254780364

254780364

ferredoxin-NADP+ reductase protein

GeneID in NCBI database:8209349Locus tag:CLIBASIA_01245
Protein GI in NCBI database:254780364Protein Accession:YP_003064777.1
Gene range:-(261830, 262504)Protein Length:224aa
Gene description:ferredoxin-NADP+ reductase protein
COG prediction:[C] Flavodoxin reductases (ferredoxin-NADPH reductases) family 1
KEGG prediction:ferredoxin-NADP+ reductase protein
SEED prediction:Ferredoxin--NADP(+) reductase (EC 1.18.1.2)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Biogenesis of cytochrome c oxidases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
MCDVSSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDTRIG
cccccccccccEEEEEEEEEEEccccEEEEEEccccccccccccEEEEEEEcccEEEEEEEEEEccccccEEEEEEEEcccccccHHHHHcccccEEEEEEccccccEEcccccccEEEEEEccHHHHHHHHHHHHHHHccccccEEEEEEEccHHHHHcHHHHHHHHHccHHHHHHccccEEEEEEccccccccccccHHHHcccHHHHHcccccccHHHHcc
cccEEcccHHHcccEEEEEEEEEEccEEEEEEEcccccccccccEEEEEEEEccEEEEEEEEccccccccEEEEEEEcccccccHHHHcccccccEEEEEcccEccccHHHEccccEEEEEEEHHHHHHHHHHcccHHHHHHccEEEEEEEEccHHHcccHHHHHccHHHccccHHHHHHHEEEEEEEcccccccEccHHHHHHccHHHHHHcccccccccccc
mcdvsselAADVYCESVISVKHYTDRLFRFCitrpksfrfrsgeFVMLGLIVngrpifraysiaspcrddklefcsikvdKGFFTTYLqniqpgdtillhkkstgdlildslipgnrlylfsmgtgiapfasmirdpetykkFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVtqedylykgritnhilsgefyrnmglsplnpdtrig
MCDVSSELAADVYCESVISVKHYTDRLFRFCITrpksfrfrsgEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRtvtqedylykgRITNHILSgefyrnmglsplnpdtrig
MCDVSSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDTRIG
*********ADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGL*P********
********AADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDTRIG
*CDVSSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPL*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCDVSSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDTRIG
MCDVSSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDTRIG
MCDVSSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDTRIG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target224 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
254780363264 ferredoxin-NADP+ reductase protein [Candidatus Lib 1e-112
254780503 461 putative glutamine synthetase [Candidatus Liberiba 0.034
>gi|254780363|ref|YP_003064776.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Back     alignment
 Score =  395 bits (1014), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/221 (85%), Positives = 204/221 (92%)

Query: 1   MCDVSSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRA 60
           MCDVS +L  +VYCESVIS+KHYTDRLFRFCITRPKSFRFRSGEFVMLGL+VNGR I RA
Sbjct: 1   MCDVSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRA 60

Query: 61  YSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYL 120
           YS+ASPC DDKLEF SIKV++G  TT+LQNIQPGDTILLHKKSTG L+LD+LIPGNRLYL
Sbjct: 61  YSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYL 120

Query: 121 FSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQ 180
           FS GTGIAPF S+IRDP TY+KFDEVI+T TC +V ELQYGIDVMHEISQDEILKDLIGQ
Sbjct: 121 FSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQ 180

Query: 181 KLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDT 221
           KLKFYRTVTQEDYLYKGRITNHILSGEFYRNM LSPLNPDT
Sbjct: 181 KLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDT 221

>gi|254780503|ref|YP_003064916.1| putative glutamine synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Back     alignment
 Score = 30.0 bits (66), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 6/57 (10%)

Query: 164 VMHEISQDEILKDLIGQKLKFYRTVTQEDYLY-----KGRITNHILSGEFYRNMGLS 215
           V++  +Q+E LK +I  +++FY     ED  Y     KGR    IL G+ Y  MG++
Sbjct: 134 VLNFYAQNE-LKPIIAPEIEFYLIAKNEDPDYPLQPPKGRSGRSILGGQSYSIMGIN 189

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target224 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
254780363264 ferredoxin-NADP+ reductase protein [Candidatus Liberiba 1 1e-108
315122176265 ferredoxin-NADP+ reductase protein [Candidatus Liberiba 1 1e-95
86357697270 ferredoxin-NADP+ reductase protein [Rhizobium etli CFN 1 2e-78
190891722270 ferredoxin-NADP+ reductase [Rhizobium etli CIAT 652] Le 1 4e-78
218663702270 ferredoxin-NADP+ reductase protein [Rhizobium etli IE47 1 4e-78
241204622270 Oxidoreductase FAD-binding domain protein [Rhizobium le 1 9e-78
209549309270 oxidoreductase FAD-binding domain protein [Rhizobium le 1 2e-77
116252121270 NADPH:ferredoxin reductase [Rhizobium leguminosarum bv. 1 7e-77
150396322270 oxidoreductase FAD-binding subunit [Sinorhizobium medic 1 5e-76
227821873270 putative NADPH:ferredoxin reductase [Sinorhizobium fred 1 8e-76
>gi|254780363|ref|YP_003064776.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Back     alignment and organism information
 Score =  395 bits (1014), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 190/221 (85%), Positives = 204/221 (92%)

