254780382

254780382

ATP dependent RNA helicase protein

GeneID in NCBI database:8209367Locus tag:CLIBASIA_01335
Protein GI in NCBI database:254780382Protein Accession:YP_003064795.1
Gene range:+(278091, 279488)Protein Length:465aa
Gene description:ATP dependent RNA helicase protein
COG prediction:[L] [K] [J] Superfamily II DNA and RNA helicases
KEGG prediction:ATP dependent RNA helicase protein
SEED prediction:ATP-dependent RNA helicase Atu1833
Pathway involved in KEGG:not defined
Subsystem involved in SEED:ATP-dependent RNA helicases, bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-----
MDFADLGLSPKVVCAVLDAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPMLTILEKGRARVRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLVAKEDIKHIDAIEKLIEKKVDWLNGDLSSLNPPLEKIDIAQHNHARKNNPIPQKSTGFDRRKKNYSSQKSHIPLKESEKISKLQQDIQENDADSLGFRGNMPAFMLPKNRGKLNDKL
ccHHHccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccEEEEcHHHHHHHHHccccccccccEEEEEcccccccccHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHcccccEEEEEcccccccccEEEEEEEccccHHHHHHHHHHHHHHcccccccEEEccHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHccccEEEEEccHHHcccccccccEEEEccccccHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccHHHcccccccccccc
ccHHHccccHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHEHcccccccHHHHHHHHHHHHcccccccccEEEEEccHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHcHHccEEEEcHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEcEccccccccEEEEEEEEcccHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHccccEHHHcccccHHHHHHHHHHHHccccEEEEEEcHHHcccccccccEEEEEcccccccHEEEEEccccccccccEEEEEEcccHHHHHHHHHHHHHHccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccc
mdfadlglspkVVCAVLdagyvkptpiqiktiplvlqrhdvcgiaqtgtgktasfvLPMLTILEKgrarvrmprtlilePTRELAAQVADNFEKYGKNYNLTVALLIGGipfeaqnkklergadvlictpgrildhfnrgkllmnNIEILVIDEAdrmldmgfipyiqNITSLVPFTRQTLLFSATMTDELQKVSENflqnpkrievntpsstaetiEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSLEKqgfsvcaihgnidqRSRMKILSNFKEGTIQLMVASDLaargldipdvghvfnfdvpnraenyihrigrtgragrhgkAFTLVAKEDIKHIDAIEKLIEKKVDWlngdlsslnpplekidiaqhnharknnpipqkstgfdrrkknyssqkshiplkesEKISKLQQDIQendadslgfrgnmpafmlpknrgklndkl
mdfadlglspKVVCAVLDAGYVKPTPIQIKTIPLVLQRHDVCGIAqtgtgktasfvlPMLTIlekgrarvrMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADVLICTPGRILdhfnrgkllmNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSenflqnpkrievntpsstaETIEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPNRAENYIHRigrtgragrhgKAFTLVAKEDIKHIDAIEKLIEKKVDWLNGDLSSLNPPLEKIDIaqhnharknnpipqkstgfdrrkknyssqkshiplkeseKISKLQQDIQENDADSLGFrgnmpafmlpknrgklndkl
MDFADLGLSPKVVCAVLDAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPMLTILEKGRARVRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLVAKEDIKHIDAIEKLIEKKVDWLNGDLSSLNPPLEKIDIAQHNHARKNNPIPQKSTGFDRRKKNYSSQKSHIPLKESEKISKLQQDIQENDADSLGFRGNMPAFMLPKNRGKLNDKL
MDFADLGLSPKVVCAVLDAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPML***************LILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLVAKEDIKHIDAIEKLIEKKVDWLNG********************************************************************************************
MDFADLGLSPKVVCAVLDAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPMLTILEKGRARVRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLVAKEDIKHIDAIEKLIEKKVDWLNGDLSSLNPPLEKIDIAQHNHARKNNPIPQKST**************HIPLKESEKISKLQQDIQENDADSLGFRGNMPAFMLPKNRGKLNDKL
*DF*DLGLSPKVVCAVLDAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPMLTILEKGRARVRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLVAKEDIKHIDAIEKLIEKKVDWLNGDLSSL***************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFADLGLSPKVVCAVLDAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPMLTILEKGRARVRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLVAKEDIKHIDAIEKLIEKKVDWLNGDLSSLNPPLEKIDIAQHNHARKNNPIPQKSTGFDRRKKNYSSQKSHIPLKESEKISKLQQDIQENDADSLGFRGNMPAFMLPKNRGKLNDKL
MDFADLGLSPKVVCAVLDAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPMLTILEKGRARVRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLVAKEDIKHIDAIEKLIEKKVDWLNGDLSSLNPPLEKIDIAQHNHARKNNPIPQKSTGFDRRKKNYSSQKSHIPLKESEKISKLQQDIQENDADSLGFRGNMPAFMLPKNRGKLNDKL
MDFADLGLSPKVVCAVLDAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPMLTILEKGRARVRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLVAKEDIKHIDAIEKLIEKKVDWLNGDLSSLNPPLEKIDIAQHNHARKNNPIPQKSTGFDRRKKNYSSQKSHIPLKESEKISKLQQDIQENDADSLGFRGNMPAFMLPKNRGKLNDKL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target465 ATP dependent RNA helicase protein [Candidatus Liberiba
254780601 573 ATP-dependent RNA helicase protein [Candidatus Lib 1e-50
254780945700 ATP-dependent DNA helicase RecG [Candidatus Liberi 2e-10
254780991805 excinuclease ABC subunit B [Candidatus Liberibacte 3e-04
254780129220 hypothetical protein CLIBASIA_00040 [Candidatus Li 4e-04
>gi|254780601|ref|YP_003065014.1| ATP-dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 573 Back     alignment
 Score =  192 bits (488), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 111/344 (32%), Positives = 188/344 (54%), Gaps = 7/344 (2%)

