254780363

254780363

ferredoxin-NADP+ reductase protein

GeneID in NCBI database:8209348Locus tag:CLIBASIA_01240
Protein GI in NCBI database:254780363Protein Accession:YP_003064776.1
Gene range:-(260694, 261488)Protein Length:264aa
Gene description:ferredoxin-NADP+ reductase protein
COG prediction:[C] Flavodoxin reductases (ferredoxin-NADPH reductases) family 1
KEGG prediction:fpr; ferredoxin-NADP+ reductase protein; K00528 ferredoxin--NADP+ reductase [EC:1.18.1.2]
SEED prediction:Flavodoxin reductases (ferredoxin-NADPH reductases) family 1
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Anaerobic respiratory reductases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MCDVSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRAYSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYLFSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDTDRIMICGSPTMIVDMKDLLIAKKFREGSNSRPGTFVVERAFSL
ccccccccccccEEEEEEEEEEccccEEEEEEccccccccccccEEEEEEEcccEEEEEEEEEEccccccEEEEEEEEEccccccHHHHHcccccEEEEEEcccccccccccccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHHHccHHHHHHccccEEEEEEEccccccccccccHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHccccccccccccEEEEEEEEEc
ccccccccHccEEEEEEEEEEEEEccEEEEEEEcccccccccccEEEEEEEEccEEEEEEEEccccccccEEEEEEEcccccccHHHHcccccccEEEEEcccEccccHHHEccccEEEEEEEHHHHHHHHHHcccHHHHHHccEEEEEEEEccHHHcccHHHHHccHHHccccHHHHHHHEEEEEEEcccccccEccHHHHHHccHHHHHHcccccccccEEEEEEEcHHHHHHHHHHHHHcccccccccccccEEEEEHEcc
mcdvspklpvnvYCESVISIKHYTDRLFRFcitrpksfrfrsgeFVMLGLMVNGRRisraysmaspcwddklEFFSIKveqgpltthlqniqpgdtillhkkstgtlvldalipgnrlylfstgtgiapfvsvirdpgtyekfdEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQKLKFYRTVtqedylykgritnhilsgefyrnmdlsplnpdtdrimicgsptmIVDMKDLLIAKKfregsnsrpgtfVVERAFSL
mcdvspklpvNVYCESVISIKHYTDRLFRFCITRpksfrfrsgefvMLGLMVNGRRISRAYSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYLFSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQKLKFYRtvtqedylykgRITNHILSGEFYRNMDLSPLNPDTDRIMICGSPTMIVDMKDLLIAKKfregsnsrpgtfvverafsl
MCDVSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRAYSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYLFSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDTDRIMICGSPTMIVDMKDLLIAKKFREGSNSRPGTFVVERAFSL
******K*PVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRAYSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYLFSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDTDRIMICGSPTMIVDMKDLLIAKKFREGSNSRPGTFVVERAFSL
MCDVSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRAYSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYLFSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDTDRIMICGSPTMIVDMKDLLIAKKFREGSNSRPGTFVVERAFSL
***VSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRAYSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYLFSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDTDRIMICGSPTMIVDMKDLLIAKKFREGSNSRPGTFVVERAFSL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCDVSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRAYSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYLFSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDTDRIMICGSPTMIVDMKDLLIAKKFREGSNSRPGTFVVERAFSL
MCDVSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRAYSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYLFSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDTDRIMICGSPTMIVDMKDLLIAKKFREGSNSRPGTFVVERAFSL
MCDVSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRAYSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYLFSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDTDRIMICGSPTMIVDMKDLLIAKKFREGSNSRPGTFVVERAFSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target264 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
254780364224 ferredoxin-NADP+ reductase protein [Candidatus Lib 1e-112
>gi|254780364|ref|YP_003064777.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 224 Back     alignment
 Score =  395 bits (1014), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/221 (85%), Positives = 204/221 (92%)

Query: 1   MCDVSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRA 60
           MCDVS +L  +VYCESVIS+KHYTDRLFRFCITRPKSFRFRSGEFVMLGL+VNGR I RA
Sbjct: 1   MCDVSSELAADVYCESVISVKHYTDRLFRFCITRPKSFRFRSGEFVMLGLIVNGRPIFRA 60

Query: 61  YSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYL 120
           YS+ASPC DDKLEF SIKV++G  TT+LQNIQPGDTILLHKKSTG L+LD+LIPGNRLYL
Sbjct: 61  YSIASPCRDDKLEFCSIKVDKGFFTTYLQNIQPGDTILLHKKSTGDLILDSLIPGNRLYL 120

Query: 121 FSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQ 180
           FS GTGIAPF S+IRDP TY+KFDEVI+T TC +V ELQYGIDVMHEISQDEILKDLIGQ
Sbjct: 121 FSMGTGIAPFASMIRDPETYKKFDEVIITHTCGRVAELQYGIDVMHEISQDEILKDLIGQ 180

Query: 181 KLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDT 221
           KLKFYRTVTQEDYLYKGRITNHILSGEFYRNM LSPLNPDT
Sbjct: 181 KLKFYRTVTQEDYLYKGRITNHILSGEFYRNMGLSPLNPDT 221

