254780381

254780381

flagellar basal body rod protein FlgB

GeneID in NCBI database:8209366Locus tag:CLIBASIA_01330
Protein GI in NCBI database:254780381Protein Accession:YP_003064794.1
Gene range:-(276812, 277204)Protein Length:130aa
Gene description:flagellar basal body rod protein FlgB
COG prediction:[N] Flagellar basal body protein
KEGG prediction:flgB; flagellar basal body rod protein FlgB; K02387 flagellar basal-body rod protein FlgB
SEED prediction:Flagellar basal-body rod protein FlgB
Pathway involved in KEGG:Flagellar assembly [PATH:las02040]
Subsystem involved in SEED:Flagellum in Campylobacter
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MQPITFFQIASQHANWLSERQKIVSENIANASTPNYRAKDISSFETILNQNFLMARTHETHLKESDSSGLHWNAHVIEAPLDQTTGVQVSGNTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVRG
ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccccccccccccccEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MQPITFFQIASQHANWLSERQKIVSENianastpnyrakdisSFETILNQNFLMARTHEthlkesdssglhwnahvieapldqttgvqvsgntvgitNELYKSGHIKYLYELNTKLIKKLNSMVMHVVRG
MQPITFFQIASQHANWLSERQKIVSENianastpnyrakDISSFETILNQNFLMARTHETHLKESDSSGLHWNAHVIEapldqttgvqVSGNTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVRG
MQPITFFQIASQHANWLSERQKIVSENIANASTPNYRAKDISSFETILNQNFLMARTHETHLKESDSSGLHWNAHVIEAPLDQTTGVQVSGNTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVRG
**PITFFQIASQHANWLSERQKIVSENIANASTPNYRAKDISS***********************************************GNTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVRG
MQPITFFQIASQHANWLSERQKIVSENIANASTPNYRAKDISSFETILNQNFLMARTHETHLKESDSSGLHWNAHVIEAPLDQTTGVQVSGNTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVRG
*QPITFFQIASQHANWLSERQKIVSENIANASTPNYRAKDISSFETILNQNFLMA*****************NAHVIEA**DQTT****SGNTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVRG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQPITFFQIASQHANWLSERQKIVSENIANASTPNYRAKDISSFETILNQNFLMARTHETHLKESDSSGLHWNAHVIEAPLDQTTGVQVSGNTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVRG
MQPITFFQIASQHANWLSERQKIVSENIANASTPNYRAKDISSFETILNQNFLMARTHETHLKESDSSGLHWNAHVIEAPLDQTTGVQVSGNTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVRG
MQPITFFQIASQHANWLSERQKIVSENIANASTPNYRAKDISSFETILNQNFLMARTHETHLKESDSSGLHWNAHVIEAPLDQTTGVQVSGNTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVRG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target130 flagellar basal body rod protein FlgB [Candidatus Liber
254780380134 flagellar basal body rod protein FlgC [Candidatus 0.041
>gi|254780380|ref|YP_003064793.1| flagellar basal body rod protein FlgC [Candidatus Liberibacter asiaticus str. psy62] Length = 134 Back     alignment 
 Score = 28.5 bits (62), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 8/38 (21%)

Query: 18 SERQKIVSENIANA----STPN---YRAKDISSFETIL 48
          S R +I+SENIANA     TP    YR K I SFE ++
Sbjct: 19 SARMQIISENIANARTTGDTPGSDPYRRKTI-SFEEVM 55