Query: 10  PKVVCAVL-DAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPMLTILEKGRA 68
           P+V+   L + GYV  T +Q   +   L+  DV   AQTG+GKT +F L + + L     
Sbjct: 8   PQVIGEALSERGYVNLTSVQEAILNPDLREKDVLVSAQTGSGKTVAFGLALASTLLAEND 67

Query: 69  R---VRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLERGADV 125
           R      P  L + PTRELA QV    E       + VA+ IGG+    + + L+ GA +
Sbjct: 68  RFSPASAPLALAIAPTRELAVQVGRELEWLYAKTGVVVAVCIGGVSVHRERRDLQNGAHI 127

Query: 126 LICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQTLLFSA 185
           ++ TPGR+ DH     L +++++ +V+DEAD MLD+GF   I+ I    P  R+ L+FSA
Sbjct: 128 VVGTPGRLCDHIRGKGLNISHLKAVVLDEADEMLDLGFRDDIEFILDSSPKKRRMLMFSA 187

Query: 186 TMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQSQDTM 245
           T++  +  +++N+ ++  R+ + + +     I+  + A     S +   +  +L+     
Sbjct: 188 TISPAITTLAKNYQKDAVRVNIASENRQHSDID--YRAVLVALSDRDNAIVNILRYHGA- 244

Query: 246 KNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLA 305
           KN I+FC+ + +V      L +  F V A+ G + Q+ R   L   ++G  ++ +A+D+A
Sbjct: 245 KNAIVFCSTRASVSRFTKVLAEHLFQVVALSGELSQQERSNALQMMRDGRARVCIATDVA 304

Query: 306 ARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLV 349
           ARG+D+PD+  V + ++ +  EN +HR GRTGRAGR G +  ++
Sbjct: 305 ARGIDLPDLELVIHAELSSNPENLLHRSGRTGRAGRKGMSVFVI 348

>gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Back     alignment
 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 137/308 (44%), Gaps = 38/308 (12%)

Query: 47  TGTGKTASFVLPMLTILEKGRARVRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALL 106
            G+GKT   ++ M   +E G       + +I+ P   LA Q  +  +KY +N  + V ++
Sbjct: 302 VGSGKTLVALIAMAAAVEAG------GQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEII 355

Query: 107 IGGIPFEAQNKKLER----GADVLICTPGRILDHFNRGKLLMNNIEILVIDEADR----- 157
            G +P   + K LER     A ++I T     D     KL++     +++DE  R     
Sbjct: 356 TGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLIL-----VIVDEQHRFGVQQ 410

Query: 158 ---MLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFL-QNPKRIEVNTPSST 213
              +      P++  +T+  P  R TL+ ++    ++ K++E    + P +  +   +  
Sbjct: 411 RLKLTQKATAPHVLLMTA-TPIPR-TLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRI 468

Query: 214 AETIEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQKKNVVNLCHSL-EKQGFSV 272
            E IE   V   ++  K   +  Q+ + +++           ++VV   +SL E    S+
Sbjct: 469 DEVIERLKV-VLSEGKKAYWICPQIEEKKES---------NFRSVVERFNSLHEHFTSSI 518

Query: 273 CAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPNRAENYIHR 332
             IHG +    +  ++ +FK GT +L++A+ +   G+D+ D   +   +  +     +H+
Sbjct: 519 AIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQ 578

Query: 333 I-GRTGRA 339
           + GR GR 
Sbjct: 579 LRGRVGRG 586

>gi|254780991|ref|YP_003065404.1| excinuclease ABC subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Back     alignment
 Score = 38.1 bits (87), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 51/117 (43%), Gaps = 8/117 (6%)

Query: 255 KKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDV 314
           K+   +L   L ++   V  +H  +    R++I+ + + G   ++V  +L   GLDIP+ 
Sbjct: 592 KRMAEDLTEYLYERNIRVRYMHSEVKTLERIEIIRDLRLGKFDVLVGINLLREGLDIPEC 651

Query: 315 GHVFNFDVPNRA--ENYIHRIGRTGRAGRHGKAFTLVAKEDIKHIDAIEKLIEKKVD 369
           G V   D        +    I   GRA R+      V  + I + D I K I+  +D
Sbjct: 652 GLVAILDADKEGFLRSKTSLIQTIGRAARN------VNSKVILYADTITKSIQLAID 702

>gi|254780129|ref|YP_003064542.1| hypothetical protein CLIBASIA_00040 [Candidatus Liberibacter asiaticus str. psy62] Length = 220 Back     alignment
 Score = 37.7 bits (86), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 9/85 (10%)

Query: 26  PIQIKTIPLVLQRHDVCGI-AQTGTGKTASFVLPMLTILEKGRARVRMPR-TLILEPTRE 83
           P QI  +  +L  HD C + A  G+GKT S +  + TI      ++  PR  LI+ P R 
Sbjct: 7   PHQIVMVNWLLS-HDRCALWASMGSGKTVSVLFALSTI------KILDPRPVLIIAPLRV 59

