1k3p_A426 Three Dimensional Structure Analysis Of The Type Ii 1e-136
1nxe_A427 A Novel Nadh Allosteric Regulator Site Is Found On 1e-135
3msu_A427 Crystal Structure Of Citrate Synthase From Francise 1e-121
1vgp_A373 Crystal Structure Of An Isozyme Of Citrate Synthase 6e-94
2ibp_A409 Crystal Structure Of Citrate Synthase From Pyrobacu 3e-93
1iom_A377 Crystal Structure Of Citrate Synthase From Thermus 9e-92
2p2w_A367 Crystal Structure Of Citrate Synthase From Thermoto 3e-90
1aj8_A371 Citrate Synthase From Pyrococcus Furiosus Length = 1e-88
1o7x_A377 Citrate Synthase From Sulfolobus Solfataricus Lengt 5e-88
1vgm_A378 Crystal Structure Of An Isozyme Of Citrate Synthase 9e-87
3o8j_A404 Crystal Structure Of 2-Methylcitrate Synthase (Prpc 2e-85
2c6x_A363 Structure Of Bacillus Subtilis Citrate Synthase Len 1e-82
1a59_A378 Cold-Active Citrate Synthase Length = 378 6e-78
3hwk_A414 Crystal Structure Of Methylcitrate Synthase From My 3e-76
2r26_A384 The Structure Of The Ternary Complex Of Carboxymeth 2e-72
2ifc_A385 The Structure Of The Binary Complex Of Oxalateaceta 2e-72
4cts_A437 Crystal Structure Analysis And Molecular Model Of A 6e-43
2cts_A437 Crystallographic Refinement And Atomic Models Of Tw 7e-43
6csc_A437 Chicken Citrate Synthase Complex With Trifluoroacet 4e-42
1amz_A435 Chicken Citrate Synthase Complex With Nitromethylde 4e-42
1csc_A433 Structure Of Ternary Complexes Of Citrate Synthase 2e-38
5csc_B429 Structure Of An Open Form Of Chicken Heart Citrate 6e-38
>gi|116667519|pdb|2H12|A Chain A, Structure Of Acetobacter Aceti Citrate Synthase Complexed With Oxaloacetate And Carboxymethyldethia Coenzyme A (Cmx) Length = 436 Back     alignment and structure
 Score =  512 bits (1319), Expect = e-143,   Method: Composition-based stats.
 Identities = 246/425 (57%), Positives = 314/425 (73%), Gaps = 1/425 (0%)

Query: 5   FAKLHLGHEEIDLPIKEGSLGSSVLDISFLHKN-GIFTYDPAFSSTASCKSKITFIDGNN 63
            A + +  +  ++P+  G+LG  V+DI  L    G+FT+DP +  TA+C SKITFIDG+ 
Sbjct: 12  TATISVDGKSAEMPVLSGTLGPDVIDIRKLPAQLGVFTFDPGYGETAACNSKITFIDGDK 71

Query: 64  GILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRFFMG 123
           G+LL+RGYPI QL+E + + EV YLLL+GEL N +Q   F + ++ H LL+E +  FF G
Sbjct: 72  GVLLHRGYPIAQLAENASYEEVIYLLLNGELPNKAQYDTFTNTLTNHTLLHEQIRNFFNG 131

Query: 124 FPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKYSIGQP 183
           F   AHPMA+L   VGALS+FY   + +         ++R+IAKI TIAA  YKY+ G+ 
Sbjct: 132 FRRDAHPMAILCGTVGALSAFYPDANDIAIPANRDLAAMRLIAKIPTIAAWAYKYTQGEA 191

Query: 184 FVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRLAGS 243
           F+YPR+DL+YA NFL M F+     Y+VNP+LARAMNRI ILHADHEQNASTSTVRLAGS
Sbjct: 192 FIYPRNDLNYAENFLSMMFARMSEPYKVNPVLARAMNRILILHADHEQNASTSTVRLAGS 251

Query: 244 SGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPFRIMGF 303
           +GA+PFACIAAG+A L G AHGGANE  L ML  IG  E IP +I + KDKN   ++MGF
Sbjct: 252 TGANPFACIAAGIAALWGPAHGGANEAVLKMLARIGKKENIPAFIAQVKDKNSGVKLMGF 311

