254780381
flagellar basal body rod protein FlgB
GeneID in NCBI database: | 8209366 | Locus tag: | CLIBASIA_01330 |
Protein GI in NCBI database: | 254780381 | Protein Accession: | YP_003064794.1 |
Gene range: | -(276812, 277204) | Protein Length: | 130aa |
Gene description: | flagellar basal body rod protein FlgB | ||
COG prediction: | [N] Flagellar basal body protein | ||
KEGG prediction: | flgB; flagellar basal body rod protein FlgB; K02387 flagellar basal-body rod protein FlgB | ||
SEED prediction: | Flagellar basal-body rod protein FlgB | ||
Pathway involved in KEGG: | Flagellar assembly [PATH:las02040] | ||
Subsystem involved in SEED: | Flagellum in Campylobacter | ||
sequence | sequence profile |
Prediction of Local Sequence Properties
Source | Summary | Result |
---|
|
|
Close Homologs Detected by BLAST or PSI-BLAST
Homolog within the Genome Detected by BLAST
Original result of BLAST against C. L. asiaticus genome
Identity | Alignment graph | Length | Definition | E-value | |
Target | 130 | flagellar basal body rod protein FlgB [Candidatus Liber | |||
254780380 | 134 | flagellar basal body rod protein FlgC [Candidatus | 0.041 |
>gi|254780380|ref|YP_003064793.1| flagellar basal body rod protein FlgC [Candidatus Liberibacter asiaticus str. psy62] Length = 134 | Back alignment |
---|
Score = 28.5 bits (62), Expect = 0.041, Method: Compositional matrix adjust. Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 8/38 (21%) Query: 18 SERQKIVSENIANA----STPN---YRAKDISSFETIL 48 S R +I+SENIANA TP YR K I SFE ++ Sbjct: 19 SARMQIISENIANARTTGDTPGSDPYRRKTI-SFEEVM 55 |
Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations
Original result of PSI-BLAST first 2 iterations
Identity | Alignment graph | Length | Definition | Round | E-value |
Target | 130 | flagellar basal body rod protein FlgB [Candidatus Liber | |||
315121850 | 183 | flagellar basal body rod protein FlgB [Candidatus Liber | 1 | 4e-52 | |
116250479 | 130 | flagellar basal body rod protein FlgB [Rhizobium legumi | 1 | 3e-29 | |
209547925 | 130 | flagellar basal body rod protein FlgB [Rhizobium legumi | 1 | 5e-29 | |
86356309 | 130 | flagellar basal body rod protein FlgB [Rhizobium etli C | 1 | 1e-28 | |
241203103 | 130 | flagellar basal body rod protein FlgB [Rhizobium legumi | 1 | 4e-28 | |
190890360 | 130 | flagellar basal-body rod protein [Rhizobium etli CIAT 6 | 1 | 5e-28 | |
327193033 | 130 | flagellar basal-body rod protein [Rhizobium etli CNPAF5 | 1 | 2e-27 | |
222084862 | 130 | flagellar basal-body rod protein [Agrobacterium radioba | 1 | 8e-27 | |
218460744 | 142 | flagellar basal body rod protein FlgB [Rhizobium etli K | 1 | 6e-26 | |
222147568 | 130 | flagellar basal body rod protein FlgB [Agrobacterium vi | 1 | 1e-25 |
>gi|315121850|ref|YP_004062339.1| flagellar basal body rod protein FlgB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 183 | Back alignment and organism information |
---|
Score = 207 bits (527), Expect = 4e-52, Method: Compositional matrix adjust. Identities = 97/130 (74%), Positives = 112/130 (86%) Query: 1 MQPITFFQIASQHANWLSERQKIVSENIANASTPNYRAKDISSFETILNQNFLMARTHET 60 MQPITFF+IASQHANWLSERQK+VSENIANASTP YR+KDIS+FET+LN N MARTHE Sbjct: 54 MQPITFFEIASQHANWLSERQKVVSENIANASTPGYRSKDISAFETVLNDNIAMARTHEA 113 Query: 61 HLKESDSSGLHWNAHVIEAPLDQTTGVQVSGNTVGITNELYKSGHIKYLYELNTKLIKKL 120 HLK D G + + I+APL Q GVQVSGNTVGITNELYK+G+IK+LYELNT+L+KKL Sbjct: 114 HLKAMDFDGFYRHVRTIQAPLYQPIGVQVSGNTVGITNELYKAGNIKHLYELNTRLVKKL 173 Query: 121 NSMVMHVVRG 130 N M+MHVV+G Sbjct: 174 NYMMMHVVKG 183 |
Species: Candidatus Liberibacter solanacearum Genus: Candidatus Liberibacter Family: Rhizobiaceae Order: Rhizobiales Class: Alphaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
>gi|116250479|ref|YP_766317.1| flagellar basal body rod protein FlgB [Rhizobium leguminosarum bv. viciae 3841] Length = 130 | Back alignment and organism information |