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target130 flagellar basal body rod protein FlgB [Candidatus Liber
315121850183 flagellar basal body rod protein FlgB [Candidatus Liber 1 4e-52
116250479130 flagellar basal body rod protein FlgB [Rhizobium legumi 1 3e-29
209547925130 flagellar basal body rod protein FlgB [Rhizobium legumi 1 5e-29
86356309130 flagellar basal body rod protein FlgB [Rhizobium etli C 1 1e-28
241203103130 flagellar basal body rod protein FlgB [Rhizobium legumi 1 4e-28
190890360130 flagellar basal-body rod protein [Rhizobium etli CIAT 6 1 5e-28
327193033130 flagellar basal-body rod protein [Rhizobium etli CNPAF5 1 2e-27
222084862130 flagellar basal-body rod protein [Agrobacterium radioba 1 8e-27
218460744142 flagellar basal body rod protein FlgB [Rhizobium etli K 1 6e-26
222147568130 flagellar basal body rod protein FlgB [Agrobacterium vi 1 1e-25
>gi|315121850|ref|YP_004062339.1| flagellar basal body rod protein FlgB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 183 Back     alignment and organism information
 Score =  207 bits (527), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 97/130 (74%), Positives = 112/130 (86%)

Query: 1   MQPITFFQIASQHANWLSERQKIVSENIANASTPNYRAKDISSFETILNQNFLMARTHET 60
           MQPITFF+IASQHANWLSERQK+VSENIANASTP YR+KDIS+FET+LN N  MARTHE 
Sbjct: 54  MQPITFFEIASQHANWLSERQKVVSENIANASTPGYRSKDISAFETVLNDNIAMARTHEA 113

Query: 61  HLKESDSSGLHWNAHVIEAPLDQTTGVQVSGNTVGITNELYKSGHIKYLYELNTKLIKKL 120
           HLK  D  G + +   I+APL Q  GVQVSGNTVGITNELYK+G+IK+LYELNT+L+KKL
Sbjct: 114 HLKAMDFDGFYRHVRTIQAPLYQPIGVQVSGNTVGITNELYKAGNIKHLYELNTRLVKKL 173