Query: 84  LAAQVADNFEKYGKNYNLTVALLIG 108
                 D  E++    ++TV+ LIG
Sbjct: 60  AQYVWKDEVERWSAFSDMTVSSLIG 84

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target465 ATP dependent RNA helicase protein [Candidatus Liberiba
315122206459 ATP dependent RNA helicase protein [Candidatus Liberiba 1 0.0
222086115506 ATP dependent RNA helicase protein [Agrobacterium radio 1 1e-162
241204840521 DEAD/DEAH box helicase [Rhizobium leguminosarum bv. tri 1 1e-160
327191069499 ATP-dependent RNA helicase protein [Rhizobium etli CNPA 1 1e-160
190891965527 ATP-dependent RNA helicase [Rhizobium etli CIAT 652] Le 1 1e-160
86357880527 ATP dependent RNA helicase protein [Rhizobium etli CFN 1 1e-160
116252340521 cold-shock DeaD-box protein A (ATP-dependent RNA helica 1 1e-160
218674642420 DEAD/DEAH box helicase domain protein [Rhizobium etli G 1 1e-159
218462794398 ATP dependent RNA helicase protein [Rhizobium etli Kim 1 1e-159
227822081501 ATP-dependent RNA helicase [Sinorhizobium fredii NGR234 1 1e-158
>gi|315122206|ref|YP_004062695.1| ATP dependent RNA helicase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 459 Back     alignment and organism information
 Score =  770 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/458 (80%), Positives = 406/458 (88%), Gaps = 1/458 (0%)

Query: 1   MDFADLGLSPKVVCAVLDAGYVKPTPIQIKTIPLVLQRHDVCGIAQTGTGKTASFVLPML 60
           M+F+DLGLSPKVVCAV DAGYV PTPIQ+KTIPLVLQRHDVCGIAQTGTGKTASFVLPML
Sbjct: 1   MNFSDLGLSPKVVCAVADAGYVDPTPIQVKTIPLVLQRHDVCGIAQTGTGKTASFVLPML 60

Query: 61  TILEKGRARVRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALLIGGIPFEAQNKKLE 120
           TILEKGRAR RMPRTLILEPTRELA+QVADNF+KYGKNYNL +ALLIGGIPFE QNKKLE
Sbjct: 61  TILEKGRARARMPRTLILEPTRELASQVADNFQKYGKNYNLNIALLIGGIPFETQNKKLE 120

Query: 121 RGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPYIQNITSLVPFTRQT 180
           RGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIP IQ+ITSL+PFTRQT
Sbjct: 121 RGADVLICTPGRILDHFNRGKLLMNNIEILVIDEADRMLDMGFIPDIQSITSLIPFTRQT 180

Query: 181 LLFSATMTDELQKVSENFLQNPKRIEVNTPSSTAETIEHCFVATYAQYSKKCALLQQLLQ 240
           LLFSATMT+ELQKVSE FLQNPKRIEVNTP STAETIEHCFVATY QYSKK  L+Q+L++
Sbjct: 181 LLFSATMTEELQKVSEKFLQNPKRIEVNTPYSTAETIEHCFVATYPQYSKKFGLVQKLIR 240

Query: 241 SQDTMKNGIIFCNQKKNVVNLCHSLEKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMV 300
            QD +KN IIFCNQKK+V +LC +LEKQGFSVCAIHGN+DQRSR+KIL +FKEGTIQLMV
Sbjct: 241 EQDAIKNAIIFCNQKKDVASLCCALEKQGFSVCAIHGNMDQRSRIKILDSFKEGTIQLMV 300

Query: 301 ASDLAARGLDIPDVGHVFNFDVPNRAENYIHRIGRTGRAGRHGKAFTLVAKEDIKHIDAI 360
           ASDLAARGLDIPDVGHVFNFDVPNR ENYIHRIGRTGRAGR GKAFTLV  ED+K+IDAI
Sbjct: 301 ASDLAARGLDIPDVGHVFNFDVPNRPENYIHRIGRTGRAGRSGKAFTLVTSEDVKYIDAI 360

Query: 361 EKLIEKKVDWLNGDLSSLNPPLEKIDIAQHNHARKNNPIPQKSTGFDRRKKNYSSQKSHI 420
           EKLIEKK+ WL+GDLS+L P  EK+D  Q ++  KN  I   ST    +KK YSSQ S I
Sbjct: 361 EKLIEKKISWLDGDLSTLQPS-EKLDETQRSNTTKNKNIQNTSTKLSHKKKKYSSQTSRI 419

Query: 421 PLKESEKISKLQQDIQENDADSLGFRGNMPAFMLPKNR 458
           P KE   IS+  QD QE+D  ++GF+GN+PAFMLP+ +
Sbjct: 420 PSKEEVVISQPYQDTQEHDIGAVGFKGNVPAFMLPREK 457