---|
>gi|209547925|ref|YP_002279842.1| flagellar basal body rod protein FlgB [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 130 | Back alignment and organism information |
---|
>gi|86356309|ref|YP_468201.1| flagellar basal body rod protein FlgB [Rhizobium etli CFN 42] Length = 130 | Back alignment and organism information |
---|
>gi|241203103|ref|YP_002974199.1| flagellar basal body rod protein FlgB [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 130 | Back alignment and organism information |
---|
>gi|190890360|ref|YP_001976902.1| flagellar basal-body rod protein [Rhizobium etli CIAT 652] Length = 130 | Back alignment and organism information |
---|
>gi|327193033|gb|EGE59945.1| flagellar basal-body rod protein [Rhizobium etli CNPAF512] Length = 130 | Back alignment and organism information |
---|
>gi|222084862|ref|YP_002543391.1| flagellar basal-body rod protein [Agrobacterium radiobacter K84] Length = 130 | Back alignment and organism information |
---|
>gi|218460744|ref|ZP_03500835.1| flagellar basal body rod protein FlgB [Rhizobium etli Kim 5] Length = 142 | Back alignment and organism information |
---|
>gi|222147568|ref|YP_002548525.1| flagellar basal body rod protein FlgB [Agrobacterium vitis S4] Length = 130 | Back alignment and organism information |
---|
Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch
Conserved Domains in CDD Database Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Original result of RPS-BLASTagainst CDD database part II
Identity | Alignment graph | Length | Definition | E-value |
Target | 130 | flagellar basal body rod protein FlgB [Candidatus Liber | ||
PRK06003 | 126 | PRK06003, flgB, flagellar basal body rod protein FlgB; | 2e-32 | |
TIGR01396 | 131 | TIGR01396, FlgB, flagellar basal-body rod protein FlgB | 7e-12 | |
PRK12627 | 128 | PRK12627, flgB, flagellar basal body rod protein FlgB; | 5e-11 | |
PRK06004 | 127 | PRK06004, flgB, flagellar basal body rod protein FlgB; | 3e-09 | |
PRK05680 | 137 | PRK05680, flgB, flagellar basal body rod protein FlgB; | 8e-09 | |
PRK12626 | 162 | PRK12626, flgB, flagellar basal body rod protein FlgB; | 1e-04 | |
PRK12622 | 135 | PRK12622, flgB, flagellar basal body rod protein FlgB; | 3e-04 | |
PRK06797 | 135 | PRK06797, flgB, flagellar basal body rod protein FlgB; | 4e-04 | |
PRK12620 | 132 | PRK12620, flgB, flagellar basal body rod protein FlgB; | 5e-04 | |
COG1815 | 133 | COG1815, FlgB, Flagellar basal body protein [Cell motil | 2e-19 | |
PRK12625 | 132 | PRK12625, flgB, flagellar basal body rod protein FlgB; | 2e-07 | |
PRK12623 | 131 | PRK12623, flgB, flagellar basal body rod protein FlgB; | 2e-04 | |
PRK12685 | 116 | PRK12685, flgB, flagellar basal body rod protein FlgB; | 3e-05 | |
PRK12621 | 136 | PRK12621, flgB, flagellar basal body rod protein FlgB; | 4e-05 | |
TIGR03506 | 231 | TIGR03506, FlgEFG_subfam, fagellar hook-basal body prot | 7e-04 | |
PRK12632 | 130 | PRK12632, flgC, flagellar basal body rod protein FlgC; | 0.002 |
>gnl|CDD|168340 PRK06003, flgB, flagellar basal body rod protein FlgB; Reviewed | Back alignment and domain information |
---|
>gnl|CDD|162337 TIGR01396, FlgB, flagellar basal-body rod protein FlgB | Back alignment and domain information |
---|
>gnl|CDD|183633 PRK12627, flgB, flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>gnl|CDD|180346 PRK06004, flgB, flagellar basal body rod protein FlgB; Reviewed | Back alignment and domain information |
---|
>gnl|CDD|180196 PRK05680, flgB, flagellar basal body rod protein FlgB; Reviewed | Back alignment and domain information |
---|
>gnl|CDD|183632 PRK12626, flgB, flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>gnl|CDD|183629 PRK12622, flgB, flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>gnl|CDD|180697 PRK06797, flgB, flagellar basal body rod protein FlgB; Reviewed | Back alignment and domain information |
---|