Query: 121 NSMVMHVVRG 130
           N M+MHVV+G
Sbjct: 174 NYMMMHVVKG 183



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116250479|ref|YP_766317.1| flagellar basal body rod protein FlgB [Rhizobium leguminosarum bv. viciae 3841] Length = 130 Back     alignment and organism information
>gi|209547925|ref|YP_002279842.1| flagellar basal body rod protein FlgB [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 130 Back     alignment and organism information
>gi|86356309|ref|YP_468201.1| flagellar basal body rod protein FlgB [Rhizobium etli CFN 42] Length = 130 Back     alignment and organism information
>gi|241203103|ref|YP_002974199.1| flagellar basal body rod protein FlgB [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 130 Back     alignment and organism information
>gi|190890360|ref|YP_001976902.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652] Length = 130 Back     alignment and organism information
>gi|327193033|gb|EGE59945.1| flagellar basal-body rod protein [Rhizobium etli CNPAF512] Length = 130 Back     alignment and organism information
>gi|222084862|ref|YP_002543391.1| flagellar basal-body rod protein [Agrobacterium radiobacter K84] Length = 130 Back     alignment and organism information
>gi|218460744|ref|ZP_03500835.1| flagellar basal body rod protein FlgB [Rhizobium etli Kim 5] Length = 142 Back     alignment and organism information
>gi|222147568|ref|YP_002548525.1| flagellar basal body rod protein FlgB [Agrobacterium vitis S4] Length = 130 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target130 flagellar basal body rod protein FlgB [Candidatus Liber
PRK06003126 PRK06003, flgB, flagellar basal body rod protein FlgB; 2e-32
TIGR01396131 TIGR01396, FlgB, flagellar basal-body rod protein FlgB 7e-12
PRK12627128 PRK12627, flgB, flagellar basal body rod protein FlgB; 5e-11
PRK06004127 PRK06004, flgB, flagellar basal body rod protein FlgB; 3e-09
PRK05680137 PRK05680, flgB, flagellar basal body rod protein FlgB; 8e-09
PRK12626162 PRK12626, flgB, flagellar basal body rod protein FlgB; 1e-04
PRK12622135 PRK12622, flgB, flagellar basal body rod protein FlgB; 3e-04
PRK06797135 PRK06797, flgB, flagellar basal body rod protein FlgB; 4e-04
PRK12620132 PRK12620, flgB, flagellar basal body rod protein FlgB; 5e-04
COG1815133 COG1815, FlgB, Flagellar basal body protein [Cell motil 2e-19
PRK12625132 PRK12625, flgB, flagellar basal body rod protein FlgB; 2e-07
PRK12623131 PRK12623, flgB, flagellar basal body rod protein FlgB; 2e-04
PRK12685116 PRK12685, flgB, flagellar basal body rod protein FlgB; 3e-05
PRK12621136 PRK12621, flgB, flagellar basal body rod protein FlgB; 4e-05
TIGR03506 231 TIGR03506, FlgEFG_subfam, fagellar hook-basal body prot 7e-04
PRK12632130 PRK12632, flgC, flagellar basal body rod protein FlgC; 0.002
>gnl|CDD|168340 PRK06003, flgB, flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>gnl|CDD|162337 TIGR01396, FlgB, flagellar basal-body rod protein FlgB Back     alignment and domain information
>gnl|CDD|183633 PRK12627, flgB, flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>gnl|CDD|180346 PRK06004, flgB, flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>gnl|CDD|180196 PRK05680, flgB, flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>gnl|CDD|183632 PRK12626, flgB, flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>gnl|CDD|183629 PRK12622, flgB, flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>gnl|CDD|180697 PRK06797, flgB, flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>gnl|CDD|183628 PRK12620, flgB, flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>gnl|CDD|32000 COG1815, FlgB, Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|183631 PRK12625, flgB, flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>gnl|CDD|183630 PRK12623, flgB, flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>gnl|CDD|183682 PRK12685, flgB, flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>gnl|CDD|171613 PRK12621, flgB, flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>gnl|CDD|163298 TIGR03506, FlgEFG_subfam, fagellar hook-basal body proteins Back     alignment and domain information
>gnl|CDD|183637 PRK12632, flgC, flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 130 flagellar basal body rod protein FlgB [Candidatus Liber
PRK06003126 flgB flagellar basal body rod protein FlgB; Reviewed 100.0
PRK12627128 flgB flagellar basal body rod protein FlgB; Provisional 100.0
PRK05680137 flgB flagellar basal body rod protein FlgB; Reviewed 100.0
PRK12626162 flgB flagellar basal body rod protein FlgB; Provisional 100.0
PRK12624143 flgB flagellar basal body rod protein FlgB; Provisional 100.0
PRK06797135 flgB flagellar basal body rod protein FlgB; Reviewed 100.0
PRK12621136 flgB flagellar basal body rod protein FlgB; Provisional 100.0