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target264 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
315122176265 ferredoxin-NADP+ reductase protein [Candidatus Liberiba 1 1e-126
254780364224 ferredoxin-NADP+ reductase protein [Candidatus Liberiba 1 1e-108
86357697270 ferredoxin-NADP+ reductase protein [Rhizobium etli CFN 1 9e-95
218663702270 ferredoxin-NADP+ reductase protein [Rhizobium etli IE47 1 2e-94
190891722270 ferredoxin-NADP+ reductase [Rhizobium etli CIAT 652] Le 1 2e-94
209549309270 oxidoreductase FAD-binding domain protein [Rhizobium le 1 1e-93
241204622270 Oxidoreductase FAD-binding domain protein [Rhizobium le 1 1e-93
116252121270 NADPH:ferredoxin reductase [Rhizobium leguminosarum bv. 1 2e-93
150396322270 oxidoreductase FAD-binding subunit [Sinorhizobium medic 1 8e-93
227821873270 putative NADPH:ferredoxin reductase [Sinorhizobium fred 1 8e-93
>gi|315122176|ref|YP_004062665.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 265 Back     alignment and organism information
 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 215/264 (81%), Positives = 239/264 (90%)

Query: 1   MCDVSPKLPVNVYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGLMVNGRRISRA 60
           M DV  K P NVYCE+VI +KHYTD+LF FCITRPK FRFRSGEFVMLGL +NG+RI RA
Sbjct: 1   MYDVPTKQPANVYCENVIWVKHYTDKLFGFCITRPKGFRFRSGEFVMLGLTINGKRIFRA 60

Query: 61  YSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLYL 120
           YS+ASPCWDDKLEFFSIKVE GPLTTHLQN+Q GD ILL+KKSTGTLVLDALIPG RLYL
Sbjct: 61  YSIASPCWDDKLEFFSIKVENGPLTTHLQNVQCGDVILLNKKSTGTLVLDALIPGKRLYL 120

Query: 121 FSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIGQ 180
           FSTGTGIAPF SVIRDP TYEKF+EVIVT TCR+V ELQYGIDV+ EIS+++I K+ +GQ
Sbjct: 121 FSTGTGIAPFASVIRDPETYEKFNEVIVTHTCRKVSELQYGIDVIREISENDIFKEFVGQ 180

Query: 181 KLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDTDRIMICGSPTMIVDMKDLL 240
           KLK+Y TVTQEDYLYKGRIT+ ILSGEFYRNMDLSPLNP+TDR+MICGSP+MIVDMK+LL
Sbjct: 181 KLKYYTTVTQEDYLYKGRITDQILSGEFYRNMDLSPLNPETDRVMICGSPSMIVDMKNLL 240