Query: 304 GHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYPNVD 363
           GHRVY+N DPR +IM++T +EVL   G  +DP+  +A+ELE+IAL D+YF++RKLYPNVD
Sbjct: 312 GHRVYKNFDPRAKIMQQTCHEVLTELGIKDDPLLDLAVELEKIALSDDYFVQRKLYPNVD 371

Query: 364 FYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVDPSRRIGRPRQLYTGALKRDYV 423
           FYSGI L+A+G PT++FTVLFAVART GWVSQW EMI +P +RI RPRQLY GA +RDYV
Sbjct: 372 FYSGIILKAMGIPTSMFTVLFAVARTTGWVSQWKEMIEEPGQRISRPRQLYIGAPQRDYV 431

Query: 424 PLEER 428
           PL +R
Sbjct: 432 PLAKR 436


>gi|323462849|pdb|3L96|A Chain A, Structural Determination Of The A50t:s279g:s280k:v281k:k282e:h283n Variant Of Citrate Synthase From E. Coli Length = 426 Back     alignment and structure
>gi|49258390|pdb|1OWB|A Chain A, Three Dimensional Structure Analysis Of The Variant R109l Nadh Complex Of Type Ii Citrate Synthase From E. Coli Length = 427 Back     alignment and structure
>gi|24987421|pdb|1K3P|A Chain A, Three Dimensional Structure Analysis Of The Type Ii Citrate From E.Coli Length = 426 Back     alignment and structure
>gi|30749778|pdb|1NXE|A Chain A, A Novel Nadh Allosteric Regulator Site Is Found On The Surfa Hexameric Type Ii Phe383ala Variant Of Citrate Synthase Length = 427 Back     alignment and structure
>gi|296863704|pdb|3MSU|A Chain A, Crystal Structure Of Citrate Synthase From Francisella Tular Length = 427 Back     alignment and structure
gi|71041782|pdb|1VGP|A Chain A, Crystal Structure Of An Isozyme Of Citrate Synthase From Sulfolbus Tokodaii Strain7 Length = 373 Back     alignment and structure
gi|149242144|pdb|2IBP|A Chain A, Crystal Structure Of Citrate Synthase From Pyrobaculum Aerophilum Length = 409 Back     alignment and structure
gi|34810916|pdb|1IOM|A Chain A, Crystal Structure Of Citrate Synthase From Thermus Thermophilus Hb8 Length = 377 Back     alignment and structure
gi|158429285|pdb|2P2W|A Chain A, Crystal Structure Of Citrate Synthase From Thermotoga Maritima Msb8 Length = 367 Back     alignment and structure
>gi|2781319|pdb|1AJ8|A Chain A, Citrate Synthase From Pyrococcus Furiosus Length = 371 Back     alignment and structure
gi|27574267|pdb|1O7X|A Chain A, Citrate Synthase From Sulfolobus Solfataricus Length = 377 Back     alignment and structure
gi|71041778|pdb|1VGM|A Chain A, Crystal Structure Of An Isozyme Of Citrate Synthase From Sulfolbus Tokodaii Strain7 Length = 378 Back     alignment and structure
>gi|328877240|pdb|3O8J|A Chain A, Crystal Structure Of 2-Methylcitrate Synthase (Prpc) From Salmonella Typhimurium Length = 404 Back     alignment and structure
>gi|151566456|pdb|2C6X|A Chain A, Structure Of Bacillus Subtilis Citrate Synthase Length = 363 Back     alignment and structure
>gi|157829689|pdb|1A59|A Chain A, Cold-Active Citrate Synthase Length = 378 Back     alignment and structure
>gi|242556780|pdb|3HWK|A Chain A, Crystal Structure Of Methylcitrate Synthase From Mycobacterium Tuberculosis Length = 414 Back     alignment and structure
>gi|196049624|pdb|2R26|A Chain A, The Structure Of The Ternary Complex Of Carboxymethyl Coenzyme A And Oxalateacetate With Citrate Synthase From The Thermophilic Archaeonthermoplasma Acidophilum Length = 384 Back     alignment and structure
gi|158428760|pdb|2IFC|A Chain A, The Structure Of The Binary Complex Of Oxalateacetate With Citrate Synthase From The Thermophilic Archaeon Thermolasma Acidophilum Length = 385 Back     alignment and structure
>gi|230993|pdb|4CTS|A Chain A, Crystal Structure Analysis And Molecular Model Of A Complex Of Citrate Synthase With Oxaloacetate And S-Acetonyl- Coenzyme A Length = 437 Back     alignment and structure
>gi|157834775|pdb|2CTS|A Chain A, Crystallographic Refinement And Atomic Models Of Two Different Forms Of Citrate Synthase At 2.7 And 1.7 Angstroms Resolution Length = 437 Back     alignment and structure
>gi|2780941|pdb|6CSC|A Chain A, Chicken Citrate Synthase Complex With Trifluoroacetonyl-Coa And Citrate Length = 437 Back     alignment and structure
>gi|157829977|pdb|1AMZ|A Chain A, Chicken Citrate Synthase Complex With Nitromethylde-Coa And Malate Length = 435 Back     alignment and structure
gi|157830700|pdb|1CSC|A Chain A, Structure Of Ternary Complexes Of Citrate Synthase With D- And L-Malate: Mechanistic Implications Length = 433 Back     alignment and structure
>gi|157884315|pdb|5CSC|B Chain B, Structure Of An Open Form Of Chicken Heart Citrate Synthase At 2.8 Angstroms Resolution Length = 429 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target429 type II citrate synthase [Candidatus Liberibacter asiat
3msu_A427 Citrate synthase; helix bundle, APHA-beta fold, csgid, 1e-139
1k3p_A426 Type II citrate synthase; lyase; 2.20A {Escherichia col 1e-139
2h12_A436 Citrate synthase; acidophIle, acetic acid resistance, a 1e-128
1iom_A377 Citrate synthase; open form, riken structural genomics/ 1e-109
1o7x_A377 Citrate synthase; lyase, tricarboxylic acid cycle; 2.7A 1e-107
3hwk_A414 Methylcitrate synthase; niaid, ssgcid, structural genom 1e-107
2ibp_A409 Citrate synthase; disulfide bond, homodimer, thermophil 7e-97
1vgp_A373 373AA long hypothetical citrate synthase; open form, tr 6e-95
1aj8_A371 Citrate synthase; hyperthermostable, lyase; HET: COA CI 9e-86
2p2w_A367 Citrate synthase; transferase, structural genomics, NPP 2e-82
1csh_A435 Citrate synthase; lyase(OXO-acid); HET: AMX; 1.65A {Gal 3e-82
2ifc_A385 Citrate synthase; oxaloacetate, EC 2.3.3.1, transferase 8e-82
1vgm_A378 378AA long hypothetical citrate synthase; open form, tr 8e-82
1a59_A378 Citrate synthase; cold-activity; HET: COA CIT; 2.09A {A 3e-79
2c6x_A363 Citrate synthase 1; tricarboxylic acid cycle, transfera 6e-79
>3msu_A Citrate synthase; helix bundle, APHA-beta fold, csgid, center for structural G of infectious diseases, transferase; HET: OAA; 1.84A {Francisella tularensis} Length = 427 Back     alignment and structure
 Score =  491 bits (1266), Expect = e-139
 Identities = 213/424 (50%), Positives = 295/424 (69%), Gaps = 6/424 (1%)