PRK12620132 flgB flagellar basal body rod protein FlgB; Provisional 100.0
PRK12622135 flgB flagellar basal body rod protein FlgB; Provisional 100.0
PRK12623131 flgB flagellar basal body rod protein FlgB; Provisional 100.0
COG1815133 FlgB Flagellar basal body protein [Cell motility and se 100.0
PRK06004126 flgB flagellar basal body rod protein FlgB; Reviewed 100.0
PRK12619130 flgB flagellar basal body rod protein FlgB; Provisional 100.0
PRK12625132 flgB flagellar basal body rod protein FlgB; Provisional 100.0
PRK07182148 flgB flagellar basal body rod protein FlgB; Reviewed 100.0
PRK12685116 flgB flagellar basal body rod protein FlgB; Reviewed 100.0
PRK12632130 flgC flagellar basal body rod protein FlgC; Provisional 99.96
TIGR01395147 FlgC flagellar basal-body rod protein FlgC; InterPro: I 99.96
PRK12628140 flgC flagellar basal body rod protein FlgC; Provisional 99.96
PRK12630143 flgC flagellar basal body rod protein FlgC; Provisional 99.95
COG1558137 FlgC Flagellar basal body rod protein [Cell motility an 99.95
PRK06802141 flgC flagellar basal body rod protein FlgC; Reviewed 99.95
PRK12629135 flgC flagellar basal body rod protein FlgC; Provisional 99.95
PRK12631138 flgC flagellar basal body rod protein FlgC; Provisional 99.95
PRK12782138 flgC flagellar basal body rod protein FlgC; Reviewed 99.94
PRK05681139 flgC flagellar basal body rod protein FlgC; Reviewed 99.94
TIGR01396134 FlgB flagellar basal-body rod protein FlgB; InterPro: I 99.57
TIGR02488 263 flgG_G_neg flagellar basal-body rod protein FlgG; Inter 99.8
TIGR03506 231 FlgEFG_subfam fagellar hook-basal body proteins. This m 99.36
PRK07521 482 flgK flagellar hook-associated protein FlgK; Validated 98.84
PRK07739 500 flgK flagellar hook-associated protein FlgK; Validated 98.84
PRK07191 456 flgK flagellar hook-associated protein FlgK; Validated 98.71
PRK12714 624 flgK flagellar hook-associated protein FlgK; Provisiona 98.66
PRK12715 649 flgK flagellar hook-associated protein FlgK; Provisiona 98.58
pfam0046031 Flg_bb_rod Flagella basal body rod protein. 98.58
PRK08471 612 flgK flagellar hook-associated protein FlgK; Validated 98.58
PRK06799 431 flgK flagellar hook-associated protein FlgK; Validated 98.58
PRK12643209 flgF flagellar basal body rod protein FlgF; Reviewed 98.57
COG1749 423 FlgE Flagellar hook protein FlgE [Cell motility and sec 98.57
PRK05841 605 flgE flagellar hook protein FlgE; Validated 98.57
PRK08147 547 flgK flagellar hook-associated protein FlgK; Validated 98.55
PRK06945 649 flgK flagellar hook-associated protein FlgK; Validated 98.53
TIGR02492 495 flgK_ends flagellar hook-associated protein FlgK; Inter 98.51
PRK08425 716 flgE flagellar hook protein FlgE; Validated 98.5
PRK08871 626 flgK flagellar hook-associated protein FlgK; Validated 98.47
PRK06665 628 flgK flagellar hook-associated protein FlgK; Validated 98.46
PRK05683 676 flgK flagellar hook-associated protein FlgK; Validated 98.43
COG1256 552 FlgK Flagellar hook-associated protein [Cell motility a 98.22
PRK05682 414 flgE flagellar hook protein FlgE; Validated 98.2
PRK12637 473 flgE flagellar hook protein FlgE; Provisional 98.04
PRK06803 398 flgE flagellar hook protein FlgE; Validated 98.02
TIGR02489 877 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR 92.91
PRK12642241 flgF flagellar basal body rod protein FlgF; Reviewed 99.67
PRK12690237 flgF flagellar basal body rod protein FlgF; Reviewed 99.67
PRK12691262 flgG flagellar basal body rod protein FlgG; Reviewed 99.64
PRK12689253 flgF flagellar basal body rod protein FlgF; Reviewed 99.64
PRK12817261 flgG flagellar basal body rod protein FlgG; Reviewed 99.61
PRK12693261 flgG flagellar basal body rod protein FlgG; Provisional 99.61
COG4786265 FlgG Flagellar basal body rod protein [Cell motility an 99.61
PRK12636263 flgG flagellar basal body rod protein FlgG; Provisional 99.61
PRK12818255 flgG flagellar basal body rod protein FlgG; Reviewed 99.61
PRK12694260 flgG flagellar basal body rod protein FlgG; Reviewed 99.61
PRK12816264 flgG flagellar basal body rod protein FlgG; Reviewed 99.6
PRK12692262 flgG flagellar basal body rod protein FlgG; Reviewed 99.58
PRK12819257 flgG flagellar basal body rod protein FlgG; Reviewed 99.54
PRK12640246 flgF flagellar basal body rod protein FlgF; Reviewed 99.53
PRK12641252 flgF flagellar basal body rod protein FlgF; Reviewed 99.51
TIGR02490254 flgF flagellar basal-body rod protein FlgF; InterPro: I 98.97
PRK05682414 flgE flagellar hook protein FlgE; Validated 98.91
PRK06803398 flgE flagellar hook protein FlgE; Validated 98.69
PRK12637473 flgE flagellar hook protein FlgE; Provisional 98.57
COG4787251 FlgF Flagellar basal body rod protein [Cell motility an 98.16
PRK08425716 flgE flagellar hook protein FlgE; Validated 98.0