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086115|ref|YP_002544647.1| ATP dependent RNA helicase protein [Agrobacterium radiobacter K84] Length = 506 Back     alignment and organism information
>gi|241204840|ref|YP_002975936.1| DEAD/DEAH box helicase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 521 Back     alignment and organism information
>gi|327191069|gb|EGE58122.1| ATP-dependent RNA helicase protein [Rhizobium etli CNPAF512] Length = 499 Back     alignment and organism information
>gi|190891965|ref|YP_001978507.1| ATP-dependent RNA helicase [Rhizobium etli CIAT 652] Length = 527 Back     alignment and organism information
>gi|86357880|ref|YP_469772.1| ATP dependent RNA helicase protein [Rhizobium etli CFN 42] Length = 527 Back     alignment and organism information
>gi|116252340|ref|YP_768178.1| cold-shock DeaD-box protein A (ATP-dependent RNA helicase) [Rhizobium leguminosarum bv. viciae 3841] Length = 521 Back     alignment and organism information
>gi|218674642|ref|ZP_03524311.1| DEAD/DEAH box helicase domain protein [Rhizobium etli GR56] Length = 420 Back     alignment and organism information
>gi|218462794|ref|ZP_03502885.1| ATP dependent RNA helicase protein [Rhizobium etli Kim 5] Length = 398 Back     alignment and organism information
>gi|227822081|ref|YP_002826052.1| ATP-dependent RNA helicase [Sinorhizobium fredii NGR234] Length = 501 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target465 ATP dependent RNA helicase protein [Candidatus Liberiba
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Pr 4e-95
KOG0331519 KOG0331, KOG0331, KOG0331, ATP-dependent RNA helicase [ 3e-92
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Pr 9e-92
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Pr 2e-86
KOG0330476 KOG0330, KOG0330, KOG0330, ATP-dependent RNA helicase [ 4e-85
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Pr 3e-80
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Pr 8e-79
KOG0333673 KOG0333, KOG0333, KOG0333, U5 snRNP-like RNA helicase s 2e-78
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Pr 6e-77
KOG0335482 KOG0335, KOG0335, KOG0335, ATP-dependent RNA helicase [ 9e-72
KOG0336629 KOG0336, KOG0336, KOG0336, ATP-dependent RNA helicase [ 2e-71
KOG0328400 KOG0328, KOG0328, KOG0328, Predicted ATP-dependent RNA 7e-71
KOG0339731 KOG0339, KOG0339, KOG0339, ATP-dependent RNA helicase [ 2e-70
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Pr 1e-69
KOG0327397 KOG0327, KOG0327, KOG0327, Translation initiation facto 8e-69
KOG0342543 KOG0342, KOG0342, KOG0342, ATP-dependent RNA helicase p 3e-67
KOG0341610 KOG0341, KOG0341, KOG0341, DEAD-box protein abstrakt [R 6e-66
KOG0345567 KOG0345, KOG0345, KOG0345, ATP-dependent RNA helicase [ 2e-65
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 2e-65
KOG0337529 KOG0337, KOG0337, KOG0337, ATP-dependent RNA helicase [ 3e-64
KOG0343 758 KOG0343, KOG0343, KOG0343, RNA Helicase [RNA processing 4e-64
KOG0326459 KOG0326, KOG0326, KOG0326, ATP-dependent RNA helicase [ 5e-58
KOG0332477 KOG0332, KOG0332, KOG0332, ATP-dependent RNA helicase [ 9e-57
KOG0347731 KOG0347, KOG0347, KOG0347, RNA helicase [RNA processing 1e-54
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase 5e-54
KOG0346569 KOG0346, KOG0346, KOG0346, RNA helicase [RNA processing 3e-53
KOG0350620 KOG0350, KOG0350, KOG0350, DEAD-box ATP-dependent RNA h 3e-50
KOG0348708 KOG0348, KOG0348, KOG0348, ATP-dependent RNA helicase [ 8e-50
KOG0344593 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [ 8e-48
KOG0329387 KOG0329, KOG0329, KOG0329, ATP-dependent RNA helicase [ 9e-36
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA replica 1e-24
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function pred 1e-19
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 2e-17
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily II [ 1e-15
COG1205 851 COG1205, COG1205, Distinct helicase family with a uniqu 2e-11
KOG0352 641 KOG0352, KOG0352, KOG0352, ATP-dependent DNA helicase [ 4e-10
KOG0920 924 KOG0920, KOG0920, KOG0920, ATP-dependent RNA helicase A 7e-05
KOG0338691 KOG0338, KOG0338, KOG0338, ATP-dependent RNA helicase [ 3e-80
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 8e-72
KOG0340442 KOG0340, KOG0340, KOG0340, ATP-dependent RNA helicase [ 2e-70
KOG0334 997 KOG0334, KOG0334, KOG0334, RNA helicase [RNA processing 2e-66
KOG4284 980 KOG4284, KOG4284, KOG4284, DEAD box protein [Transcript 1e-48
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicases [DN 1e-110
cd00268203 cd00268, DEADc, DEAD-box helicases 3e-67
pfam00270167 pfam00270, DEAD, DEAD/DEAH box helicase 2e-52
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 3e-44
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replication, r 7e-07
KOG0349725 KOG0349, KOG0349, KOG0349, Putative DEAD-box RNA helica 1e-35
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication, rec 5e-10
COG1203733 COG1203, COG1203, Predicted helicases [General function 3e-08
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-30
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 1e-05
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 0.001
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal domain 5e-27
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Pr 2e-12
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ f 1e-11
KOG0351 941 KOG0351, KOG0351, KOG0351, ATP-dependent DNA helicase [ 4e-06
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 4e-06
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like 3e-04
TIGR00631655 TIGR00631, uvrb, excinuclease ABC, B subunit 0.002
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-terminal do 4e-23
smart0049082 smart00490, HELICc, helicase superfamily c-terminal dom 1e-21
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replication, r 3e-08
COG1197 1139 COG1197, Mfd, Transcription-repair coupling factor (sup 2e-04
TIGR00580926 TIGR00580, mfd, transcription-repair coupling factor (m 5e-04
PRK09401 1176 PRK09401, PRK09401, reverse gyrase; Reviewed 7e-10
COG1110 1187 COG1110, COG1110, Reverse gyrase [DNA replication, reco 2e-08
TIGR01054 1171 TIGR01054, rgy, reverse gyrase 3e-08
KOG0353 695 KOG0353, KOG0353, KOG0353, ATP-dependent DNA helicase [ 1e-07
KOG0349 725 KOG0349, KOG0349, KOG0349, Putative DEAD-box RNA helica 1e-07
COG1204 766 COG1204, COG1204, Superfamily II helicase [General func 3e-07
PRK09751 1490 PRK09751, PRK09751, putative ATP-dependent helicase Lhr 2e-04
KOG0952 1230 KOG0952, KOG0952, KOG0952, DNA/RNA helicase MER3/SLH1, 8e-04
KOG0354 746 KOG0354, KOG0354, KOG0354, DEAD-box like helicase [Gene 4e-07
KOG0953 700 KOG0953, KOG0953, KOG0953, Mitochondrial RNA helicase S 0.003
COG1643 845 COG1643, HrpA, HrpA-like helicases [DNA replication, re 2e-06
COG0556663 COG0556, UvrB, Helicase subunit of the DNA excision rep 3e-06