>gnl|CDD|183628 PRK12620, flgB, flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>gnl|CDD|32000 COG1815, FlgB, Flagellar basal body protein [Cell motility and secretion] | Back alignment and domain information |
---|
>gnl|CDD|183631 PRK12625, flgB, flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>gnl|CDD|183630 PRK12623, flgB, flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>gnl|CDD|183682 PRK12685, flgB, flagellar basal body rod protein FlgB; Reviewed | Back alignment and domain information |
---|
>gnl|CDD|171613 PRK12621, flgB, flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>gnl|CDD|163298 TIGR03506, FlgEFG_subfam, fagellar hook-basal body proteins | Back alignment and domain information |
---|
>gnl|CDD|183637 PRK12632, flgC, flagellar basal body rod protein FlgC; Provisional | Back alignment and domain information |
---|
Conserved Domains in CDD Database Detected by HHsearch
Original result of HHsearch against CDD database
Identity | Alignment graph | Length | Definition | Probability |
Target | 130 | flagellar basal body rod protein FlgB [Candidatus Liber | ||
PRK06003 | 126 | flgB flagellar basal body rod protein FlgB; Reviewed | 100.0 | |
PRK12627 | 128 | flgB flagellar basal body rod protein FlgB; Provisional | 100.0 | |
PRK05680 | 137 | flgB flagellar basal body rod protein FlgB; Reviewed | 100.0 | |
PRK12626 | 162 | flgB flagellar basal body rod protein FlgB; Provisional | 100.0 | |
PRK12624 | 143 | flgB flagellar basal body rod protein FlgB; Provisional | 100.0 | |
PRK06797 | 135 | flgB flagellar basal body rod protein FlgB; Reviewed | 100.0 | |
PRK12621 | 136 | flgB flagellar basal body rod protein FlgB; Provisional | 100.0 | |
PRK12620 | 132 | flgB flagellar basal body rod protein FlgB; Provisional | 100.0 | |
PRK12622 | 135 | flgB flagellar basal body rod protein FlgB; Provisional | 100.0 | |
PRK12623 | 131 | flgB flagellar basal body rod protein FlgB; Provisional | 100.0 | |
COG1815 | 133 | FlgB Flagellar basal body protein [Cell motility and se | 100.0 | |
PRK06004 | 126 | flgB flagellar basal body rod protein FlgB; Reviewed | 100.0 | |
PRK12619 | 130 | flgB flagellar basal body rod protein FlgB; Provisional | 100.0 | |
PRK12625 | 132 | flgB flagellar basal body rod protein FlgB; Provisional | 100.0 | |
PRK07182 | 148 | flgB flagellar basal body rod protein FlgB; Reviewed | 100.0 | |
PRK12685 | 116 | flgB flagellar basal body rod protein FlgB; Reviewed | 100.0 | |
PRK12632 | 130 | flgC flagellar basal body rod protein FlgC; Provisional | 99.96 | |
TIGR01395 | 147 | FlgC flagellar basal-body rod protein FlgC; InterPro: I | 99.96 | |
PRK12628 | 140 | flgC flagellar basal body rod protein FlgC; Provisional | 99.96 | |
PRK12630 | 143 | flgC flagellar basal body rod protein FlgC; Provisional | 99.95 | |
COG1558 | 137 | FlgC Flagellar basal body rod protein [Cell motility an | 99.95 | |
PRK06802 | 141 | flgC flagellar basal body rod protein FlgC; Reviewed | 99.95 | |
PRK12629 | 135 | flgC flagellar basal body rod protein FlgC; Provisional | 99.95 | |
PRK12631 | 138 | flgC flagellar basal body rod protein FlgC; Provisional | 99.95 | |
PRK12782 | 138 | flgC flagellar basal body rod protein FlgC; Reviewed | 99.94 | |
PRK05681 | 139 | flgC flagellar basal body rod protein FlgC; Reviewed | 99.94 | |
TIGR01396 | 134 | FlgB flagellar basal-body rod protein FlgB; InterPro: I | 99.57 | |
TIGR02488 | 263 | flgG_G_neg flagellar basal-body rod protein FlgG; Inter | 99.8 | |
TIGR03506 | 231 | FlgEFG_subfam fagellar hook-basal body proteins. This m | 99.36 | |
PRK07521 | 482 | flgK flagellar hook-associated protein FlgK; Validated | 98.84 | |
PRK07739 | 500 | flgK flagellar hook-associated protein FlgK; Validated | 98.84 | |
PRK07191 | 456 | flgK flagellar hook-associated protein FlgK; Validated | 98.71 | |
PRK12714 | 624 | flgK flagellar hook-associated protein FlgK; Provisiona | 98.66 | |