Query: 1   MCDVSSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRA 60
           MCDVS +L  +VYCESVIS+KHYTDRLFRFCITRPKSFRFRSGEFVMLGL+VNGR I RA
Sbjct: 1   MCDVSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRA 60

Query: 61  YSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYL 120
           YS+ASPC DDKLEF SIKV++G  TT+LQNIQPGDTILLHKKSTG L+LD+LIPGNRLYL
Sbjct: 61  YSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYL 120

Query: 121 FSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQ 180
           FS GTGIAPF S+IRDP TY+KFDEVI+T TC +V ELQYGIDVMHEISQDEILKDLIGQ
Sbjct: 121 FSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQ 180

Query: 181 KLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDT 221
           KLKFYRTVTQEDYLYKGRITNHILSGEFYRNM LSPLNPDT
Sbjct: 181 KLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDT 221


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122176|ref|YP_004062665.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 265 Back     alignment and organism information
>gi|86357697|ref|YP_469589.1| ferredoxin-NADP+ reductase protein [Rhizobium etli CFN 42] Length = 270 Back     alignment and organism information
>gi|190891722|ref|YP_001978264.1| ferredoxin-NADP+ reductase [Rhizobium etli CIAT 652] Length = 270 Back     alignment and organism information
>gi|218663702|ref|ZP_03519632.1| ferredoxin-NADP+ reductase protein [Rhizobium etli IE4771] Length = 270 Back     alignment and organism information
>gi|241204622|ref|YP_002975718.1| Oxidoreductase FAD-binding domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 270 Back     alignment and organism information
>gi|209549309|ref|YP_002281226.1| oxidoreductase FAD-binding domain protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 270 Back     alignment and organism information
>gi|116252121|ref|YP_767959.1| NADPH:ferredoxin reductase [Rhizobium leguminosarum bv. viciae 3841] Length = 270 Back     alignment and organism information
>gi|150396322|ref|YP_001326789.1| oxidoreductase FAD-binding subunit [Sinorhizobium medicae WSM419] Length = 270 Back     alignment and organism information
>gi|227821873|ref|YP_002825843.1| putative NADPH:ferredoxin reductase [Sinorhizobium fredii NGR234] Length = 270 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target224 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
COG1018266 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NADPH r 1e-28
PRK10926248 PRK10926, PRK10926, ferredoxin-NADP reductase; Provisio 7e-22
cd00322223 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD a 1e-17
cd06187224 cd06187, O2ase_reductase_like, The oxygenase reductase 1e-13
TIGR02160 352 TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenase/red 4e-07
cd06196218 cd06196, FNR_like_1, Ferredoxin reductase-like proteins 5e-04
cd06195241 cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase is an 3e-57
cd06215231 cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur binding 2e-12
cd06214241 cd06214, PA_degradation_oxidoreductase_like, NAD(P) bin 5e-12
cd06191231 cd06191, FNR_iron_sulfur_binding, Iron-sulfur binding F 2e-11
cd06201289 cd06201, SiR_like2, Cytochrome p450- like alpha subunit 2e-10
cd06216243 cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding 6e-10
cd06217235 cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur binding 6e-09
cd06211238 cd06211, phenol_2-monooxygenase_like, Phenol 2-monooxyg 2e-08
cd06210236 cd06210, MMO_FAD_NAD_binding, Methane monooxygenase (MM 4e-08
cd06183234 cd06183, cyt_b5_reduct_like, Cytochrome b5 reductase ca 4e-08
cd06189224 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin 9e-08
COG0543252 COG0543, UbiB, 2-polyprenylphenol hydroxylase and relat 5e-07
cd06209228 cd06209, BenDO_FAD_NAD, Benzoate dioxygenase reductase 6e-07
cd06221253 cd06221, sulfite_reductase_like, Anaerobic sulfite redu 9e-07
cd06212232 cd06212, monooxygenase_like, The oxygenase reductase FA 3e-06
cd06182267 cd06182, CYPOR_like, NADPH cytochrome p450 reductase (C 4e-06
cd06208286 cd06208, CYPOR_like_FNR, These ferredoxin reductases ar 2e-05
cd06194222 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulfur bi 4e-05
PRK05713312 PRK05713, PRK05713, hypothetical protein; Provisional 4e-05
KOG0534286 KOG0534, KOG0534, KOG0534, NADH-cytochrome b-5 reductas 7e-05
cd06190232 cd06190, T4MO_e_transfer_like, Toluene-4-monoxygenase e 1e-04
cd06184247 cd06184, flavohem_like_fad_nad_binding, FAD_NAD(P)H bin 2e-04
COG4097438 COG4097, COG4097, Predicted ferric reductase [Inorganic 0.001
PRK07609339 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucoseen red 0.003
cd06213227 cd06213, oxygenase_e_transfer_subunit, The oxygenase re 0.004
pfam0097099 pfam00970, FAD_binding_6, Oxidoreductase FAD-binding do 1e-07
PRK08345289 PRK08345, PRK08345, cytochrome-c3 hydrogenase subunit g 1e-06
cd06207382 cd06207, CyPoR_like, NADPH cytochrome p450 reductase (C 2e-04
KOG1159574 KOG1159, KOG1159, KOG1159, NADP-dependent flavoprotein 0.003
>gnl|CDD|31221 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|182844 PRK10926, PRK10926, ferredoxin-NADP reductase; Provisional Back     alignment and domain information