Query: 241 IAKKFREGSNSRPGTFVVERAFSL 264
           I +KFREGSNSR GTFV+ERAFSL
Sbjct: 241 ITQKFREGSNSRAGTFVIERAFSL 264


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254780364|ref|YP_003064777.1| ferredoxin-NADP+ reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 224 Back     alignment and organism information
>gi|86357697|ref|YP_469589.1| ferredoxin-NADP+ reductase protein [Rhizobium etli CFN 42] Length = 270 Back     alignment and organism information
>gi|218663702|ref|ZP_03519632.1| ferredoxin-NADP+ reductase protein [Rhizobium etli IE4771] Length = 270 Back     alignment and organism information
>gi|190891722|ref|YP_001978264.1| ferredoxin-NADP+ reductase [Rhizobium etli CIAT 652] Length = 270 Back     alignment and organism information
>gi|209549309|ref|YP_002281226.1| oxidoreductase FAD-binding domain protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 270 Back     alignment and organism information
>gi|241204622|ref|YP_002975718.1| Oxidoreductase FAD-binding domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 270 Back     alignment and organism information
>gi|116252121|ref|YP_767959.1| NADPH:ferredoxin reductase [Rhizobium leguminosarum bv. viciae 3841] Length = 270 Back     alignment and organism information
>gi|150396322|ref|YP_001326789.1| oxidoreductase FAD-binding subunit [Sinorhizobium medicae WSM419] Length = 270 Back     alignment and organism information
>gi|227821873|ref|YP_002825843.1| putative NADPH:ferredoxin reductase [Sinorhizobium fredii NGR234] Length = 270 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target264 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
COG1018266 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NADPH r 2e-37
PRK10926248 PRK10926, PRK10926, ferredoxin-NADP reductase; Provisio 1e-31
cd00322223 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD a 9e-20
cd06187224 cd06187, O2ase_reductase_like, The oxygenase reductase 4e-15
cd06183234 cd06183, cyt_b5_reduct_like, Cytochrome b5 reductase ca 1e-12
cd06215231 cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur binding 5e-12
cd06191231 cd06191, FNR_iron_sulfur_binding, Iron-sulfur binding F 3e-11
COG0543252 COG0543, UbiB, 2-polyprenylphenol hydroxylase and relat 2e-10
cd06210236 cd06210, MMO_FAD_NAD_binding, Methane monooxygenase (MM 2e-10
cd06209228 cd06209, BenDO_FAD_NAD, Benzoate dioxygenase reductase 2e-10
cd06214241 cd06214, PA_degradation_oxidoreductase_like, NAD(P) bin 3e-10
KOG0534286 KOG0534, KOG0534, KOG0534, NADH-cytochrome b-5 reductas 5e-10
cd06221253 cd06221, sulfite_reductase_like, Anaerobic sulfite redu 8e-10
cd06216243 cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding 9e-10
cd06217235 cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur binding 1e-09
cd06189224 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin 4e-09
TIGR02160 352 TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenase/red 6e-09
cd06196218 cd06196, FNR_like_1, Ferredoxin reductase-like proteins 3e-07
PRK08345289 PRK08345, PRK08345, cytochrome-c3 hydrogenase subunit g 2e-06
cd06184247 cd06184, flavohem_like_fad_nad_binding, FAD_NAD(P)H bin 6e-06
PLN02252888 PLN02252, PLN02252, nitrate reductase [NADPH] 2e-04
cd06192243 cd06192, DHOD_e_trans_like, FAD/NAD binding domain (ele 0.001
cd06195241 cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase is an 6e-75
pfam0097099 pfam00970, FAD_binding_6, Oxidoreductase FAD-binding do 1e-07
cd06211238 cd06211, phenol_2-monooxygenase_like, Phenol 2-monooxyg 4e-06
cd06190232 cd06190, T4MO_e_transfer_like, Toluene-4-monoxygenase e 1e-05
cd06212232 cd06212, monooxygenase_like, The oxygenase reductase FA 3e-05
cd06194222 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulfur bi 3e-05
PRK05713312 PRK05713, PRK05713, hypothetical protein; Provisional 3e-05
PRK07609339 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucoseen red 0.001
cd06201289 cd06201, SiR_like2, Cytochrome p450- like alpha subunit 7e-06
pfam00175106 pfam00175, NAD_binding_1, Oxidoreductase NAD-binding do 2e-04
>gnl|CDD|31221 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|182844 PRK10926, PRK10926, ferredoxin-NADP reductase; Provisional Back     alignment and domain information
>gnl|CDD|99778 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>gnl|CDD|99784 cd06187, O2ase_reductase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant Back     alignment and domain information
>gnl|CDD|99780 cd06183, cyt_b5_reduct_like, Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor Back     alignment and domain information
>gnl|CDD|99811 cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99788 cd06191, FNR_iron_sulfur_binding, Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|30889 COG0543, UbiB, 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|99806 cd06210, MMO_FAD_NAD_binding, Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol Back     alignment and domain information
>gnl|CDD|99805 cd06209, BenDO_FAD_NAD, Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain Back     alignment and domain information
>gnl|CDD|99810 cd06214, PA_degradation_oxidoreductase_like, NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase Back     alignment and domain information
>gnl|CDD|35754 KOG0534, KOG0534, KOG0534, NADH-cytochrome b-5 reductase [Coenzyme transport and metabolism, Energy production and conversion] Back     alignment and domain information
>gnl|CDD|99817 cd06221, sulfite_reductase_like, Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>gnl|CDD|99812 cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99813 cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99786 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins Back     alignment and domain information