Query: 1   MTDKFAKLHLGHE--EIDLPIKEGSLGSSVLDISFLHKNGIFTYDPAFSSTASCKSKITF 58
           +  K+A L    +  EI+LP+   SLG+  +D+S L K+GIFTYDP F STA+C+SKIT+
Sbjct: 8   LMSKYATLKYADKNIEIELPVYSPSLGNDCIDVSSLVKHGIFTYDPGFMSTAACESKITY 67

Query: 59  IDGNNGILLYRGYPIEQLSEKSDFLEVCYLLLHGELANVSQQKDFNDKISRHALLNENMS 118
           IDG  G+LL+RGYPIE+ ++KS++  +CY L++GEL    Q K F  +I     + E++ 
Sbjct: 68  IDGGKGVLLHRGYPIEEWTQKSNYRTLCYALIYGELPTDEQVKSFRQEIINKMPVCEHVK 127

Query: 119 RFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSLRMIAKISTIAAMIYKY 178
                 P   HPM+ L++ V  L++ +         E    V+  ++AKI+TIAAM Y++
Sbjct: 128 AAIAAMPQHTHPMSSLIAGVNVLAAEHIHNG---QKESQDEVAKNIVAKIATIAAMAYRH 184

Query: 179 SIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTV 238
           + G+ F+ P+ +  YA NFL+M F+     Y+ + L  +AM+ IF+LHADHEQNASTSTV
Sbjct: 185 NHGKKFLEPKMEYGYAENFLYMMFA-DDESYKPDELHIKAMDTIFMLHADHEQNASTSTV 243