>gnl|CDD|99778 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>gnl|CDD|99784 cd06187, O2ase_reductase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant Back     alignment and domain information
>gnl|CDD|131215 TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>gnl|CDD|99793 cd06196, FNR_like_1, Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>gnl|CDD|99792 cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin Back     alignment and domain information
>gnl|CDD|99811 cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99810 cd06214, PA_degradation_oxidoreductase_like, NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase Back     alignment and domain information
>gnl|CDD|99788 cd06191, FNR_iron_sulfur_binding, Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99798 cd06201, SiR_like2, Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>gnl|CDD|99812 cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99813 cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99807 cd06211, phenol_2-monooxygenase_like, Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol Back     alignment and domain information
>gnl|CDD|99806 cd06210, MMO_FAD_NAD_binding, Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol Back     alignment and domain information
>gnl|CDD|99780 cd06183, cyt_b5_reduct_like, Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor Back     alignment and domain information
>gnl|CDD|99786 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins Back     alignment and domain information
>gnl|CDD|30889 COG0543, UbiB, 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|99805 cd06209, BenDO_FAD_NAD, Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain Back     alignment and domain information
>gnl|CDD|99817 cd06221, sulfite_reductase_like, Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>gnl|CDD|99808 cd06212, monooxygenase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>gnl|CDD|99779 cd06182, CYPOR_like, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>gnl|CDD|99804 cd06208, CYPOR_like_FNR, These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain Back     alignment and domain information
>gnl|CDD|99791 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|168200 PRK05713, PRK05713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|35754 KOG0534, KOG0534, KOG0534, NADH-cytochrome b-5 reductase [Coenzyme transport and metabolism, Energy production and conversion] Back     alignment and domain information
>gnl|CDD|99787 cd06190, T4MO_e_transfer_like, Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system Back     alignment and domain information
>gnl|CDD|99781 cd06184, flavohem_like_fad_nad_binding, FAD_NAD(P)H binding domain of flavohemoglobin Back     alignment and domain information
>gnl|CDD|33854 COG4097, COG4097, Predicted ferric reductase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181058 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>gnl|CDD|99809 cd06213, oxygenase_e_transfer_subunit, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>gnl|CDD|144531 pfam00970, FAD_binding_6, Oxidoreductase FAD-binding domain Back     alignment and domain information
>gnl|CDD|181398 PRK08345, PRK08345, cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|99803 cd06207, CyPoR_like, NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>gnl|CDD|36374 KOG1159, KOG1159, KOG1159, NADP-dependent flavoprotein reductase [Energy production and conversion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 224 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
PRK10926248 ferredoxin-NADP reductase; Provisional 100.0
cd06195241 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-contai 100.0
PRK11872340 antC anthranilate dioxygenase reductase; Provisional 100.0
cd06214241 PA_degradation_oxidoreductase_like NAD(P) binding domai 100.0
cd06188283 NADH_quinone_reductase Na+-translocating NADH:quinone o 100.0
PRK07609337 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated 100.0
PRK08051232 fre FMN reductase; Validated 100.0
cd06184247 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domai 100.0
cd06209228 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FA 100.0
cd06213227 oxygenase_e_transfer_subunit The oxygenase reductase FA 100.0
cd06212232 monooxygenase_like The oxygenase reductase FAD/NADH bin 100.0
cd06189224 flavin_oxioreductase NAD(P)H dependent flavin oxidoredu 100.0
cd06215231 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxi 100.0
PRK05464408 Na(+)-translocating NADH-quinone reductase subunit F; P 100.0
cd06187224 O2ase_reductase_like The oxygenase reductase FAD/NADH b 100.0
cd06211238 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phe 100.0
cd06217235 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxi 100.0
cd06216243 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxi 100.0
cd06210236 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reducta 100.0
PRK10684 335 HCP oxidoreductase, NADH-dependent; Provisional 100.0