>gnl|CDD|131215 TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>gnl|CDD|99793 cd06196, FNR_like_1, Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>gnl|CDD|181398 PRK08345, PRK08345, cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|99781 cd06184, flavohem_like_fad_nad_binding, FAD_NAD(P)H binding domain of flavohemoglobin Back     alignment and domain information
>gnl|CDD|177894 PLN02252, PLN02252, nitrate reductase [NADPH] Back     alignment and domain information
>gnl|CDD|99789 cd06192, DHOD_e_trans_like, FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>gnl|CDD|99792 cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin Back     alignment and domain information
>gnl|CDD|144531 pfam00970, FAD_binding_6, Oxidoreductase FAD-binding domain Back     alignment and domain information
>gnl|CDD|99807 cd06211, phenol_2-monooxygenase_like, Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol Back     alignment and domain information
>gnl|CDD|99787 cd06190, T4MO_e_transfer_like, Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system Back     alignment and domain information
>gnl|CDD|99808 cd06212, monooxygenase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>gnl|CDD|99791 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|168200 PRK05713, PRK05713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181058 PRK07609, PRK07609, CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>gnl|CDD|99798 cd06201, SiR_like2, Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>gnl|CDD|143941 pfam00175, NAD_binding_1, Oxidoreductase NAD-binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 264 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
PRK10926248 ferredoxin-NADP reductase; Provisional 100.0
cd06195241 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-contai 100.0
cd06214241 PA_degradation_oxidoreductase_like NAD(P) binding domai 100.0
PRK11872340 antC anthranilate dioxygenase reductase; Provisional 100.0
PRK07609337 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated 100.0
cd06188283 NADH_quinone_reductase Na+-translocating NADH:quinone o 100.0
PRK08051232 fre FMN reductase; Validated 100.0
cd06184247 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domai 100.0
cd06189224 flavin_oxioreductase NAD(P)H dependent flavin oxidoredu 100.0
cd06212232 monooxygenase_like The oxygenase reductase FAD/NADH bin 100.0
cd06209228 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FA 100.0
cd06187224 O2ase_reductase_like The oxygenase reductase FAD/NADH b 100.0
cd06191231 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin 100.0
cd06215231 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxi 100.0
cd06216243 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxi 100.0
cd06213227 oxygenase_e_transfer_subunit The oxygenase reductase FA 100.0
cd06210236 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reducta 100.0
cd06211238 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phe 100.0
PRK10684335 HCP oxidoreductase, NADH-dependent; Provisional 100.0
cd06217235 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxi 100.0
PRK13289399 nitric oxide dioxygenase; Provisional 100.0
cd06194222 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferr 100.0
cd06183234 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes th 100.0
cd06190232 T4MO_e_transfer_like Toluene-4-monoxygenase electron tr 100.0
cd06196218 FNR_like_1 Ferredoxin reductase-like proteins catalyze 100.0
PRK05713312 hypothetical protein; Provisional 100.0
PRK05464408 Na(+)-translocating NADH-quinone reductase subunit F; P 100.0
cd00322223 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) 100.0
COG1018266 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) 100.0
TIGR02160 371 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK 100.0
cd06198216 FNR_like_3 NAD(P) binding domain of ferredoxin reductas 100.0
cd06221253 sulfite_reductase_like Anaerobic sulfite reductase cont 100.0
cd06185211 PDR_like Phthalate dioxygenase reductase (PDR) is an FM 100.0
PTZ00319303 NADH-cytochrome B5 reductase; Provisional 100.0
KOG0534286 consensus 100.0
PRK08345292 cytochrome-c3 hydrogenase subunit gamma; Provisional 100.0
cd06208286 CYPOR_like_FNR These ferredoxin reductases are related 100.0
PRK08221263 anaerobic sulfite reductase subunit B; Provisional 100.0
TIGR01941425 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocatin 100.0
PTZ00274325 cytochrome b5 reductase; Provisional 100.0
COG0543252 UbiB 2-polyprenylphenol hydroxylase and related flavodo 100.0
cd06220233 DHOD_e_trans_like2 FAD/NAD binding domain in the electr 100.0
cd06218246 DHOD_e_trans FAD/NAD binding domain in the electron tra 100.0
PRK00054248 dihydroorotate dehydrogenase electron transfer subunit; 100.0
cd06201289 SiR_like2 Cytochrome p450- like alpha subunits of E. co 99.98
cd06200245 SiR_like1 Cytochrome p450- like alpha subunits of E. co 99.97
COG2871410 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, s 99.97
TIGR03224411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protei 99.97
cd06192243 DHOD_e_trans_like FAD/NAD binding domain (electron tran 99.97
cd06197220 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin redu 99.96
COG4097438 Predicted ferric reductase [Inorganic ion transport and 99.96
PRK06222281 ferredoxin-NADP(+) reductase subunit alpha; Reviewed 99.96
cd06182267 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serv 99.96
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the electr 99.96