PRK12715 | 649 | flgK flagellar hook-associated protein FlgK; Provisiona | 98.58 | |
pfam00460 | 31 | Flg_bb_rod Flagella basal body rod protein. | 98.58 | |
PRK08471 | 612 | flgK flagellar hook-associated protein FlgK; Validated | 98.58 | |
PRK06799 | 431 | flgK flagellar hook-associated protein FlgK; Validated | 98.58 | |
PRK12643 | 209 | flgF flagellar basal body rod protein FlgF; Reviewed | 98.57 | |
COG1749 | 423 | FlgE Flagellar hook protein FlgE [Cell motility and sec | 98.57 | |
PRK05841 | 605 | flgE flagellar hook protein FlgE; Validated | 98.57 | |
PRK08147 | 547 | flgK flagellar hook-associated protein FlgK; Validated | 98.55 | |
PRK06945 | 649 | flgK flagellar hook-associated protein FlgK; Validated | 98.53 | |
TIGR02492 | 495 | flgK_ends flagellar hook-associated protein FlgK; Inter | 98.51 | |
PRK08425 | 716 | flgE flagellar hook protein FlgE; Validated | 98.5 | |
PRK08871 | 626 | flgK flagellar hook-associated protein FlgK; Validated | 98.47 | |
PRK06665 | 628 | flgK flagellar hook-associated protein FlgK; Validated | 98.46 | |
PRK05683 | 676 | flgK flagellar hook-associated protein FlgK; Validated | 98.43 | |
COG1256 | 552 | FlgK Flagellar hook-associated protein [Cell motility a | 98.22 | |
PRK05682 | 414 | flgE flagellar hook protein FlgE; Validated | 98.2 | |
PRK12637 | 473 | flgE flagellar hook protein FlgE; Provisional | 98.04 | |
PRK06803 | 398 | flgE flagellar hook protein FlgE; Validated | 98.02 | |
TIGR02489 | 877 | flgE_epsilon flagellar hook protein FlgE; InterPro: IPR | 92.91 | |
PRK12642 | 241 | flgF flagellar basal body rod protein FlgF; Reviewed | 99.67 | |
PRK12690 | 237 | flgF flagellar basal body rod protein FlgF; Reviewed | 99.67 | |
PRK12691 | 262 | flgG flagellar basal body rod protein FlgG; Reviewed | 99.64 | |
PRK12689 | 253 | flgF flagellar basal body rod protein FlgF; Reviewed | 99.64 | |
PRK12817 | 261 | flgG flagellar basal body rod protein FlgG; Reviewed | 99.61 | |
PRK12693 | 261 | flgG flagellar basal body rod protein FlgG; Provisional | 99.61 | |
COG4786 | 265 | FlgG Flagellar basal body rod protein [Cell motility an | 99.61 | |
PRK12636 | 263 | flgG flagellar basal body rod protein FlgG; Provisional | 99.61 | |
PRK12818 | 255 | flgG flagellar basal body rod protein FlgG; Reviewed | 99.61 | |
PRK12694 | 260 | flgG flagellar basal body rod protein FlgG; Reviewed | 99.61 | |
PRK12816 | 264 | flgG flagellar basal body rod protein FlgG; Reviewed | 99.6 | |
PRK12692 | 262 | flgG flagellar basal body rod protein FlgG; Reviewed | 99.58 | |
PRK12819 | 257 | flgG flagellar basal body rod protein FlgG; Reviewed | 99.54 | |
PRK12640 | 246 | flgF flagellar basal body rod protein FlgF; Reviewed | 99.53 | |
PRK12641 | 252 | flgF flagellar basal body rod protein FlgF; Reviewed | 99.51 | |
TIGR02490 | 254 | flgF flagellar basal-body rod protein FlgF; InterPro: I | 98.97 | |
PRK05682 | 414 | flgE flagellar hook protein FlgE; Validated | 98.91 | |
PRK06803 | 398 | flgE flagellar hook protein FlgE; Validated | 98.69 | |
PRK12637 | 473 | flgE flagellar hook protein FlgE; Provisional | 98.57 | |
COG4787 | 251 | FlgF Flagellar basal body rod protein [Cell motility an | 98.16 | |
PRK08425 | 716 | flgE flagellar hook protein FlgE; Validated | 98.0 | |
PRK05841 | 605 | flgE flagellar hook protein FlgE; Validated | 97.99 | |
pfam06429 | 39 | DUF1078 Domain of unknown function (DUF1078). This fami | 97.96 | |
PRK07739 | 500 | flgK flagellar hook-associated protein FlgK; Validated | 97.71 | |
TIGR02492 | 495 | flgK_ends flagellar hook-associated protein FlgK; Inter | 97.68 | |
COG1749 | 423 | FlgE Flagellar hook protein FlgE [Cell motility and sec | 97.57 | |
PRK07521 | 482 | flgK flagellar hook-associated protein FlgK; Validated | 97.48 | |
PRK06799 | 431 | flgK flagellar hook-associated protein FlgK; Validated | 97.41 | |
PRK07191 | 456 | flgK flagellar hook-associated protein FlgK; Validated | 97.37 | |