cd06194222 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferr 100.0
PRK13289399 nitric oxide dioxygenase; Provisional 100.0
cd06183234 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes th 100.0
cd06190232 T4MO_e_transfer_like Toluene-4-monoxygenase electron tr 100.0
cd06196218 FNR_like_1 Ferredoxin reductase-like proteins catalyze 100.0
TIGR02160 371 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK 100.0
cd00322223 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) 100.0
cd06221253 sulfite_reductase_like Anaerobic sulfite reductase cont 100.0
cd06208286 CYPOR_like_FNR These ferredoxin reductases are related 100.0
PTZ00319303 NADH-cytochrome B5 reductase; Provisional 99.98
PRK08221263 anaerobic sulfite reductase subunit B; Provisional 99.98
KOG0534286 consensus 99.97
PRK08345292 cytochrome-c3 hydrogenase subunit gamma; Provisional 99.97
COG0543252 UbiB 2-polyprenylphenol hydroxylase and related flavodo 99.97
TIGR01941425 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocatin 99.97
PTZ00274325 cytochrome b5 reductase; Provisional 99.97
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electron tra 99.97
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the electr 99.96
PRK00054248 dihydroorotate dehydrogenase electron transfer subunit; 99.96
cd06201289 SiR_like2 Cytochrome p450- like alpha subunits of E. co 99.95
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron tran 99.95
TIGR03224411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protei 99.94
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Reviewed 99.94
cd06200245 SiR_like1 Cytochrome p450- like alpha subunits of E. co 99.94
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the electr 99.94
COG2871410 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, s 99.94
cd06182267 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serv 99.93
TIGR02911261 sulfite_red_B sulfite reductase, subunit B; InterPro: I 99.91
PRK12778 760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 99.88
PRK12779944 putative bifunctional glutamate synthase subunit beta/2 99.86
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 99.82
COG0369587 CysJ Sulfite reductase, alpha subunit (flavoprotein) [I 99.82
PRK06214537 sulfite reductase; Provisional 99.74
PTZ003061167 NADH-dependent fumarate reductase; Provisional 99.63
cd06191231 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin 100.0
COG1018266 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) 100.0
PRK05713312 hypothetical protein; Provisional 100.0
cd06198216 FNR_like_3 NAD(P) binding domain of ferredoxin reductas 100.0
cd06185211 PDR_like Phthalate dioxygenase reductase (PDR) is an FM 100.0
cd06197220 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin redu 99.92
COG4097438 Predicted ferric reductase [Inorganic ion transport and 99.92
KOG0039646 consensus 99.75
TIGR01931628 cysJ sulfite reductase [NADPH] flavoprotein, alpha-comp 99.63
cd06186210 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes th 99.91
KOG3378385 consensus 99.62
PRK05802328 hypothetical protein; Provisional 99.1
cd06193235 siderophore_interacting Siderophore interacting protein 98.9
COG2375265 ViuB Siderophore-interacting protein [Inorganic ion tra 98.77
cd06206384 bifunctional_CYPOR These bifunctional proteins fuse N-t 99.88
cd06199360 SiR Cytochrome p450- like alpha subunits of E. coli sul 99.83
cd06203398 methionine_synthase_red Human methionine synthase reduc 99.82
cd06202406 Nitric_oxide_synthase The ferredoxin-reductase (FNR) li 99.82
cd06207382 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serv 99.81
PRK10953599 cysJ sulfite reductase subunit alpha; Provisional 99.81
cd06204416 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as 99.75
KOG1158645 consensus 99.74
KOG1159574 consensus 99.49
pfam0097099 FAD_binding_6 Oxidoreductase FAD-binding domain. 99.76
pfam08022103 FAD_binding_8 FAD-binding domain. 98.96
pfam08021116 FAD_binding_9 Siderophore-interacting FAD-binding domai 98.21
pfam00175106 NAD_binding_1 Oxidoreductase NAD-binding domain. Xanthi 99.66
PRK065671048 putative bifunctional glutamate synthase subunit beta/2 99.35
pfam08030148 NAD_binding_6 Ferric reductase NAD binding domain. 98.7
>PRK10926 ferredoxin-NADP reductase; Provisional Back     alignment and domain information
>cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase Back     alignment and domain information
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK08051 fre FMN reductase; Validated Back     alignment and domain information
>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin Back     alignment and domain information
>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain Back     alignment and domain information
>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins Back     alignment and domain information
>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant Back     alignment and domain information
>cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol Back     alignment and domain information
>cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain Back     alignment and domain information