cd06186210 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes th 99.95
TIGR02911261 sulfite_red_B sulfite reductase, subunit B; InterPro: I 99.95
PRK12778 760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 99.88
KOG3378385 consensus 99.86
PRK06214537 sulfite reductase; Provisional 99.86
KOG0039646 consensus 99.83
PTZ003061167 NADH-dependent fumarate reductase; Provisional 99.83
PRK12779944 putative bifunctional glutamate synthase subunit beta/2 99.78
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 99.73
cd06193235 siderophore_interacting Siderophore interacting protein 99.36
COG2375265 ViuB Siderophore-interacting protein [Inorganic ion tra 99.18
PRK05802328 hypothetical protein; Provisional 99.03
PRK10953599 cysJ sulfite reductase subunit alpha; Provisional 99.93
cd06206384 bifunctional_CYPOR These bifunctional proteins fuse N-t 99.92
cd06202406 Nitric_oxide_synthase The ferredoxin-reductase (FNR) li 99.91
cd06199360 SiR Cytochrome p450- like alpha subunits of E. coli sul 99.9
cd06203398 methionine_synthase_red Human methionine synthase reduc 99.9
COG0369587 CysJ Sulfite reductase, alpha subunit (flavoprotein) [I 99.9
cd06207382 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serv 99.9
KOG1158645 consensus 99.88
cd06204416 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as 99.87
TIGR01931628 cysJ sulfite reductase [NADPH] flavoprotein, alpha-comp 99.86
KOG1159574 consensus 99.78
pfam0097099 FAD_binding_6 Oxidoreductase FAD-binding domain. 99.81
pfam08022103 FAD_binding_8 FAD-binding domain. 98.81
pfam08021116 FAD_binding_9 Siderophore-interacting FAD-binding domai 98.45
pfam00175106 NAD_binding_1 Oxidoreductase NAD-binding domain. Xanthi 99.8
PRK065671048 putative bifunctional glutamate synthase subunit beta/2 99.13
pfam08030148 NAD_binding_6 Ferric reductase NAD binding domain. 99.1
pfam00667217 FAD_binding_1 FAD binding domain. This domain is found 90.27
>PRK10926 ferredoxin-NADP reductase; Provisional Back     alignment and domain information
>cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin Back     alignment and domain information
>cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain Back     alignment and domain information
>PRK08051 fre FMN reductase; Validated Back     alignment and domain information
>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin Back     alignment and domain information
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins Back     alignment and domain information
>cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain Back     alignment and domain information
>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant Back     alignment and domain information
>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain Back     alignment and domain information
>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol Back     alignment and domain information
>cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>PRK13289 nitric oxide dioxygenase; Provisional Back     alignment and domain information
>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain Back     alignment and domain information
>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor Back     alignment and domain information
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system Back     alignment and domain information
>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit; InterPro: IPR011884 Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation , Back     alignment and domain information
>cd06198 FNR_like_3 NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster Back     alignment and domain information
>PTZ00319 NADH-cytochrome B5 reductase; Provisional Back     alignment and domain information
>KOG0534 consensus Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain Back     alignment and domain information
>PRK08221 anaerobic sulfite reductase subunit B; Provisional Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit; InterPro: IPR010205 This entry represents the NqrF subunit of the six-protein, Na(+)-pumping NADH-quinone reductase of a number of marine and pathogenic Gram-negative bacteria Back     alignment and domain information
>PTZ00274 cytochrome b5 reductase; Provisional Back     alignment and domain information
>COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin reductase-like proteins Back     alignment and domain information
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide Back     alignment and domain information
>TIGR02911 sulfite_red_B sulfite reductase, subunit B; InterPro: IPR014260 This entry represents subunit B, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG3378 consensus Back     alignment and domain information
>PRK06214 sulfite reductase; Provisional Back     alignment and domain information
>KOG0039 consensus Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family Back     alignment and domain information
>COG2375 ViuB Siderophore-interacting protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information
>cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) Back     alignment and domain information
>cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain Back     alignment and domain information
>cd06199 SiR Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate Back     alignment and domain information
>COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>KOG1158 consensus Back     alignment and domain information
>cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component; InterPro: IPR010199 This entry describes an NADPH-dependent sulphite reductase flavoprotein subunit Back     alignment and domain information