PRK08471 | 612 | flgK flagellar hook-associated protein FlgK; Validated | 97.37 | |
PRK05683 | 676 | flgK flagellar hook-associated protein FlgK; Validated | 97.36 | |
PRK08147 | 547 | flgK flagellar hook-associated protein FlgK; Validated | 97.32 | |
PRK06665 | 628 | flgK flagellar hook-associated protein FlgK; Validated | 97.32 | |
PRK12714 | 624 | flgK flagellar hook-associated protein FlgK; Provisiona | 97.31 | |
PRK12715 | 649 | flgK flagellar hook-associated protein FlgK; Provisiona | 97.31 | |
PRK06945 | 649 | flgK flagellar hook-associated protein FlgK; Validated | 97.3 | |
PRK08871 | 626 | flgK flagellar hook-associated protein FlgK; Validated | 97.26 | |
COG1256 | 552 | FlgK Flagellar hook-associated protein [Cell motility a | 97.17 | |
TIGR02489 | 877 | flgE_epsilon flagellar hook protein FlgE; InterPro: IPR | 96.88 |
>PRK06003 flgB flagellar basal body rod protein FlgB; Reviewed | Back alignment and domain information |
---|
>PRK12627 flgB flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>PRK05680 flgB flagellar basal body rod protein FlgB; Reviewed | Back alignment and domain information |
---|
>PRK12626 flgB flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>PRK12624 flgB flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>PRK06797 flgB flagellar basal body rod protein FlgB; Reviewed | Back alignment and domain information |
---|
>PRK12621 flgB flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>PRK12620 flgB flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>PRK12622 flgB flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>PRK12623 flgB flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>COG1815 FlgB Flagellar basal body protein [Cell motility and secretion] | Back alignment and domain information |
---|
>PRK06004 flgB flagellar basal body rod protein FlgB; Reviewed | Back alignment and domain information |
---|
>PRK12619 flgB flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>PRK12625 flgB flagellar basal body rod protein FlgB; Provisional | Back alignment and domain information |
---|
>PRK07182 flgB flagellar basal body rod protein FlgB; Reviewed | Back alignment and domain information |
---|
>PRK12685 flgB flagellar basal body rod protein FlgB; Reviewed | Back alignment and domain information |
---|
>PRK12632 flgC flagellar basal body rod protein FlgC; Provisional | Back alignment and domain information |
---|
>TIGR01395 FlgC flagellar basal-body rod protein FlgC; InterPro: IPR006299 These sequences represent FlgC, one of several components of bacterial flagella | Back alignment and domain information |
---|
>PRK12628 flgC flagellar basal body rod protein FlgC; Provisional | Back alignment and domain information |
---|
>PRK12630 flgC flagellar basal body rod protein FlgC; Provisional | Back alignment and domain information |
---|
>COG1558 FlgC Flagellar basal body rod protein [Cell motility and secretion] | Back alignment and domain information |
---|
>PRK06802 flgC flagellar basal body rod protein FlgC; Reviewed | Back alignment and domain information |
---|
>PRK12629 flgC flagellar basal body rod protein FlgC; Provisional | Back alignment and domain information |
---|
>PRK12631 flgC flagellar basal body rod protein FlgC; Provisional | Back alignment and domain information |
---|
>PRK12782 flgC flagellar basal body rod protein FlgC; Reviewed | Back alignment and domain information |
---|
>PRK05681 flgC flagellar basal body rod protein FlgC; Reviewed | Back alignment and domain information |
---|
>TIGR01396 FlgB flagellar basal-body rod protein FlgB; InterPro: IPR006300 Many bacterial species swim actively by means of flagella | Back alignment and domain information |
---|
>TIGR02488 flgG_G_neg flagellar basal-body rod protein FlgG; InterPro: IPR012834 This family consists of the FlgG protein of the flagellar apparatus in the proteobacteria and spirochetes | Back alignment and domain information |