>gnl|CDD|183308 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|35552 KOG0331, KOG0331, KOG0331, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|182572 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|183029 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|35551 KOG0330, KOG0330, KOG0330, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|183247 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|179884 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|35554 KOG0333, KOG0333, KOG0333, U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|179276 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|35556 KOG0335, KOG0335, KOG0335, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35557 KOG0336, KOG0336, KOG0336, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35549 KOG0328, KOG0328, KOG0328, Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35560 KOG0339, KOG0339, KOG0339, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|179861 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|35548 KOG0327, KOG0327, KOG0327, Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35563 KOG0342, KOG0342, KOG0342, ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35562 KOG0341, KOG0341, KOG0341, DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35566 KOG0345, KOG0345, KOG0345, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|35558 KOG0337, KOG0337, KOG0337, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35564 KOG0343, KOG0343, KOG0343, RNA Helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35547 KOG0326, KOG0326, KOG0326, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35553 KOG0332, KOG0332, KOG0332, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35568 KOG0347, KOG0347, KOG0347, RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|177796 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|35567 KOG0346, KOG0346, KOG0346, RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35571 KOG0350, KOG0350, KOG0350, DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35569 KOG0348, KOG0348, KOG0348, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35565 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35550 KOG0329, KOG0329, KOG0329, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|30860 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31394 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|31261 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31398 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|35573 KOG0352, KOG0352, KOG0352, ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|36138 KOG0920, KOG0920, KOG0920, ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35559 KOG0338, KOG0338, KOG0338, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|185453 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|35561 KOG0340, KOG0340, KOG0340, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35555 KOG0334, KOG0334, KOG0334, RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|39485 KOG4284, KOG4284, KOG4284, DEAD box protein [Transcription] Back     alignment and domain information
>gnl|CDD|30859 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|28928 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|144015 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|31308 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35570 KOG0349, KOG0349, KOG0349, Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31393 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|31396 COG1203, COG1203, Predicted helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|28927 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|161975 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|184313 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|28960 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|35572 KOG0351, KOG0351, KOG0351, ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|184313 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|178682 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|161969 TIGR00631, uvrb, excinuclease ABC, B subunit Back     alignment and domain information
>gnl|CDD|144016 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|128766 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|31308 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31390 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|161938 TIGR00580, mfd, transcription-repair coupling factor (mfd) Back     alignment and domain information
>gnl|CDD|181823 PRK09401, PRK09401, reverse gyrase; Reviewed Back     alignment and domain information
>gnl|CDD|31307 COG1110, COG1110, Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|162177 TIGR01054, rgy, reverse gyrase Back     alignment and domain information
>gnl|CDD|35574 KOG0353, KOG0353, KOG0353, ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|35570 KOG0349, KOG0349, KOG0349, Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31397 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|36170 KOG0952, KOG0952, KOG0952, DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35575 KOG0354, KOG0354, KOG0354, DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|36171 KOG0953, KOG0953, KOG0953, Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31829 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|30902 COG0556, UvrB, Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 465 ATP dependent RNA helicase protein [Candidatus Liberiba
PTZ00110602 helicase; Provisional 100.0
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0331519 consensus 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 100.0
KOG0330476 consensus 100.0
KOG0338691 consensus 100.0
KOG0333673 consensus 100.0
KOG0328400 consensus 100.0
KOG0342543 consensus 100.0
KOG0345567 consensus 100.0
KOG0343 758 consensus 100.0
KOG0334 997 consensus 100.0
KOG0336629 consensus 100.0
KOG0335482 consensus 100.0
KOG0348708 consensus 100.0
KOG0339731 consensus 100.0
KOG0347731 consensus 100.0
KOG0326459 consensus 100.0
KOG0341610 consensus 100.0
KOG0327397 consensus 100.0
KOG0337529 consensus 100.0
KOG0344593 consensus 100.0
KOG4284 980 consensus 100.0
KOG0332477 consensus 100.0
KOG0350620 consensus 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
TIGR01389 607 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR0062 100.0
PRK13767 878 ATP-dependent helicase; Provisional 100.0
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 100.0
KOG0349725 consensus 100.0
KOG0329387 consensus 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, reco 100.0
PRK02362 736 ski2-like helicase; Provisional 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
TIGR00614497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 100.0
PRK00254 717 ski2-like helicase; Provisional 100.0
PRK13766 764 Hef nuclease; Provisional 100.0
COG1205 851 Distinct helicase family with a unique C-terminal domai 100.0
KOG0351 941 consensus 100.0