>KOG1159 consensus Back     alignment and domain information
>pfam00970 FAD_binding_6 Oxidoreductase FAD-binding domain Back     alignment and domain information
>pfam08022 FAD_binding_8 FAD-binding domain Back     alignment and domain information
>pfam08021 FAD_binding_9 Siderophore-interacting FAD-binding domain Back     alignment and domain information
>pfam00175 NAD_binding_1 Oxidoreductase NAD-binding domain Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>pfam08030 NAD_binding_6 Ferric reductase NAD binding domain Back     alignment and domain information
>pfam00667 FAD_binding_1 FAD binding domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target264 ferredoxin-NADP+ reductase protein [Candidatus Liberiba
2bgi_A272 X-Ray Structure Of The Ferredoxin-Nadp(H) Reductase 3e-61
1a8p_A258 Ferredoxin Reductase From Azotobacter Vinelandii Le 3e-61
2qdx_A257 P.Aeruginosa Fpr With Fad Length = 257 4e-61
3fpk_A251 Crystal Structure Of Ferredoxin-Nadp Reductase From 9e-45
1fdr_A248 Flavodoxin Reductase From E. Coli Length = 248 2e-44
2xnj_A266 Crystal Structure Of An Engineered Ferredoxin(Flavo 3e-41
1krh_A338 X-Ray Stucture Of Benzoate Dioxygenase Reductase Le 4e-23
2eix_A243 The Structure Of Physarum Polycephalum Cytochrome B 3e-21
1tvc_A250 Fad And Nadh Binding Domain Of Methane Monooxygenas 1e-18
1gvh_A396 The X-Ray Structure Of Ferric Escherichia Coli Flav 8e-16
3ozu_A403 The Crystal Structure Of Flavohemoglobin From R. Eu 9e-16
1cqx_A403 Crystal Structure Of The Flavohemoglobin From Alcal 9e-16
1ndh_A272 Crystal Structure Of Nadh-Cytochrome B5 Reductase F 3e-15
1umk_A275 The Structure Of Human Erythrocyte Nadh-Cytochrome 2e-14
1ib0_A274 Crystal Structure Of Rat B5r In Complex With Fad An 5e-14
1qx4_A274 Structrue Of S127p Mutant Of Cytochrome B5 Reductas 5e-14
1qfj_A232 Crystal Structure Of Nad(P)h:flavin Oxidoreductase 2e-13
1cnf_A270 Structural Studies On Corn Nitrate Reductase: Refin 2e-11
2pia_A321 Phthalate Dioxygenase Reductase: A Modular Structur 5e-10
1cne_A270 Structural Studies On Corn Nitrate Reductase: Refin 1e-09
2xnc_A315 Crystal Structure Of An Engineered Ferredoxin Nadp 1e-09
2r6h_A290 Crystal Structure Of The Domain Comprising The Nad 1e-09
2bmw_A304 Ferredoxin: Nadp+reductase Mutant With Thr 155 Repl 8e-09
2rc5_A314 Refined Structure Of Fnr From Leptospira Interrogan 1e-08
1gaq_A314 Crystal Structure Of The Complex Between Ferredoxin 4e-08
2vyq_A304 Ferredoxin:nadp Reductase Mutant With Thr 155 Repla 9e-08
1jb9_A316 Crystal Structure Of The Ferredoxin:nadp+ Reductase 1e-07
1h42_A304 Ferredoxin:nadp+ Reductase Mutant With Thr 155 Repl 1e-07
3lvb_A311 Crystal Structure Of The Ferredoxin:nadp+ Reductase 1e-07
3lo8_A311 Crystal Structure Of The Oxidized Form Of Ferredoxi 1e-07
1ogj_A303 Ferredoxin:nadp+ Reductase Mutant With Leu 263 Repl 2e-07
1qfy_A308 Pea Fnr Y308s Mutant In Complex With Nadp+ Length = 1e-06
3mhp_A296 Fnr-Recruitment To The Thylakoid Length = 296 1e-06
1qg0_A308 Wild-Type Pea Fnr Length = 308 1e-06
1bjk_A295 Ferredoxin:nadp+ Reductase Mutant With Arg 264 Repl 2e-06
1qga_A308 Pea Fnr Y308w Mutant In Complex With Nadp+ Length = 2e-06
1ogi_A303 Ferredoxin:nadp+ Reductase Mutant With Thr 155 Repl 3e-06
1quf_A304 X-Ray Structure Of A Complex Nadp+-Ferredoxin:nadp+ 3e-06
1bqe_A295 Ferredoxin:nadp+ Reductase Mutant With Thr 155 Repl 3e-06
1sm4_A296 Crystal Structure Analysis Of The Ferredoxin-Nadp+ 4e-06
1ewy_A303 Anabaena Pcc7119 Ferredoxin:ferredoxin-Nadp+-Reduct 4e-06
1e62_A304 Ferredoxin:nadp+ Reductase Mutant With Lys 75 Repla 4e-06
2bsa_A303 Ferredoxin-Nadp Reductase (Mutation: Y 303 S) Compl 4e-06
1gr1_A303 Structure Of Ferredoxin-Nadp+ Reductase With Glu 13 5e-06
2x3u_A303 Ferredoxin-Nadp Reductase Mutant With Tyr 303 Repla 5e-06
1h85_A295 Ferredoxin:nadp+ Reductase Mutant With Val 136 Repl 5e-06
1que_A303 X-Ray Structure Of The Ferredoxin:nadp+ Reductase F 5e-06
1qgz_A295 Ferredoxin:nadp+ Reductase Mutant With Leu 78 Repla 5e-06
2b5o_A402 Ferredoxin-Nadp Reductase Length = 402 5e-06
1w34_A304 Ferredoxin-Nadp Reductase (Mutation: Y 303 S) Lengt 5e-06
1e63_A304 Ferredoxin:nadp+ Reductase Mutant With Lys 75 Repla 5e-06
1e64_A304 Ferredoxin:nadp+ Reductase Mutant With Lys 75 Repla 5e-06
1qh0_A295 Ferredoxin:nadp+ Reductase Mutant With Leu 76 Mutat 6e-06
1b2r_A304 Ferredoxin-Nadp+ Reductase (Mutation: E 301 A) Leng 6e-06
1qgy_A295 Ferredoxin:nadp+ Reductase Mutant With Lys 75 Repla 6e-06
1gjr_A304 Ferredoxin-Nadp+ Reductase Complexed With Nadp+ By 7e-06
1go2_A304 Structure Of Ferredoxin-Nadp+ Reductase With Lys 72 7e-06
1w35_A304 Ferredoxin-Nadp+ Reductase (Mutation: Y 303 W) Leng 8e-06
1fnb_A314 Refined Crystal Structure Of Spinach Ferredoxin Red 3e-05
1bx0_A314 Ferredoxin:nadp+ Oxidoreductase (Ferredoxin Reducta 4e-05
1frq_A314 Ferredoxin:nadp+ Oxidoreductase (Ferredoxin Reducta 4e-05
1bx1_A314 Ferredoxin:nadp+ Oxidoreductase (Ferredoxin Reducta 4e-05
1ep3_B262 Crystal Structure Of Lactococcus Lactis Dihydroorot 3e-04
1ep1_B261 Crystal Structure Of Lactococcus Lactis Dihydroorot 3e-04
1frn_A314 The Involvement Of Ser96 In The Catalytic Mechanism 3e-04
1tll_A688 Crystal Structure Of Rat Neuronal Nitric-Oxide Synt 6e-05
1f20_A435 Crystal Structure Of Rat Neuronal Nitric-Oxide Synt 8e-05
1ddg_A374 Crystal Structure Of Sir-Fp60 Length = 374 0.001
>gi|78101589|pdb|2BGI|A Chain A, X-Ray Structure Of The Ferredoxin-Nadp(H) Reductase From Rhodobacter Capsulatus Complexed With Three Molecules Of The Detergent N-Heptyl-Beta-D-Thioglucoside At 1.7 Angstroms Length = 272 Back     alignment and structure
 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 131/264 (49%), Positives = 191/264 (72%), Gaps = 3/264 (1%)