>PRK13289 nitric oxide dioxygenase; Provisional Back     alignment and domain information
>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor Back     alignment and domain information
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system Back     alignment and domain information
>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit; InterPro: IPR011884 Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation , Back     alignment and domain information
>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain Back     alignment and domain information
>PTZ00319 NADH-cytochrome B5 reductase; Provisional Back     alignment and domain information
>PRK08221 anaerobic sulfite reductase subunit B; Provisional Back     alignment and domain information
>KOG0534 consensus Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit; InterPro: IPR010205 This entry represents the NqrF subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria Back     alignment and domain information
>PTZ00274 cytochrome b5 reductase; Provisional Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>TIGR02911 sulfite_red_B sulfite reductase, subunit B; InterPro: IPR014260 This entry represents subunit B, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06214 sulfite reductase; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain Back     alignment and domain information
>COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>cd06198 FNR_like_3 NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster Back     alignment and domain information
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin reductase-like proteins Back     alignment and domain information
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0039 consensus Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component; InterPro: IPR010199 This entry describes an NADPH-dependent sulphite reductase flavoprotein subunit Back     alignment and domain information
>cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide Back     alignment and domain information
>KOG3378 consensus Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family Back     alignment and domain information
>COG2375 ViuB Siderophore-interacting protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) Back     alignment and domain information
>cd06199 SiR Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate Back     alignment and domain information
>cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain Back     alignment and domain information
>cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information
>cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>KOG1158 consensus Back     alignment and domain information
>KOG1159 consensus Back     alignment and domain information
>pfam00970 FAD_binding_6 Oxidoreductase FAD-binding domain Back     alignment and domain information
>pfam08022 FAD_binding_8 FAD-binding domain Back     alignment and domain information
>pfam08021 FAD_binding_9 Siderophore-interacting FAD-binding domain Back     alignment and domain information
>pfam00175 NAD_binding_1 Oxidoreductase NAD-binding domain Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>pfam08030 NAD_binding_6 Ferric reductase NAD binding domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target224 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
2qdx_A257 P.Aeruginosa Fpr With Fad Length = 257 3e-47
1a8p_A258 Ferredoxin Reductase From Azotobacter Vinelandii Le 1e-46
2bgi_A272 X-Ray Structure Of The Ferredoxin-Nadp(H) Reductase 4e-46
3fpk_A251 Crystal Structure Of Ferredoxin-Nadp Reductase From 6e-32
1fdr_A248 Flavodoxin Reductase From E. Coli Length = 248 3e-31
2xnj_A266 Crystal Structure Of An Engineered Ferredoxin(Flavo 3e-29
1qfj_A232 Crystal Structure Of Nad(P)h:flavin Oxidoreductase 8e-13
1krh_A338 X-Ray Stucture Of Benzoate Dioxygenase Reductase Le 7e-12
2eix_A243 The Structure Of Physarum Polycephalum Cytochrome B 3e-11
1ndh_A272 Crystal Structure Of Nadh-Cytochrome B5 Reductase F 9e-08
1cnf_A270 Structural Studies On Corn Nitrate Reductase: Refin 2e-07
1cne_A270 Structural Studies On Corn Nitrate Reductase: Refin 6e-07
1umk_A275 The Structure Of Human Erythrocyte Nadh-Cytochrome 8e-07
1ib0_A274 Crystal Structure Of Rat B5r In Complex With Fad An 6e-06
1qx4_A274 Structrue Of S127p Mutant Of Cytochrome B5 Reductas 6e-06
1tvc_A250 Fad And Nadh Binding Domain Of Methane Monooxygenas 1e-05
1gaq_A314 Crystal Structure Of The Complex Between Ferredoxin 0.001
2xnc_A315 Crystal Structure Of An Engineered Ferredoxin Nadp 0.001
1gvh_A396 The X-Ray Structure Of Ferric Escherichia Coli Flav 3e-07
3lvb_A311 Crystal Structure Of The Ferredoxin:nadp+ Reductase 2e-05
3lo8_A311 Crystal Structure Of The Oxidized Form Of Ferredoxi 2e-05
1jb9_A316 Crystal Structure Of The Ferredoxin:nadp+ Reductase 2e-05
2rc5_A314 Refined Structure Of Fnr From Leptospira Interrogan 7e-04
>gi|159795221|pdb|2QDX|A Chain A, P.Aeruginosa Fpr With Fad Length = 257 Back     alignment and structure
 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 95/214 (44%), Positives = 144/214 (67%)