COG1204 766 Superfamily II helicase [General function prediction on 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recombinati 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General func 100.0
KOG0352 641 consensus 100.0
KOG0354 746 consensus 100.0
TIGR00580997 mfd transcription-repair coupling factor; InterPro: IPR 100.0
PRK10689 1148 transcription-repair coupling factor; Provisional 100.0
KOG0952 1230 consensus 100.0
KOG0353 695 consensus 100.0
COG1200677 RecG RecG-like helicase [DNA replication, recombination 100.0
COG1197 1139 Mfd Transcription-repair coupling factor (superfamily I 100.0
KOG0951 1674 consensus 100.0
KOG0950 1008 consensus 99.98
KOG0948 1041 consensus 99.97
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 99.94
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 99.91
PRK09200 799 preprotein translocase subunit SecA; Reviewed 99.87
KOG4150 1034 consensus 99.86
TIGR00603756 rad25 DNA repair helicase rad25; InterPro: IPR001161 Xe 99.86
PRK12903 885 secA preprotein translocase subunit SecA; Reviewed 99.83
PRK12906 823 secA preprotein translocase subunit SecA; Reviewed 99.83
PRK12898673 secA preprotein translocase subunit SecA; Reviewed 99.83
PRK12904 833 preprotein translocase subunit SecA; Reviewed 99.83
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.81
PRK12326 775 preprotein translocase subunit SecA; Reviewed 99.81
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.8
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.79
KOG09511674 consensus 99.72
KOG0387 923 consensus 99.72
KOG1123776 consensus 99.71
KOG1000689 consensus 99.51
KOG2340698 consensus 99.49
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, RNA h 99.46
KOG0340442 consensus 100.0
KOG0346569 consensus 100.0
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 100.0
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 100.0
smart00487201 DEXDc DEAD-like helicases superfamily. 99.94
pfam04851103 ResIII Type III restriction enzyme, res subunit. 99.55
pfam00176295 SNF2_N SNF2 family N-terminal domain. This domain is fo 98.9
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 97.99
PRK10875607 recD exonuclease V subunit alpha; Provisional 97.99
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 97.8
PRK08769319 DNA polymerase III subunit delta'; Validated 96.96
PRK10536262 hypothetical protein; Provisional 96.19
PRK05707328 DNA polymerase III subunit delta'; Validated 95.36
PRK09112352 DNA polymerase III subunit delta'; Validated 94.67
KOG1513 1300 consensus 93.97
PRK08699325 DNA polymerase III subunit delta'; Validated 93.83
PRK07471363 DNA polymerase III subunit delta'; Validated 93.5
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.96
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 99.95
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 99.94
TIGR01970 858 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IP 99.94
KOG0922 674 consensus 99.89
KOG0920 924 consensus 99.88
KOG0953 700 consensus 99.75
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 100.0
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 100.0
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 100.0
KOG0947 1248 consensus 100.0
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
PRK04914 955 ATP-dependent helicase HepA; Validated 99.96
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 99.96
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 99.95
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 99.93
PRK05580699 primosome assembly protein PriA; Validated 99.93
PRK09694878 hypothetical protein; Provisional 99.93
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 99.92
COG4096 875 HsdR Type I site-specific restriction-modification syst 99.91
KOG0923 902 consensus 99.86
KOG0924 1042 consensus 99.85
KOG0949 1330 consensus 99.85
TIGR02621 975 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-sub 99.82
COG4889 1518 Predicted helicase [General function prediction only] 99.8
KOG0385 971 consensus 99.79
KOG0384 1373 consensus 99.78
KOG0926 1172 consensus 99.78
KOG0925 699 consensus 99.61
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 100.0
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 99.97
CHL00122 891 secA preprotein translocase subunit SecA; Validated 99.82
PRK12902 946 secA preprotein translocase subunit SecA; Reviewed 99.8
TIGR00963 904 secA preprotein translocase, SecA subunit; InterPro: IP 99.53
pfam02399 829 Herpes_ori_bp Origin of replication binding protein. Th 98.66
PRK05298657 excinuclease ABC subunit B; Provisional 99.94
COG0556663 UvrB Helicase subunit of the DNA excision repair comple 99.93
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 99.91
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polymerase 99.85
TIGR01407944 dinG_rel DnaQ family exonuclease/DinG family helicase, 99.71
KOG03921549 consensus 99.66
KOG0389941 consensus 99.48
KOG0386 1157 consensus 99.37
KOG1002791 consensus 99.21
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 98.69
KOG0391 1958 consensus 98.17
KOG03881185 consensus 98.04
KOG1015 1567 consensus 97.67
KOG1001674 consensus 96.44
KOG1016 1387 consensus 96.15
KOG02981394 consensus 93.32
TIGR01587424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 99.94
TIGR00595524 priA primosomal protein N'; InterPro: IPR005259 All pro 99.66
COG0610 962 Type I site-specific restriction-modification system, R 99.19
KOG0921 1282 consensus 98.76
TIGR00348813 hsdR type I site-specific deoxyribonuclease, HsdR famil 98.41
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 99.94
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 98.5
TIGR01447753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 98.02
COG3421 812 Uncharacterized protein conserved in bacteria [Function 97.49
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 97.42
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.51
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 96.42
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 96.4
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 95.99
pfam05621302 TniB Bacterial TniB protein. This family consists of se 95.81
pfam04466387 Terminase_3 Phage terminase large subunit. Initiation o 95.64
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 95.11
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 94.64
TIGR02768888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 94.62
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 92.58
PRK10867453 signal recognition particle protein; Provisional 91.82
PRK00771433 signal recognition particle protein Srp54; Provisional 91.29
pfam03266168 DUF265 Protein of unknown function, DUF265. 90.43
PRK08074932 bifunctional ATP-dependent DNA helicase/DNA polymerase 99.87
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.78
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 99.75
smart0049082 HELICc helicase superfamily c-terminal domain. 99.75