---|
>TIGR03506 FlgEFG_subfam fagellar hook-basal body proteins | Back alignment and domain information |
---|
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional | Back alignment and domain information |
---|
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional | Back alignment and domain information |
---|
>pfam00460 Flg_bb_rod Flagella basal body rod protein | Back alignment and domain information |
---|
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK12643 flgF flagellar basal body rod protein FlgF; Reviewed | Back alignment and domain information |
---|
>COG1749 FlgE Flagellar hook protein FlgE [Cell motility and secretion] | Back alignment and domain information |
---|
>PRK05841 flgE flagellar hook protein FlgE; Validated | Back alignment and domain information |
---|
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway | Back alignment and domain information |
---|
>PRK08425 flgE flagellar hook protein FlgE; Validated | Back alignment and domain information |
---|
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] | Back alignment and domain information |
---|
>PRK05682 flgE flagellar hook protein FlgE; Validated | Back alignment and domain information |
---|
>PRK12637 flgE flagellar hook protein FlgE; Provisional | Back alignment and domain information |
---|
>PRK06803 flgE flagellar hook protein FlgE; Validated | Back alignment and domain information |
---|
>TIGR02489 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR012835 Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the proteobacteria (Helicobacter, Wolinella, and Campylobacter) | Back alignment and domain information |
---|
>PRK12642 flgF flagellar basal body rod protein FlgF; Reviewed | Back alignment and domain information |
---|
>PRK12690 flgF flagellar basal body rod protein FlgF; Reviewed | Back alignment and domain information |
---|
>PRK12691 flgG flagellar basal body rod protein FlgG; Reviewed | Back alignment and domain information |
---|
>PRK12689 flgF flagellar basal body rod protein FlgF; Reviewed | Back alignment and domain information |
---|
>PRK12817 flgG flagellar basal body rod protein FlgG; Reviewed | Back alignment and domain information |
---|
>PRK12693 flgG flagellar basal body rod protein FlgG; Provisional | Back alignment and domain information |
---|
>COG4786 FlgG Flagellar basal body rod protein [Cell motility and secretion] | Back alignment and domain information |
---|
>PRK12636 flgG flagellar basal body rod protein FlgG; Provisional | Back alignment and domain information |
---|
>PRK12818 flgG flagellar basal body rod protein FlgG; Reviewed | Back alignment and domain information |
---|
>PRK12694 flgG flagellar basal body rod protein FlgG; Reviewed | Back alignment and domain information |
---|
>PRK12816 flgG flagellar basal body rod protein FlgG; Reviewed | Back alignment and domain information |
---|
>PRK12692 flgG flagellar basal body rod protein FlgG; Reviewed | Back alignment and domain information |
---|
>PRK12819 flgG flagellar basal body rod protein FlgG; Reviewed | Back alignment and domain information |
---|
>PRK12640 flgF flagellar basal body rod protein FlgF; Reviewed | Back alignment and domain information |
---|
>PRK12641 flgF flagellar basal body rod protein FlgF; Reviewed | Back alignment and domain information |
---|
>TIGR02490 flgF flagellar basal-body rod protein FlgF; InterPro: IPR012836 Members of this protein are FlgF, one of several homologous flagellar basal-body rod proteins in bacteria | Back alignment and domain information |
---|
>PRK05682 flgE flagellar hook protein FlgE; Validated | Back alignment and domain information |
---|
>PRK06803 flgE flagellar hook protein FlgE; Validated | Back alignment and domain information |
---|