Query: 10  ADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRD 69
           +++Y E V+SV H+ D LF F  TR    RF++G+FVM+GL V+GRP+ RAYSIASP  +
Sbjct: 1   SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYE 60

Query: 70  DKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAP 129
           + LEF SIKV  G  T+ LQ+++ GD +++ +K TG L+ D L+PG  LYL S GTG+AP
Sbjct: 61  EHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAP 120

Query: 130 FASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVT 189
           F S+I+DPETY+++++VI+ H    V+EL Y   +   + + E   D + +KL +Y  VT
Sbjct: 121 FLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVT 180

Query: 190 QEDYLYKGRITNHILSGEFYRNMGLSPLNPDTRI 223
           +E +  +GR T+ + SG+ + ++GL P+NP    
Sbjct: 181 REPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDDR 214


gi|157829742|pdb|1A8P|A Chain A, Ferredoxin Reductase From Azotobacter Vinelandii Length = 258 Back     alignment and structure
>gi|78101589|pdb|2BGI|A Chain A, X-Ray Structure Of The Ferredoxin-Nadp(H) Reductase From Rhodobacter Capsulatus Complexed With Three Molecules Of The Detergent N-Heptyl-Beta-D-Thioglucoside At 1.7 Angstroms Length = 272 Back     alignment and structure
>gi|222447122|pdb|3FPK|A Chain A, Crystal Structure Of Ferredoxin-Nadp Reductase From Salmonella Typhimurium Length = 251 Back     alignment and structure
>gi|157831052|pdb|1FDR|A Chain A, Flavodoxin Reductase From E. Coli Length = 248 Back     alignment and structure
>gi|323714333|pdb|2XNJ|A Chain A, Crystal Structure Of An Engineered Ferredoxin(Flavodoxin) Nadp(H) Reductase (Fpr) From Escherichia Coli Length = 266 Back     alignment and structure
>gi|5107658|pdb|1QFJ|A Chain A, Crystal Structure Of Nad(P)h:flavin Oxidoreductase From Escherichia Coli Length = 232 Back     alignment and structure
>gi|21465902|pdb|1KRH|A Chain A, X-Ray Stucture Of Benzoate Dioxygenase Reductase Length = 338 Back     alignment and structure
>gi|146387239|pdb|2EIX|A Chain A, The Structure Of Physarum Polycephalum Cytochrome B5 Reductase Length = 243 Back     alignment and structure
gi|157832094|pdb|1NDH|A Chain A, Crystal Structure Of Nadh-Cytochrome B5 Reductase From Pig Liver At 2.4 Angstroms Resolution Length = 272 Back     alignment and structure
>gi|157830650|pdb|1CNF|A Chain A, Structural Studies On Corn Nitrate Reductase: Refined Structure Of The Cytochrome B Reductase Fragment At 2.5 Angstroms, Its Adp Complex And An Active Site Mutant And Modeling Of The Cytochrome B Domain Length = 270 Back     alignment and structure
>gi|157830649|pdb|1CNE|A Chain A, Structural Studies On Corn Nitrate Reductase: Refined Structure Of The Cytochrome B Reductase Fragment At 2.5 Angstroms, Its Adp Complex And An Active Site Mutant And Modeling Of The Cytochrome B Domain Length = 270 Back     alignment and structure
>gi|56554196|pdb|1UMK|A Chain A, The Structure Of Human Erythrocyte Nadh-Cytochrome B5 Reductase Length = 275 Back     alignment and structure
>gi|17943396|pdb|1IB0|A Chain A, Crystal Structure Of Rat B5r In Complex With Fad And Nad Length = 274 Back     alignment and structure
>gi|55669578|pdb|1QX4|A Chain A, Structrue Of S127p Mutant Of Cytochrome B5 Reductase Length = 274 Back     alignment and structure
>gi|159163077|pdb|1TVC|A Chain A, Fad And Nadh Binding Domain Of Methane Monooxygenase Reductase From Methylococcus Capsulatus (Bath) Length = 250 Back     alignment and structure
>gi|13096165|pdb|1GAQ|A Chain A, Crystal Structure Of The Complex Between Ferredoxin And Ferredoxin-Nadp+ Reductase Length = 314 Back     alignment and structure
>gi|323714331|pdb|2XNC|A Chain A, Crystal Structure Of An Engineered Ferredoxin Nadp Reductase (Fnr) From Pisum Sativum Length = 315 Back     alignment and structure
gi|23200077|pdb|1GVH|A Chain A, The X-Ray Structure Of Ferric Escherichia Coli Flavohemoglobin Reveals An Unespected Geometry Of The Distal Heme Pocket Length = 396 Back     alignment and structure
>gi|291191325|pdb|3LVB|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase From Maize Root At 1.7 Angstroms - Test Set Withheld Length = 311 Back     alignment and structure
>gi|291191259|pdb|3LO8|A Chain A, Crystal Structure Of The Oxidized Form Of Ferredoxin:nadp+ Reductase From Maize Root At 1.05 Angstroms Length = 311 Back     alignment and structure
>gi|14719468|pdb|1JB9|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase From Maize Root At 1.7 Angstroms Length = 316 Back     alignment and structure
>gi|170785009|pdb|2RC5|A Chain A, Refined Structure Of Fnr From Leptospira Interrogans Length = 314 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target224 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
2qdx_A257 Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A { 2e-32
2bgi_A272 Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NA 2e-31
1fdr_A248 Flavodoxin reductase; ferredoxin reductase, flavin, oxi 5e-29
1qfj_A232 Protein (flavin reductase); riboflavin, ferredoxin redu 2e-16
1gvh_A396 Flavohemoprotein; oxidoreductase, NADP, heme, flavoprot 3e-16
1fnb_A314 Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),fe 3e-16
1ep3_B262 Dihydroorotate dehydrogenase B (PYRK subunit); heterote 3e-16
3jqq_A316 Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FA 6e-15
3lo8_A311 Ferredoxin--NADP reductase; electron transport, oxidore 1e-14
1jb9_A316 Ferredoxin-NADP reductase; electron transport, oxidored 7e-14
2rc5_A314 Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FA 7e-13
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-bin 8e-13
2b5o_A402 FNR, ferredoxin--NADP reductase; complex with FAD, oxid 1e-11
2cnd_A270 NADH-dependent nitrate reductase; nitrate assimilating 1e-10
1umk_A275 B5R, NADH-cytochrome B5 reductase; flavoprotein, beta b 1e-10
2bmw_A304 Ferredoxin--NADP reductase; oxidoreductase, flavoprotei 1e-09
1f20_A435 Nitric-oxide synthase; nitric-xoide synthase, reductase 2e-09
1cqx_A403 Flavohemoprotein; globin fold, six-stranded antiparalle 2e-06
2r6h_A290 NADH:ubiquinone oxidoreductase, Na translocating, F sub 4e-06
2pia_A 321 Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkh 7e-11
1ddg_A374 Sulfite reductase (NADPH) flavoprotein alpha- component 2e-04
1tvc_A250 Methane monooxygenase component C, methane monooxygenas 2e-07
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated PIT, 7e-07
3a1f_A186 Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding 0.004
1tll_A688 Nitric-oxide synthase, brain; reductase module, FMN, FA 4e-04
>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Length = 257 Back     alignment and structure
 Score =  134 bits (336), Expect = 2e-32
 Identities = 95/213 (44%), Positives = 144/213 (67%)