Query: 239 RLAGSSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPF 298
           RL+GS+G  P+A I AG+  L G AHGGANE  L ML EIGS E I  YI +AKDK+DPF
Sbjct: 244 RLSGSTGNSPYAAIIAGITALWGPAHGGANEAVLKMLSEIGSTENIDKYIAKAKDKDDPF 303

Query: 299 RIMGFGHRVYRNHDPRCRIMRETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKL 358
           R+MGFGHRVY+N DPR   M++   E+L   G  ++P+  VA +LE IAL+DE+FIERKL
Sbjct: 304 RLMGFGHRVYKNTDPRATAMKKNCEEILAKLGHSDNPLLTVAKKLEEIALQDEFFIERKL 363

Query: 359 YPNVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVDPSRRIGRPRQLYTGAL 418
           + NVDFYSGI L+A+G P ++FT +FA+ART+GW+SQW EM+ DP+++IGRPRQLYTGA 
Sbjct: 364 FSNVDFYSGIILKAMGIPEDMFTAIFALARTSGWISQWIEMVNDPAQKIGRPRQLYTGAT 423

Query: 419 KRDY 422
            R++
Sbjct: 424 NRNF 427


>1k3p_A Type II citrate synthase; lyase; 2.20A {Escherichia coli} SCOP: a.103.1.1 PDB: 1owb_A* 1owc_A 1nxe_A 1nxg_A* Length = 426 Back     alignment and structure
>2h12_A Citrate synthase; acidophIle, acetic acid resistance, allostery, transferase; HET: CMX; 1.85A {Acetobacter aceti} Length = 436 Back     alignment and structure
>1iom_A Citrate synthase; open form, riken structural genomics/proteomics initiative, RSGI, structural genomics, lyase; 1.50A {Thermus thermophilus HB8} SCOP: a.103.1.1 PDB: 1ixe_A* Length = 377 Back     alignment and structure
>1o7x_A Citrate synthase; lyase, tricarboxylic acid cycle; 2.7A {Sulfolobus solfataricus} SCOP: a.103.1.1 Length = 377 Back     alignment and structure
>3hwk_A Methylcitrate synthase; niaid, ssgcid, structural genomics, seattle structural genomics center for infectious disease, tubercluosis; 2.30A {Mycobacterium tuberculosis} Length = 414 Back     alignment and structure
>2ibp_A Citrate synthase; disulfide bond, homodimer, thermophilic, catenane, transferase; 1.60A {Pyrobaculum aerophilum str} Length = 409 Back     alignment and structure
>1vgp_A 373AA long hypothetical citrate synthase; open form, transferase; 2.70A {Sulfolobus tokodaii} Length = 373 Back     alignment and structure
>1aj8_A Citrate synthase; hyperthermostable, lyase; HET: COA CIT; 1.90A {Pyrococcus furiosus} SCOP: a.103.1.1 Length = 371 Back     alignment and structure
>2p2w_A Citrate synthase; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: FLC; 1.90A {Thermotoga maritima} Length = 367 Back     alignment and structure
>1csh_A Citrate synthase; lyase(OXO-acid); HET: AMX; 1.65A {Gallus gallus} SCOP: a.103.1.1 PDB: 1amz_A* 1csi_A* 1csr_A* 1css_A* 1al6_A* 6csc_A* 2cts_A* 3enj_A 1cts_A 4cts_A 1csc_A* 2csc_A* 3csc_A* 4csc_A* 5csc_A 5cts_A* 6cts_A* 5csc_B Length = 435 Back     alignment and structure
>2ifc_A Citrate synthase; oxaloacetate, EC 2.3.3.1, transferase; 1.70A {Thermoplasma acidophilum} PDB: 2r9e_A* 2r26_A* Length = 385 Back     alignment and structure
>1vgm_A 378AA long hypothetical citrate synthase; open form, transferase; 2.00A {Sulfolobus tokodaii} Length = 378 Back     alignment and structure
>1a59_A Citrate synthase; cold-activity; HET: COA CIT; 2.09A {Antarctic bacterium ds2-3r} SCOP: a.103.1.1 Length = 378 Back     alignment and structure
>2c6x_A Citrate synthase 1; tricarboxylic acid cycle, transferase, allosteric enzyme, enzyme thermostability; HET: COZ CIT; 3.4A {Bacillus subtilis} Length = 363 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target429 type II citrate synthase [Candidatus Liberibacter asiat
2h12_A436 Citrate synthase; acidophIle, acetic acid resistance, a 100.0
3msu_A427 Citrate synthase; helix bundle, APHA-beta fold, csgid, 100.0
1k3p_A426 Citrate synthase; transferase; 2.20A {Escherichia coli} 100.0
2ibp_A409 Citrate synthase; disulfide bond, homodimer, thermophil 100.0
3hwk_A414 Methylcitrate synthase; niaid, ssgcid, structural genom 100.0
1csh_A435 Citrate synthase; lyase(OXO-acid); HET: AMX; 1.65A {Gal 100.0
1iom_A377 Citrate synthase; open form, riken structural genomics/ 100.0
1vgp_A373 373AA long hypothetical citrate synthase; open form, tr 100.0
2ifc_A385 Citrate synthase; oxaloacetate, EC 2.3.3.1, transferase 100.0
1aj8_A371 Citrate synthase; hyperthermostable, lyase; HET: COA CI 100.0
1o7x_A377 Citrate synthase; lyase, tricarboxylic acid cycle; 2.7A 100.0
2c6x_A363 Citrate synthase 1; tricarboxylic acid cycle, transfera 100.0
1vgm_A378 378AA long hypothetical citrate synthase; open form, tr 100.0
1a59_A378 Citrate synthase; cold-activity; HET: COA CIT; 2.09A {A 100.0
2p2w_A367 Citrate synthase; transferase, structural genomics, NPP 100.0
>2h12_A Citrate synthase; acidophIle, acetic acid resistance, allostery, transferase; HET: CMX; 1.85A {Acetobacter aceti} Back     alignment and structure
Probab=100.00  E-value=0  Score=1082.44  Aligned_cols=425  Identities=58%  Similarity=0.990  Sum_probs=415.1