PRK05841605 flgE flagellar hook protein FlgE; Validated 97.99
pfam0642939 DUF1078 Domain of unknown function (DUF1078). This fami 97.96
PRK07739500 flgK flagellar hook-associated protein FlgK; Validated 97.71
TIGR02492495 flgK_ends flagellar hook-associated protein FlgK; Inter 97.68
COG1749423 FlgE Flagellar hook protein FlgE [Cell motility and sec 97.57
PRK07521482 flgK flagellar hook-associated protein FlgK; Validated 97.48
PRK06799431 flgK flagellar hook-associated protein FlgK; Validated 97.41
PRK07191456 flgK flagellar hook-associated protein FlgK; Validated 97.37
PRK08471612 flgK flagellar hook-associated protein FlgK; Validated 97.37
PRK05683676 flgK flagellar hook-associated protein FlgK; Validated 97.36
PRK08147547 flgK flagellar hook-associated protein FlgK; Validated 97.32
PRK06665628 flgK flagellar hook-associated protein FlgK; Validated 97.32
PRK12714624 flgK flagellar hook-associated protein FlgK; Provisiona 97.31
PRK12715649 flgK flagellar hook-associated protein FlgK; Provisiona 97.31
PRK06945649 flgK flagellar hook-associated protein FlgK; Validated 97.3
PRK08871626 flgK flagellar hook-associated protein FlgK; Validated 97.26
COG1256552 FlgK Flagellar hook-associated protein [Cell motility a 97.17
TIGR02489877 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR 96.88
>PRK06003 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK05680 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12626 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12624 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK06797 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12621 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12620 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12622 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12623 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion] Back     alignment and domain information
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12619 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK12625 flgB flagellar basal body rod protein FlgB; Provisional Back     alignment and domain information
>PRK07182 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12685 flgB flagellar basal body rod protein FlgB; Reviewed Back     alignment and domain information
>PRK12632 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>TIGR01395 FlgC flagellar basal-body rod protein FlgC; InterPro: IPR006299 These sequences represent FlgC, one of several components of bacterial flagella Back     alignment and domain information
>PRK12628 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12630 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK06802 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK12629 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12631 flgC flagellar basal body rod protein FlgC; Provisional Back     alignment and domain information
>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>PRK05681 flgC flagellar basal body rod protein FlgC; Reviewed Back     alignment and domain information
>TIGR01396 FlgB flagellar basal-body rod protein FlgB; InterPro: IPR006300 Many bacterial species swim actively by means of flagella Back     alignment and domain information
>TIGR02488 flgG_G_neg flagellar basal-body rod protein FlgG; InterPro: IPR012834 This family consists of the FlgG protein of the flagellar apparatus in the proteobacteria and spirochetes Back     alignment and domain information
>TIGR03506 FlgEFG_subfam fagellar hook-basal body proteins Back     alignment and domain information
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>pfam00460 Flg_bb_rod Flagella basal body rod protein Back     alignment and domain information
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12643 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>COG1749 FlgE Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>PRK05841 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>PRK08425 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>PRK05682 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK12637 flgE flagellar hook protein FlgE; Provisional Back     alignment and domain information
>PRK06803 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>TIGR02489 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR012835 Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the proteobacteria (Helicobacter, Wolinella, and Campylobacter) Back     alignment and domain information
>PRK12642 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12690 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12691 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12689 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12817 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12693 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>COG4786 FlgG Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK12636 flgG flagellar basal body rod protein FlgG; Provisional Back     alignment and domain information