Query: 10  ADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRAYSIASPCRD 69
           +++Y E V+SV H+ D LF F  TR    RF++G+FVM+GL V+GRP+ RAYSIASP  +
Sbjct: 1   SNLYTERVLSVHHWNDTLFSFKTTRNPGLRFKTGQFVMIGLEVDGRPLMRAYSIASPNYE 60

Query: 70  DKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAP 129
           + LEF SIKV  G  T+ LQ+++ GD +++ +K TG L+ D L+PG  LYL S GTG+AP
Sbjct: 61  EHLEFFSIKVPDGPLTSRLQHLKEGDELMVSRKPTGTLVHDDLLPGKHLYLLSTGTGMAP 120

Query: 130 FASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQKLKFYRTVT 189
           F S+I+DPETY+++++VI+ H    V+EL Y   +   + + E   D + +KL +Y  VT
Sbjct: 121 FLSVIQDPETYERYEKVILVHGVRWVSELAYADFITKVLPEHEYFGDQVKEKLIYYPLVT 180

Query: 190 QEDYLYKGRITNHILSGEFYRNMGLSPLNPDTR 222
           +E +  +GR T+ + SG+ + ++GL P+NP   
Sbjct: 181 REPFRNQGRQTDLMRSGKLFEDIGLPPMNPQDD 213


>2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Length = 272 Back     alignment and structure
>1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 3fpk_A* Length = 248 Back     alignment and structure
>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfamily, oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Length = 232 Back     alignment and structure
>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Length = 396 Back     alignment and structure
>1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 1sm4_A* Length = 314 Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain, alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Length = 262 Back     alignment and structure
>3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* Length = 316 Back     alignment and structure
>3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* Length = 311 Back     alignment and structure
>1jb9_A Ferredoxin-NADP reductase; electron transport, oxidoreductase; HET: FAD; 1.70A {Zea mays} SCOP: b.43.4.2 c.25.1.1 Length = 316 Back     alignment and structure
>2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* Length = 314 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 Back     alignment and structure
>2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} Length = 402 Back     alignment and structure
>2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* Length = 270 Back     alignment and structure
>1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* Length = 275 Back     alignment and structure
>2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... Length = 304 Back     alignment and structure
>1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidoreductase; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 Length = 435 Back     alignment and structure
>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix- flanked five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Ralstonia eutropha} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Length = 403 Back     alignment and structure
>2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, F subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis W83} Length = 290 Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 321 Back     alignment and structure
>1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* Length = 374 Back     alignment and structure
>1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Length = 250 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Length = 186 Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Length = 688 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target224 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
2bgi_A272 Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NA 100.0
2qdx_A257 Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A { 100.0
1fdr_A248 Flavodoxin reductase; ferredoxin reductase, flavin, oxi 100.0
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-bin 100.0
1qfj_A232 Protein (flavin reductase); riboflavin, ferredoxin redu 100.0
1fnb_A314 Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),fe 100.0
1tvc_A250 Methane monooxygenase component C, methane monooxygenas 100.0
2bmw_A304 Ferredoxin--NADP reductase; oxidoreductase, flavoprotei 100.0
1umk_A275 B5R, NADH-cytochrome B5 reductase; flavoprotein, beta b 100.0
2rc5_A314 Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FA 100.0
2eix_A243 NADH-cytochrome B5 reductase; flavoprotein, FAD-binding 100.0
2b5o_A402 FNR, ferredoxin--NADP reductase; complex with FAD, oxid 100.0
3lo8_A311 Ferredoxin--NADP reductase; electron transport, oxidore 100.0
3jqq_A316 Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FA 100.0
2cnd_A270 NADH-dependent nitrate reductase; nitrate assimilating 100.0
1ep3_B262 Dihydroorotate dehydrogenase B (PYRK subunit); heterote 100.0
2r6h_A290 NADH:ubiquinone oxidoreductase, Na translocating, F sub 100.0
1ddg_A374 Sulfite reductase (NADPH) flavoprotein alpha- component 99.93
1gvh_A396 Flavohemoprotein; oxidoreductase, NADP, heme, flavoprot 100.0
1cqx_A403 Flavohemoprotein; globin fold, six-stranded antiparalle 100.0
2pia_A 321 Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkh 100.0
1f20_A435 Nitric-oxide synthase; nitric-xoide synthase, reductase 99.91
1tll_A688 Nitric-oxide synthase, brain; reductase module, FMN, FA 99.9
2qtl_A539 MSR;, methionine synthase reductase; alpha-beta-alpha s 99.9
2bpo_A682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytoc 99.82
1ja1_A622 NADPH-cytochrome P450 reductase; oxidoreductase; HET: F 99.77
2gpj_A252 Siderophore-interacting protein; structural genomics, j 99.86
3lrx_A158 Putative hydrogenase; alpha-beta protein, structural ge 99.52
3a1f_A186 Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding 99.39
3lyu_A142 Putative hydrogenase; the C-terminal has AN alpha-beta 99.42
>2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-45  Score=296.49  Aligned_cols=218  Identities=50%  Similarity=0.938  Sum_probs=198.6