Q ss_pred             CEEEEEECCEEEEEEEECCCCCCCCEEECCCC-CCCEEEECCCCCCEEEEEEEEEEEECCCCEEEECCEEHHHHHHHCCH
Q ss_conf             76999989989997523077787510100115-58618988887862387875654334477789899319999750898
Q gi|254780355|r    4 KFAKLHLGHEEIDLPIKEGSLGSSVLDISFLH-KNGIFTYDPAFSSTASCKSKITFIDGNNGILLYRGYPIEQLSEKSDF   82 (429)
Q Consensus         4 ~~~~l~~~~~~~~lpi~~~~~~~~~~d~~~l~-~~G~~~~dpG~~~ta~ceS~IT~IDG~~G~L~YRGY~IedLa~~~sF   82 (429)
                      +++||++|||+|||||++||+|+++|||++|+ ++|++||||||.||++|||+||||||++|+|+||||||+|||++++|
T Consensus        11 ~~~~~~~~g~~~~~pi~~~~~~~~~~d~~~~~~~~G~~~~dpG~~~t~~~eS~IT~IDG~~G~L~YRGy~I~dLa~~~sF   90 (436)
T 2h12_A           11 STATISVDGKSAEMPVLSGTLGPDVIDIRKLPAQLGVFTFDPGYGETAACNSKITFIDGDKGVLLHRGYPIAQLAENASY   90 (436)
T ss_dssp             CEEEEEETTEEEEEEEECCSBSCCEEECTTHHHHHSCEEECTTCTTEEEEEESSEEEETTTTEEEETTEEHHHHHHHCCH
T ss_pred             EEEEEEECCEEEEEEEEECCCCCCEEEEHHHHCCCCCEEECCCCCCCCEEEEEEEEEECCCCEEEECCEEHHHHHHCCCH
T ss_conf             26999779979995455478898535501000248948868887872147776436847864799999459998705999