Query: 3   DVSPKLPVN--VYCESVISIKHYTDRLFRFCITRPKSFRFRSGEFVMLGL-MVNGRRISR 59
           + +P  P       ++V S++H+TD LF F +TRP++ RFRSGEFVM+GL   NG+ I R
Sbjct: 5   ETTPIAPAKVLPDAQTVTSVRHWTDTLFSFRVTRPQTLRFRSGEFVMIGLLDDNGKPIMR 64

Query: 60  AYSMASPCWDDKLEFFSIKVEQGPLTTHLQNIQPGDTILLHKKSTGTLVLDALIPGNRLY 119
           AYS+ASP WD++LEF+SIKV  GPLT+ LQ+I+ G+ I+L  K  GTLV+DAL+PG RL+
Sbjct: 65  AYSIASPAWDEELEFYSIKVPDGPLTSRLQHIKVGEQIILRPKPVGTLVIDALLPGKRLW 124

Query: 120 LFSTGTGIAPFVSVIRDPGTYEKFDEVIVTQTCRQVVELQYGIDVMHEISQDEILKDLIG 179
             +TGTGIAPF S++R+P  YEKFDEVI+   CR V EL+YG  ++  + +D ++ +L+ 
Sbjct: 125 FLATGTGIAPFASLMREPEAYEKFDEVIMMHACRTVAELEYGRQLVEALQEDPLIGELVE 184

Query: 180 QKLKFYRTVTQEDYLYKGRITNHILSGEFYRNMDLSPLNPDTDRIMICGSPTMIVDMKDL 239
            KLK+Y T T+E++ + GRIT+++ SG+ + ++ ++P+NP+TDR M+CGS    VD+  +
Sbjct: 185 GKLKYYPTTTREEFHHMGRITDNLASGKVFEDLGIAPMNPETDRAMVCGSLAFNVDVMKV 244