COG1199654 DinG Rad3-related DNA helicases [Transcription / DNA re 99.74
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 99.68
TIGR00643 721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 97.14
PRK10917 677 ATP-dependent DNA helicase RecG; Provisional 97.1
KOG0701 1606 consensus 97.09
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 96.94
PRK05580 699 primosome assembly protein PriA; Validated 96.37
PRK10689 1148 transcription-repair coupling factor; Provisional 96.12
COG1200 677 RecG RecG-like helicase [DNA replication, recombination 95.53
TIGR00580 997 mfd transcription-repair coupling factor; InterPro: IPR 95.29
COG1198 730 PriA Primosomal protein N' (replication factor Y) - sup 95.15
KOG0331 519 consensus 94.73
COG1197 1139 Mfd Transcription-repair coupling factor (superfamily I 94.48
PTZ00110 602 helicase; Provisional 92.66
KOG0339 731 consensus 92.18
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 91.85
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 91.82
PRK08506473 replicative DNA helicase; Provisional 91.31
pfam02606318 LpxK Tetraacyldisaccharide-1-P 4'-kinase. This family c 90.2
PRK12900 983 secA preprotein translocase subunit SecA; Reviewed 99.78
PRK12899 969 secA preprotein translocase subunit SecA; Reviewed 99.77
PRK12901 1111 secA preprotein translocase subunit SecA; Reviewed 99.75
pfam07517381 SecA_DEAD SecA DEAD-like domain. SecA protein binds to 98.99
KOG0391 1958 consensus 97.85
pfam12340229 DUF3638 Protein of unknown function (DUF3638). This dom 97.66
KOG18051100 consensus 97.49
KOG0388 1185 consensus 97.04
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 97.03
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 96.79
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.78
KOG1001 674 consensus 96.15
PRK13826 1102 Dtr system oriT relaxase; Provisional 95.52
pfam05876552 Terminase_GpA Phage terminase large subunit (GpA). This 94.55
pfam03237380 Terminase_6 Terminase-like family. This family represen 94.45
KOG0298 1394 consensus 94.41
TIGR01169227 rplA_bact ribosomal protein L1; InterPro: IPR005878 Rib 92.33
COG1435201 Tdk Thymidine kinase [Nucleotide transport and metaboli 90.38
TIGR02236333 recomb_radA DNA repair and recombination protein RadA; 90.26
KOG0390776 consensus 99.69
KOG4439901 consensus 99.17
TIGR02562 1153 cas3_yersinia CRISPR-associated helicase Cas3, Yersinia 98.96
pfam06862435 DUF1253 Protein of unknown function (DUF1253). This fam 99.57
KOG09521230 consensus 99.08
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.9
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.9
KOG1803649 consensus 97.83
KOG1802935 consensus 97.73
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 97.56
TIGR02785 1295 addA_Gpos recombination helicase AddA; InterPro: IPR014 97.45
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 97.15
pfam02534468 TraG TraG/TraD family. These proteins contain a P-loop 97.04
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 97.02
COG1444 758 Predicted P-loop ATPase fused to an acetyltransferase [ 96.96
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 96.52
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.48
PRK13897628 type IV secretion system component VirD4; Provisional 96.46
COG3973747 Superfamily I DNA and RNA helicases [General function p 96.3
pfam10412386 TrwB_AAD_bind Type IV secretion-system coupling protein 96.23
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 96.11
PRK11054684 helD DNA helicase IV; Provisional 96.0
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 95.89
PRK12377248 putative replication protein; Provisional 95.88
pfam03354473 Terminase_1 Phage Terminase. The majority of the member 95.81
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 95.79
PRK13889 992 conjugal transfer relaxase TraA; Provisional 95.63
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 95.59
PRK09183258 transposase/IS protein; Provisional 95.57
pfam02456370 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can in 95.54
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 94.91
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta subuni 94.75
PRK11773 722 uvrD DNA-dependent helicase II; Provisional 94.72
COG1484254 DnaC DNA replication protein [DNA replication, recombin 94.23
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 93.39
PRK09302501 circadian clock protein KaiC; Reviewed 93.3
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA replicati 93.02
KOG1806 1320 consensus 92.99
PRK04328250 hypothetical protein; Provisional 92.74
pfam06745231 KaiC KaiC. This family represents a conserved region wi 92.42
TIGR02902532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 92.18
PRK13709 1756 conjugal transfer nickase/helicase TraI; Provisional 91.88
cd01124187 KaiC KaiC is a circadian clock protein primarily found 91.71
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 91.68
KOG0741744 consensus 91.6
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 91.02
PRK08116262 hypothetical protein; Validated 90.85
TIGR00631 667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 90.65
KOG2036 1011 consensus 90.6
PRK06067241 flagellar accessory protein FlaH; Validated 90.56
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 90.42
KOG1015 1567 consensus 90.4
pfam04665241 Pox_A32 Poxvirus A32 protein. The A32 protein is though 90.34
TIGR02746900 TraC-F-type type-IV secretion system protein TraC; Inte 90.21
KOG1132 945 consensus 98.14
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.87
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 97.83
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 97.63
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 97.41
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.06
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.98
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.77
KOG1133 821 consensus 96.62
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 96.52
smart00382148 AAA ATPases associated with a variety of cellular activ 96.3
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.17
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 96.12
TIGR01074 677 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 95.83
PRK06526254 transposase; Provisional 95.73
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 95.44
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 95.11
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 95.01
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 94.97
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 94.89
PRK08727233 hypothetical protein; Validated 94.84
KOG0732 1080 consensus 94.76
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 94.76
PRK06964342 DNA polymerase III subunit delta'; Validated 94.74
PRK08181269 transposase; Validated 94.67
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 94.3
COG0630312 VirB11 Type IV secretory pathway, VirB11 components, an 93.97