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHH
Q ss_conf             99999998187999899999999886406899899999985124765257899999998752068557678788988899
Q gi|254780355|r   83 LEVCYLLLHGELANVSQQKDFNDKISRHALLNENMSRFFMGFPSSAHPMAMLVSAVGALSSFYYSPSGVQDLEQCVNVSL  162 (429)
Q Consensus        83 eEVayLLl~GeLPt~~el~~F~~~l~~~~~lpe~v~~~i~~~p~~ahPM~~L~~~vsaL~a~~~~~~~~~d~~~~~~~a~  162 (429)
                      ||||||||+|+|||++|+++|+.+|.+++.+|+.+.+++++||+++|||++|+++|++|++++++..+..+++.....++
T Consensus        91 EEVayLLl~G~LPt~~el~~f~~~l~~~~~lp~~~~~~i~~~p~~ahPM~~L~~~vsal~~~~p~~~~~~~~~~~~~~a~  170 (436)
T 2h12_A           91 EEVIYLLLNGELPNKAQYDTFTNTLTNHTLLHEQIRNFFNGFRRDAHPMAILCGTVGALSAFYPDANDIAIPANRDLAAM  170 (436)
T ss_dssp             HHHHHHHHHSSCCCHHHHHHHHHHHHTTCSCCGGGHHHHTTSCTTCCHHHHHHHHHHHHGGGCC--------CCHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
T ss_conf             99999997287997677767899988603355999999973786678278999999987720985422357688999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHEECCCCCCCHHHHHHHHH
Q ss_conf             99999999999999972798534888642468877876428984101479699999875635013678763015555442
Q gi|254780355|r  163 RMIAKISTIAAMIYKYSIGQPFVYPRSDLDYASNFLHMCFSVPCAEYQVNPLLARAMNRIFILHADHEQNASTSTVRLAG  242 (429)
Q Consensus       163 rLiA~~p~i~A~~yr~~~G~~~i~Pd~~lsyaeNfL~Ml~~~~~~~~~~~~~~~~ald~~LILhADHe~NaSTft~R~va  242 (429)
                      |++|++|+|+|++||++.|+++++|+++++|++|||+|+++.+...++++|..+|+||++||||||||+||||||+||++
T Consensus       171 rliA~~p~i~a~~y~~~~g~~~~~p~~~l~~a~nfl~m~~~~~~~~~~~~~~~~~~ld~~LILhADHe~NaSTfaaRvva  250 (436)
T 2h12_A          171 RLIAKIPTIAAWAYKYTQGEAFIYPRNDLNYAENFLSMMFARMSEPYKVNPVLARAMNRILILHADHEQNASTSTVRLAG  250 (436)
T ss_dssp             HHHHHHHHHHHHHHHHHHTCCCCCCCTTSCHHHHHHHHHHCBTTBCCCCCHHHHHHHHHHHHHHSCCSSCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             99999999999999986799877798775678889987405887656657689999999999971256641599999998


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCEEECCCCCCCCCCCHHHHHHHHHH
Q ss_conf             05654246776755421002220352899999862155351279999998214786143027743555540346899999
Q gi|254780355|r  243 SSGADPFACIAAGVACLGGRAHGGANEEALNMLMEIGSLERIPHYIMRAKDKNDPFRIMGFGHRVYRNHDPRCRIMRETM  322 (429)
Q Consensus       243 St~adlysai~agi~aL~GPlHGGAne~v~~ml~~I~~~~~v~~~i~~~~~~~~~~ri~GfGHrvyk~~DPRa~~l~~~~  322 (429)
                      ||++|+|+||+|||+|||||+||||||+|++||++|+++++++.|+...+.++++.|||||||||||++||||++|+++|
T Consensus       251 ST~ad~ysavsAgi~aL~GPlHGGAne~v~~ml~ei~~~~~~~~~i~~~~~~~~~~~l~GFGHrvYk~~DPRa~~l~~~~  330 (436)
T 2h12_A          251 STGANPFACIAAGIAALWGPAHGGANEAVLKMLARIGKKENIPAFIAQVKDKNSGVKLMGFGHRVYKNFDPRAKIMQQTC  330 (436)
T ss_dssp             TTTCCHHHHHHHHHHHHHSTTTTTHHHHHHHHHHHHCSGGGHHHHHHHHHCTTSCCCCTTBCCSSCSSCCHHHHHHHHHH
T ss_pred             HCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             22798157899999863797667669999999998478330699999998652287466778776888894189999999


