254780356

254780356

hypothetical protein CLIBASIA_01205

GeneID in NCBI database:8209341Locus tag:CLIBASIA_01205
Protein GI in NCBI database:254780356Protein Accession:YP_003064769.1
Gene range:+(253208, 253570)Protein Length:120aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MLQKKISNPLCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLSILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIVK
ccHHHHccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHEEEcccEEHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc
cHHHHccHHHHHHHHHHHHHHHHHHHHcccEEHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccEEEEEEEEEc
mlqkkisnplcnIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFwfvyspeipiwGIVLSILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEitrnpttilSQSITTNLRGIVK
mlqkkisnplcNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLSILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAieitrnpttilsqsittnlrgivk
MLQKKISNPLCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEipiwgivlsiliiaiislriRYSHPHILLIVKTLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIVK
*********LCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLSILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIV*
MLQKKISNPLCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLSILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIVK
MLQKKISNPLCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLSILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIVK
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQKKISNPLCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLSILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIVK
MLQKKISNPLCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLSILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIVK
MLQKKISNPLCNIIQHVKYLIQLEQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLSILIIAIISLRIRYSHPHILLIVKTLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIVK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target120 hypothetical protein CLIBASIA_01205 [Candidatus Liberib
222148889 1007 hypothetical protein Avi_2562 [Agrobacterium vitis S4] 1 1e-11
190891621 820 hypothetical protein RHECIAT_CH0002024 [Rhizobium etli 1 1e-06
227821911 815 DNA uptake protein [Sinorhizobium fredii NGR234] Length 1 2e-06
327189235 820 hypothetical protein RHECNPAF_70025 [Rhizobium etli CNP 1 3e-06
86357548 848 hypothetical protein RHE_CH01927 [Rhizobium etli CFN 42 1 1e-05
150396364 799 ComEC/Rec2-like protein [Sinorhizobium medicae WSM419] 1 1e-05
307317027 801 ComEC/Rec2-related protein [Sinorhizobium meliloti AK83 1 2e-05
15965263 801 hypothetical protein SMc02086 [Sinorhizobium meliloti 1 1 2e-05
159184742 809 hypothetical protein Atu1393 [Agrobacterium tumefaciens 1 5e-05
209549196 810 ComEC/Rec2-related protein [Rhizobium leguminosarum bv. 1 6e-05
>gi|222148889|ref|YP_002549846.1| hypothetical protein Avi_2562 [Agrobacterium vitis S4] Length = 1007 Back     alignment and organism information
 Score = 73.2 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 36/96 (37%), Positives = 53/96 (55%)

Query: 24  EQEYGGFFLFIPVFLAFGAIFWFVYSPEIPIWGIVLSILIIAIISLRIRYSHPHILLIVK 83
           E  YG  FLF+PV L  GAI+WF    ++P   I L+     ++ LR+RY HP +  +  
Sbjct: 80  ELAYGRTFLFLPVLLGLGAIWWFTRPQDLPRLPIFLTFCAAGVVWLRVRYRHPVLATVCG 139

Query: 84  TLTYFLTRMILAAIEITRNPTTILSQSITTNLRGIV 119
             T  L  M+LA ++  R  T I+  ++TT +RG V
Sbjct: 140 IATLGLAGMLLADVQTARLDTIIIDSAVTTVVRGKV 175


Species: Agrobacterium vitis
Genus: Agrobacterium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891621|ref|YP_001978163.1| hypothetical protein RHECIAT_CH0002024 [Rhizobium etli CIAT 652] Length = 820 Back     alignment and organism information
>gi|227821911|ref|YP_002825881.1| DNA uptake protein [Sinorhizobium fredii NGR234] Length = 815 Back     alignment and organism information
>gi|327189235|gb|EGE56414.1| hypothetical protein RHECNPAF_70025 [Rhizobium etli CNPAF512] Length = 820 Back     alignment and organism information
>gi|86357548|ref|YP_469440.1| hypothetical protein RHE_CH01927 [Rhizobium etli CFN 42] Length = 848 Back     alignment and organism information
>gi|150396364|ref|YP_001326831.1| ComEC/Rec2-like protein [Sinorhizobium medicae WSM419] Length = 799 Back     alignment and organism information
>gi|307317027|ref|ZP_07596468.1| ComEC/Rec2-related protein [Sinorhizobium meliloti AK83] Length = 801 Back     alignment and organism information
>gi|15965263|ref|NP_385616.1| hypothetical protein SMc02086 [Sinorhizobium meliloti 1021] Length = 801 Back     alignment and organism information
>gi|159184742|ref|NP_354400.2| hypothetical protein Atu1393 [Agrobacterium tumefaciens str. C58] Length = 809 Back     alignment and organism information
>gi|209549196|ref|YP_002281113.1| ComEC/Rec2-related protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 810 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 120 hypothetical protein CLIBASIA_01205 [Candidatus Liberib
PRK11539 754 hypothetical protein; Provisional 93.89
>PRK11539 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00