Q ss_pred             CHHCCCCCEE--EEEEEEEECCCCEEEEEEECCCCCCCCCCCEEEECCCC-CCCCEEEEEEECCCCCCCCCEEEEEEECC
Q ss_conf             3220734211--78989984799869999807899973898578803145-86110556432056677760179996157
Q gi|254780364|r    5 SSELAADVYC--ESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIV-NGRPIFRAYSIASPCRDDKLEFCSIKVDK   81 (224)
Q Consensus         5 ~~~ip~~~~~--~~V~~~~~~T~~~~~l~l~~p~~~~f~aGQ~~~l~~~~-~g~~~~R~ySiaS~p~~~~~~~~i~~~~~   81 (224)
                      ++-.|+++.+  .||++++++|+++++|+|+.|++|+|+||||+.|.++. .|+.++|+|||+|+|.++.++++++++.+
T Consensus         7 ~p~~~~~~~~~~~tV~~v~~~t~~~~~~~l~~~~~~~f~pGQ~v~i~~~~~~g~~~~R~YSi~S~p~~~~l~~~v~~~~~   86 (272)
T 2bgi_A            7 TPIAPAKVLPDAQTVTSVRHWTDTLFSFRVTRPQTLRFRSGEFVMIGLLDDNGKPIMRAYSIASPAWDEELEFYSIKVPD   86 (272)
T ss_dssp             ---------CEEEEEEEEEEEETTEEEEEEECCTTCCCCTTCEEEEEEECTTSCEEEEEEECCSCTTCSEEEEEEECCTT
T ss_pred             CCCCCCCCCCCCCEEEEEEECCCCEEEEEECCCCCCCCCCCCCEEEEECCCCCEEEEEEEEECCCCCCCCEEEEEEEECC
T ss_conf             88884224897729998883579879999888998988999718999617899277677764679999968999999679


Q ss_pred             CCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHH
Q ss_conf             67653100002222210016887533564467688179996586808899999986530886338999940586454304
Q gi|254780364|r   82 GFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYLFSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYG  161 (224)
Q Consensus        82 g~~s~~l~~~~~gd~~~~~~~p~g~f~~~~~~~~~~lvlIAgGtGiaP~~silr~~~~~~~~~~i~l~~g~R~~~dl~~~  161 (224)
                      |.+|++|+++++||+++...+|+|.|.+++..++++++|||||||||||+||++++...+..++++|+||+|+.+|++|.
T Consensus        87 G~~S~~L~~~~~gd~~~~~~~p~G~f~~~~~~~~~~ivlIAgGtGItP~~sil~~~~~~~~~~~v~l~~~~r~~~d~~~~  166 (272)
T 2bgi_A           87 GPLTSRLQHIKVGEQIILRPKPVGTLVIDALLPGKRLWFLATGTGIAPFASLMREPEAYEKFDEVIMMHACRTVAELEYG  166 (272)
T ss_dssp             CTTHHHHTTCCTTCEEEEEEEEECSCCGGGBCCCSEEEEEEEGGGGHHHHHHTTCGGGGTSCSEEEEEEEESSSGGGHHH
T ss_pred             CCHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCHHHHCCH
T ss_conf             97023134426787236763798862344478887067981587734689999998863677327999850788994027


Q ss_pred             HHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCHHHHCCCCCCCHHHC
Q ss_conf             8889988753321012468759998105788776672168785860699678797871212
Q gi|254780364|r  162 IDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDTR  222 (224)
Q Consensus       162 ~el~~l~~~~~~~~~~~~~~~~~~~~isre~~~~~GrIt~~i~~g~l~~~~~l~~~~pet~  222 (224)
                      +||.++...++........+|++++++++++..+.|++++...++.+.+.++...++|+++
T Consensus       167 ~el~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  227 (272)
T 2bgi_A          167 RQLVEALQEDPLIGELVEGKLKYYPTTTREEFHHMGRITDNLASGKVFEDLGIAPMNPETD  227 (272)
T ss_dssp             HHHHHHHHHCTTTTTTSTTTEEEEEEESSSCCSSBCCHHHHHHSCHHHHHHTCCCCCTTTE
T ss_pred             HHHHHHHHHCCCCCEEECCCEEEEEEECCCCCCCCCCCCHHHHCCHHHHHHCCCCCCCCCC
T ss_conf             9999999868543002115268999843433245676440321464788744567883786



>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Back     alignment and structure
>1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 3fpk_A* Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfamily, oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Back     alignment and structure
>1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 1sm4_A* Back     alignment and structure
>1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Back     alignment and structure
>2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... Back     alignment and structure
>1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* Back     alignment and structure
>2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* Back     alignment and structure
>2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreductase; HET: FAD; 1.56A {Physarum polycephalum} Back     alignment and structure
>2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} Back     alignment and structure
>3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* Back     alignment and structure
>3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* Back     alignment and structure
>2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain, alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Back     alignment and structure
>2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, F subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis W83} Back     alignment and structure