>PRK12818 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12694 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12816 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12692 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12819 flgG flagellar basal body rod protein FlgG; Reviewed Back     alignment and domain information
>PRK12640 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>PRK12641 flgF flagellar basal body rod protein FlgF; Reviewed Back     alignment and domain information
>TIGR02490 flgF flagellar basal-body rod protein FlgF; InterPro: IPR012836 Members of this protein are FlgF, one of several homologous flagellar basal-body rod proteins in bacteria Back     alignment and domain information
>PRK05682 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK06803 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK12637 flgE flagellar hook protein FlgE; Provisional Back     alignment and domain information
>COG4787 FlgF Flagellar basal body rod protein [Cell motility and secretion] Back     alignment and domain information
>PRK08425 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>PRK05841 flgE flagellar hook protein FlgE; Validated Back     alignment and domain information
>pfam06429 DUF1078 Domain of unknown function (DUF1078) Back     alignment and domain information
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway Back     alignment and domain information
>COG1749 FlgE Flagellar hook protein FlgE [Cell motility and secretion] Back     alignment and domain information
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional Back     alignment and domain information
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated Back     alignment and domain information
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] Back     alignment and domain information
>TIGR02489 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR012835 Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the proteobacteria (Helicobacter, Wolinella, and Campylobacter) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target130 flagellar basal body rod protein FlgB [Candidatus Liber
3a69_A402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 99.11
1ucu_A494 Phase 1 flagellin; flagellar filament, cryo-electron mi 90.42
3a69_A 402 Flagellar HOOK protein FLGE; the bacterial flagellar mo 98.17
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Back     alignment and structure
Probab=99.11  E-value=2.8e-11  Score=78.09  Aligned_cols=38  Identities=21%  Similarity=0.288  Sum_probs=36.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             52008999999999999999999999999999999636
Q gi|254780381|r   92 NTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVR  129 (130)
Q Consensus        92 n~Vdl~~Em~~~~~~~~~Y~a~~~~~~~~~~~~~~al~  129 (130)
                      .+|||++||++|+.-|+.|+|+.++|....+||.++|.
T Consensus       363 S~V~ldeEmtnli~~Q~aY~A~akvitt~demld~lin  400 (402)
T 3a69_A          363 SNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVN  400 (402)
T ss_dssp             ----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             14799999999999999999975266499999999970
>1ucu_A Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} SCOP: e.32.1.1 PDB: 3a5x_A Back     alignment and structure
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against MMDB70 database

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

Original result of HHsearch against MMDB70 database

IdentityAlignment graphLength Definition Probability
Target130 flagellar basal body rod protein FlgB [Candidatus Liber
1ucu_A_1-40_455-49480 Phase 1 flagellin; flagellar filament, cryo-electr 90.07
>1ucu_A (A:1-40,A:455-494) Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} Back     alignment and structure
Probab=90.07  E-value=0.94  Score=22.84  Aligned_cols=38  Identities=13%  Similarity=0.198  Sum_probs=34.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             52008999999999999999999999999999999636
Q gi|254780381|r   92 NTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVR  129 (130)
Q Consensus        92 n~Vdl~~Em~~~~~~~~~Y~a~~~~~~~~~~~~~~al~  129 (130)
                      -.+|+..||+++.+.++..|+...++.....+=+.+++
T Consensus        40 ADaD~A~E~~~~tk~qIL~Qa~~amLaQAN~~pq~vl~   77 (80)
T 1ucu_A           40 ADSDYATEVSNMSRAQILQQAGTSVLAQANQVPQNVLS   77 (80)
T ss_dssp             SCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CHCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
T ss_conf             21319999999999999999999999997416789998