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             99888608776517999999999996115314579877844788999998499966858999999998999999999707
Q gi|254780355|r  323 YEVLEVTGRFNDPIAQVAIELERIALEDEYFIERKLYPNVDFYSGITLRALGFPTNLFTVLFAVARTAGWVSQWTEMIVD  402 (429)
Q Consensus       323 ~~l~~~~~~~~~~~~~~a~~le~~a~~d~~~~~r~l~pNvDfysg~i~~~lGip~~~ft~iFa~~R~~Gw~AH~~Eq~~~  402 (429)
                      +++.++.+..++++++++.++|++++++++|++|+||||||||+|++|++||||++|||+||++||++||+|||+||+++
T Consensus       331 ~~l~~~~~~~~~~l~~ia~~le~~~~~~~~~~~r~l~PNVDfy~~~l~~~lG~p~~~~t~lFa~~R~~Gw~AH~~Eq~~~  410 (436)
T 2h12_A          331 HEVLTELGIKDDPLLDLAVELEKIALSDDYFVQRKLYPNVDFYSGIILKAMGIPTSMFTVLFAVARTTGWVSQWKEMIEE  410 (436)
T ss_dssp             HHHHHHTTCCCCHHHHHHHHHHHHHHHSHHHHHTTCCBCTHHHHHHHHHHTTCCGGGHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99998708874189999999999998887524589876748899999998196945400899999999999999999708


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCHHHC
Q ss_conf             89830045621058876870685542
Q gi|254780355|r  403 PSRRIGRPRQLYTGALKRDYVPLEER  428 (429)
Q Consensus       403 ~~~ri~RP~~~Y~G~~~r~y~pi~~R  428 (429)
                      +.+||+||||+|||+.+|+||||++|
T Consensus       411 ~~~ri~RPr~~Y~G~~~r~y~pi~~R  436 (436)
T 2h12_A          411 PGQRISRPRQLYIGAPQRDYVPLAKR  436 (436)
T ss_dssp             TTCCCCCCEEEECSCCCCCCCCGGGC
T ss_pred             CCCCEECCCCCCCCCCCCCCCCCCCC
T ss_conf             78962375631169999998780019



>3msu_A Citrate synthase; helix bundle, APHA-beta fold, csgid, center for structural G of infectious diseases, transferase; HET: OAA; 1.84A {Francisella tularensis} Back     alignment and structure
>1k3p_A Citrate synthase; transferase; 2.20A {Escherichia coli} SCOP: a.103.1.1 PDB: 1owb_A* 1owc_A 1nxe_A 1nxg_A* Back     alignment and structure
>2ibp_A Citrate synthase; disulfide bond, homodimer, thermophilic, catenane, transferase; 1.60A {Pyrobaculum aerophilum str} Back     alignment and structure
>3hwk_A Methylcitrate synthase; niaid, ssgcid, structural genomics, seattle structural genomics center for infectious disease, tubercluosis; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1csh_A Citrate synthase; lyase(OXO-acid); HET: AMX; 1.65A {Gallus gallus} SCOP: a.103.1.1 PDB: 1amz_A* 1csi_A* 1csr_A* 1css_A* 1al6_A* 6csc_A* 2cts_A* 3enj_A 1cts_A 4cts_A 1csc_A* 2csc_A* 3csc_A* 4csc_A* 5csc_A 5cts_A* 6cts_A* 5csc_B Back     alignment and structure
>1iom_A Citrate synthase; open form, riken structural genomics/proteomics initiative, RSGI, structural genomics, lyase; 1.50A {Thermus thermophilus HB8} SCOP: a.103.1.1 PDB: 1ixe_A* Back     alignment and structure
>1vgp_A 373AA long hypothetical citrate synthase; open form, transferase; 2.70A {Sulfolobus tokodaii} Back     alignment and structure
>2ifc_A Citrate synthase; oxaloacetate, EC 2.3.3.1, transferase; 1.70A {Thermoplasma acidophilum} PDB: 2r9e_A* 2r26_A* Back     alignment and structure
>1aj8_A Citrate synthase; hyperthermostable, lyase; HET: COA CIT; 1.90A {Pyrococcus furiosus} SCOP: a.103.1.1 Back     alignment and structure
>1o7x_A Citrate synthase; lyase, tricarboxylic acid cycle; 2.7A {Sulfolobus solfataricus} SCOP: a.103.1.1 Back     alignment and structure
>2c6x_A Citrate synthase 1; tricarboxylic acid cycle, transferase, allosteric enzyme, enzyme thermostability; HET: COZ CIT; 3.4A {Bacillus subtilis} Back     alignment and structure
>1vgm_A 378AA long hypothetical citrate synthase; open form, transferase; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1a59_A Citrate synthase; cold-activity; HET: COA CIT; 2.09A {Antarctic bacterium ds2-3r} SCOP: a.103.1.1 Back     alignment and structure
>2p2w_A Citrate synthase; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: FLC; 1.90A {Thermotoga maritima} Back     alignment and structure