PRK06871324 DNA polymerase III subunit delta'; Validated 93.84
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 93.61
TIGR02688470 TIGR02688 conserved hypothetical protein TIGR02688; Int 93.6
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 93.27
KOG0745564 consensus 92.68
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 92.65
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 92.23
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 92.1
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 91.99
PRK06090319 DNA polymerase III subunit delta'; Validated 91.87
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 91.85
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 91.8
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 91.68
PRK07993334 DNA polymerase III subunit delta'; Validated 91.31
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 91.09
TIGR00174307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 91.07
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 91.06
PRK07952242 DNA replication protein DnaC; Validated 91.04
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 90.92
PRK10865 857 protein disaggregation chaperone; Provisional 90.83
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 90.4
KOG2228408 consensus 90.26
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 90.25
PRK13342417 recombination factor protein RarA; Reviewed 90.23
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 90.21
TIGR00929931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 90.2
PRK08084235 DNA replication initiation factor; Provisional 90.09
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.97
KOG1513 1300 consensus 96.2
pfam10593231 Z1 Z1 domain. This uncharacterized domain was identifie 92.71
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 97.02
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 96.95
PRK00440318 rfc replication factor C small subunit; Reviewed 96.74
PRK04841 903 transcriptional regulator MalT; Provisional 96.4
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 96.37
PRK04195403 replication factor C large subunit; Provisional 96.3
PRK12402337 replication factor C small subunit 2; Reviewed 96.06
PRK06305462 DNA polymerase III subunits gamma and tau; Validated 95.59
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 95.5
KOG0989346 consensus 95.4
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 95.33
PRK05564313 DNA polymerase III subunit delta'; Validated 95.14
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 95.1
pfam00308219 Bac_DnaA Bacterial dnaA protein. 95.07
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 94.99
PRK08451523 DNA polymerase III subunits gamma and tau; Validated 94.98
PRK08058329 DNA polymerase III subunit delta'; Validated 94.96
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 94.78
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 94.65
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 94.36
KOG0991333 consensus 93.64
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 93.15
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 92.76
PRK05642234 DNA replication initiation factor; Validated 92.49
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 92.31
PRK07399314 DNA polymerase III subunit delta'; Validated 91.58
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 91.4
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 91.37
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 91.22
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 90.97
KOG2543438 consensus 90.56
PRK07940395 DNA polymerase III subunit delta'; Validated 90.4
PRK05917290 DNA polymerase III subunit delta'; Validated 90.22
PRK09401 1176 reverse gyrase; Reviewed 96.7
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 96.14
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 93.69
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 93.51
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 93.25
PRK13894320 conjugal transfer ATPase TrbB; Provisional 96.5
PRK13833323 conjugal transfer protein TrbB; Provisional 96.46
PRK13851343 type IV secretion system protein VirB11; Provisional 96.41
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.15
PRK13900332 type IV secretion system ATPase VirB11; Provisional 96.13
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.79
pfam03668284 ATP_bind_2 P-loop ATPase protein family. This family co 95.07
PRK05416292 hypothetical protein; Provisional 93.29
TIGR01192592 chvA glucan exporter ATP-binding protein; InterPro: IPR 92.86
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell moti 92.74
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 92.26
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 91.45
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.32
COG1875436 NYN ribonuclease and ATPase of PhoH family domains [Gen 96.12
KOG0344593 consensus 96.08
smart00491142 HELICc2 helicase superfamily c-terminal domain. 94.68
PRK08939306 primosomal protein DnaI; Reviewed 92.9
PRK10436461 hypothetical protein; Provisional 95.3
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 93.57
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 95.01
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 94.98
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 94.73
KOG0738491 consensus 93.08
PRK13830818 conjugal transfer protein TrbE; Provisional 92.91
PRK13873815 conjugal transfer ATPase TrbE; Provisional 92.21
PRK13891852 conjugal transfer protein TrbE; Provisional 90.27
PRK00149447 dnaA chromosomal replication initiation protein; Review 94.27
PRK12422455 chromosomal replication initiation protein; Provisional 91.99
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, LssB fa 93.73
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0331 consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0330 consensus Back     alignment and domain information
>KOG0338 consensus Back     alignment and domain information
>KOG0333 consensus Back     alignment and domain information
>KOG0328 consensus Back     alignment and domain information
>KOG0342 consensus Back     alignment and domain information
>KOG0345 consensus Back     alignment and domain information
>KOG0343 consensus Back     alignment and domain information
>KOG0334 consensus Back     alignment and domain information
>KOG0336 consensus Back     alignment and domain information
>KOG0335 consensus Back     alignment and domain information
>KOG0348 consensus Back     alignment and domain information
>KOG0339 consensus Back     alignment and domain information
>KOG0347 consensus Back     alignment and domain information
>KOG0326 consensus Back     alignment and domain information
>KOG0341 consensus Back     alignment and domain information
>KOG0327 consensus Back     alignment and domain information
>KOG0337 consensus Back     alignment and domain information