Query: 240 LIAKKFREGSNSRPGTFVVERAFS 263
           L +   REG+NS P  FVVE+AF 
Sbjct: 245 LESYGLREGANSEPREFVVEKAFV 268


gi|157829742|pdb|1A8P|A Chain A, Ferredoxin Reductase From Azotobacter Vinelandii Length = 258 Back     alignment and structure
>gi|159795221|pdb|2QDX|A Chain A, P.Aeruginosa Fpr With Fad Length = 257 Back     alignment and structure
>gi|222447122|pdb|3FPK|A Chain A, Crystal Structure Of Ferredoxin-Nadp Reductase From Salmonella Typhimurium Length = 251 Back     alignment and structure
>gi|157831052|pdb|1FDR|A Chain A, Flavodoxin Reductase From E. Coli Length = 248 Back     alignment and structure
>gi|323714333|pdb|2XNJ|A Chain A, Crystal Structure Of An Engineered Ferredoxin(Flavodoxin) Nadp(H) Reductase (Fpr) From Escherichia Coli Length = 266 Back     alignment and structure
>gi|21465902|pdb|1KRH|A Chain A, X-Ray Stucture Of Benzoate Dioxygenase Reductase Length = 338 Back     alignment and structure
>gi|146387239|pdb|2EIX|A Chain A, The Structure Of Physarum Polycephalum Cytochrome B5 Reductase Length = 243 Back     alignment and structure
>gi|159163077|pdb|1TVC|A Chain A, Fad And Nadh Binding Domain Of Methane Monooxygenase Reductase From Methylococcus Capsulatus (Bath) Length = 250 Back     alignment and structure
gi|23200077|pdb|1GVH|A Chain A, The X-Ray Structure Of Ferric Escherichia Coli Flavohemoglobin Reveals An Unespected Geometry Of The Distal Heme Pocket Length = 396 Back     alignment and structure
gi|326327956|pdb|3OZU|A Chain A, The Crystal Structure Of Flavohemoglobin From R. Eutrophus In Complex With Miconazole Length = 403 Back     alignment and structure
>gi|6137667|pdb|1CQX|A Chain A, Crystal Structure Of The Flavohemoglobin From Alcaligenes Eutrophus At 1.75 A Resolution Length = 403 Back     alignment and structure
gi|157832094|pdb|1NDH|A Chain A, Crystal Structure Of Nadh-Cytochrome B5 Reductase From Pig Liver At 2.4 Angstroms Resolution Length = 272 Back     alignment and structure
>gi|56554196|pdb|1UMK|A Chain A, The Structure Of Human Erythrocyte Nadh-Cytochrome B5 Reductase Length = 275 Back     alignment and structure
>gi|17943396|pdb|1IB0|A Chain A, Crystal Structure Of Rat B5r In Complex With Fad And Nad Length = 274 Back     alignment and structure
>gi|55669578|pdb|1QX4|A Chain A, Structrue Of S127p Mutant Of Cytochrome B5 Reductase Length = 274 Back     alignment and structure
>gi|5107658|pdb|1QFJ|A Chain A, Crystal Structure Of Nad(P)h:flavin Oxidoreductase From Escherichia Coli Length = 232 Back     alignment and structure
>gi|157830650|pdb|1CNF|A Chain A, Structural Studies On Corn Nitrate Reductase: Refined Structure Of The Cytochrome B Reductase Fragment At 2.5 Angstroms, Its Adp Complex And An Active Site Mutant And Modeling Of The Cytochrome B Domain Length = 270 Back     alignment and structure
>gi|157835682|pdb|2PIA|A Chain A, Phthalate Dioxygenase Reductase: A Modular Structure For Electron Transfer From Pyridine Nucleotides To [2fe-2s] Length = 321 Back     alignment and structure
>gi|157830649|pdb|1CNE|A Chain A, Structural Studies On Corn Nitrate Reductase: Refined Structure Of The Cytochrome B Reductase Fragment At 2.5 Angstroms, Its Adp Complex And An Active Site Mutant And Modeling Of The Cytochrome B Domain Length = 270 Back     alignment and structure
>gi|323714331|pdb|2XNC|A Chain A, Crystal Structure Of An Engineered Ferredoxin Nadp Reductase (Fnr) From Pisum Sativum Length = 315 Back     alignment and structure
>gi|158430640|pdb|2R6H|A Chain A, Crystal Structure Of The Domain Comprising The Nad Binding And The Fad Binding Regions Of The Nadh:ubiquinone Oxidoreductase, Na Translocating, F Subunit From Porphyromonas Gingivalis Length = 290 Back     alignment and structure
>gi|110590891|pdb|2BMW|A Chain A, Ferredoxin: Nadp+reductase Mutant With Thr 155 Replaced By Gly, Ala 160 Replaced By Thr, Leu 263 Replaced By Pro, Arg 264 Replaced By Pro And Gly 265 Replaced By Pro (T155g- A160t-L263p-R264p-G265p) Length = 304 Back     alignment and structure
>gi|170785009|pdb|2RC5|A Chain A, Refined Structure Of Fnr From Leptospira Interrogans Length = 314 Back     alignment and structure
>gi|13096165|pdb|1GAQ|A Chain A, Crystal Structure Of The Complex Between Ferredoxin And Ferredoxin-Nadp+ Reductase Length = 314 Back     alignment and structure
>gi|227343658|pdb|2VYQ|A Chain A, Ferredoxin:nadp Reductase Mutant With Thr 155 Replaced By Gly, Ala 160 Replaced By Thr, Leu 263 Replaced By Pro And Tyr 303 Replaced By Ser (T155g-A160t-L263p-Y303s) Length = 304 Back     alignment and structure
>gi|14719468|pdb|1JB9|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase From Maize Root At 1.7 Angstroms Length = 316 Back     alignment and structure
>gi|37926401|pdb|1H42|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Thr 155 Replaced By Gly, Ala 160 Replaced By Thr And Leu 263 Replaced By Pro (T155g-A160t-L263p) Length = 304 Back     alignment and structure
>gi|291191325|pdb|3LVB|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase From Maize Root At 1.7 Angstroms - Test Set Withheld Length = 311 Back     alignment and structure
>gi|291191259|pdb|3LO8|A Chain A, Crystal Structure Of The Oxidized Form Of Ferredoxin:nadp+ Reductase From Maize Root At 1.05 Angstroms Length = 311 Back     alignment and structure
>gi|37927145|pdb|1OGJ|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Leu 263 Replaced By Pro (L263p) Length = 303 Back     alignment and structure
>gi|4930119|pdb|1QFY|A Chain A, Pea Fnr Y308s Mutant In Complex With Nadp+ Length = 308 Back     alignment and structure
>gi|310689811|pdb|3MHP|A Chain A, Fnr-Recruitment To The Thylakoid Length = 296 Back     alignment and structure
>gi|4930123|pdb|1QG0|A Chain A, Wild-Type Pea Fnr Length = 308 Back     alignment and structure
>gi|157830348|pdb|1BJK|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Arg 264 Replaced By Glu (R264e) Length = 295 Back     alignment and structure
>gi|4930128|pdb|1QGA|A Chain A, Pea Fnr Y308w Mutant In Complex With Nadp+ Length = 308 Back     alignment and structure
>gi|37927143|pdb|1OGI|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Thr 155 Replaced By Gly And Ala 160 Replaced By Thr (T155g-A160t) Length = 303 Back     alignment and structure
>gi|157833612|pdb|1QUF|A Chain A, X-Ray Structure Of A Complex Nadp+-Ferredoxin:nadp+ Reductase From The Cyanobacterium Anabaena Pcc 7119 At 2.25 Angstroms Length = 304 Back     alignment and structure
>gi|20149792|pdb|1BQE|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Thr 155 Replaced By Gly (T155g) Length = 295 Back     alignment and structure
>gi|47169163|pdb|1SM4|A Chain A, Crystal Structure Analysis Of The Ferredoxin-Nadp+ Reductase From Paprika Length = 296 Back     alignment and structure
>gi|13096126|pdb|1EWY|A Chain A, Anabaena Pcc7119 Ferredoxin:ferredoxin-Nadp+-Reductase Complex Length = 303 Back     alignment and structure
>gi|14488721|pdb|1E62|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Lys 75 Replaced By Arg (K75r) Length = 304 Back     alignment and structure
>gi|82408144|pdb|2BSA|A Chain A, Ferredoxin-Nadp Reductase (Mutation: Y 303 S) Complexed With Nadp Length = 303 Back     alignment and structure
>gi|24987261|pdb|1GR1|A Chain A, Structure Of Ferredoxin-Nadp+ Reductase With Glu 139 Replaced By Lys (E139k) Length = 303 Back     alignment and structure
>gi|296863364|pdb|2X3U|A Chain A, Ferredoxin-Nadp Reductase Mutant With Tyr 303 Replaced By Phe (Y303f) Length = 303 Back     alignment and structure
>gi|17942836|pdb|1H85|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Val 136 Replaced By Leu (V136l) Length = 295 Back     alignment and structure
>gi|157833611|pdb|1QUE|A Chain A, X-Ray Structure Of The Ferredoxin:nadp+ Reductase From The Cyanobacterium Anabaena Pcc 7119 At 1.8 Angstroms Length = 303 Back     alignment and structure
>gi|20151222|pdb|1QGZ|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Leu 78 Replaced By Asp (L78d) Length = 295 Back     alignment and structure
gi|82408009|pdb|2B5O|A Chain A, Ferredoxin-Nadp Reductase Length = 402 Back     alignment and structure
>gi|82407344|pdb|1W34|A Chain A, Ferredoxin-Nadp Reductase (Mutation: Y 303 S) Length = 304 Back     alignment and structure
>gi|14488722|pdb|1E63|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Lys 75 Replaced By Ser (K75s) Length = 304 Back     alignment and structure
>gi|14488723|pdb|1E64|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Lys 75 Replaced By Gln (K75q) Length = 304 Back     alignment and structure
>gi|20151223|pdb|1QH0|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Leu 76 Mutated By Asp And Leu 78 Mutated By Asp Length = 295 Back     alignment and structure
>gi|6730081|pdb|1B2R|A Chain A, Ferredoxin-Nadp+ Reductase (Mutation: E 301 A) Length = 304 Back     alignment and structure
>gi|47168638|pdb|1QGY|A Chain A, Ferredoxin:nadp+ Reductase Mutant With Lys 75 Replaced By Glu (K75e) Length = 295