>PRK12637 flgE flagellar hook protein FlgE; Provisional | Back alignment and domain information |
---|
>COG4787 FlgF Flagellar basal body rod protein [Cell motility and secretion] | Back alignment and domain information |
---|
>PRK08425 flgE flagellar hook protein FlgE; Validated | Back alignment and domain information |
---|
>PRK05841 flgE flagellar hook protein FlgE; Validated | Back alignment and domain information |
---|
>pfam06429 DUF1078 Domain of unknown function (DUF1078) | Back alignment and domain information |
---|
>PRK07739 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>TIGR02492 flgK_ends flagellar hook-associated protein FlgK; InterPro: IPR002371 Within the bacterial flagellum, the basal-body rod, the hook, the hook- associated proteins (HAPs), and the helical filament together constitute an axial substructure whose elements share structural features and a common export pathway | Back alignment and domain information |
---|
>COG1749 FlgE Flagellar hook protein FlgE [Cell motility and secretion] | Back alignment and domain information |
---|
>PRK07521 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK06799 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK07191 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK08471 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK05683 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK08147 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK06665 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK12714 flgK flagellar hook-associated protein FlgK; Provisional | Back alignment and domain information |
---|
>PRK12715 flgK flagellar hook-associated protein FlgK; Provisional | Back alignment and domain information |
---|
>PRK06945 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>PRK08871 flgK flagellar hook-associated protein FlgK; Validated | Back alignment and domain information |
---|
>COG1256 FlgK Flagellar hook-associated protein [Cell motility and secretion] | Back alignment and domain information |
---|
>TIGR02489 flgE_epsilon flagellar hook protein FlgE; InterPro: IPR012835 Members of this family are flagellar hook proteins, designated FlgE, as found in the epsilon subdivision of the proteobacteria (Helicobacter, Wolinella, and Campylobacter) | Back alignment and domain information |
---|
Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch
Homologous Structures Detected by PSI-BLAST against Nonredundant Database
No homologous structure with e-value below 0.005
Homologous Structures in PDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Homologous Structures in PDB70 Database Detected by HHsearch
Original result of HHsearch against PDB70 database
Identity | Alignment graph | Length | Definition | Probability |
Target | 130 | flagellar basal body rod protein FlgB [Candidatus Liber | ||
3a69_A | 402 | Flagellar HOOK protein FLGE; the bacterial flagellar mo | 99.11 | |
1ucu_A | 494 | Phase 1 flagellin; flagellar filament, cryo-electron mi | 90.42 | |
3a69_A | 402 | Flagellar HOOK protein FLGE; the bacterial flagellar mo | 98.17 |
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} | Back alignment and structure |
---|
Probab=99.11 E-value=2.8e-11 Score=78.09 Aligned_cols=38 Identities=21% Similarity=0.288 Sum_probs=36.0 Q ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 52008999999999999999999999999999999636 Q gi|254780381|r 92 NTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVR 129 (130) Q Consensus 92 n~Vdl~~Em~~~~~~~~~Y~a~~~~~~~~~~~~~~al~ 129 (130) .+|||++||++|+.-|+.|+|+.++|....+||.++|. T Consensus 363 S~V~ldeEmtnli~~Q~aY~A~akvitt~demld~lin 400 (402) T 3a69_A 363 SNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVN 400 (402) T ss_dssp ----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 14799999999999999999975266499999999970 |
>1ucu_A Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} SCOP: e.32.1.1 PDB: 3a5x_A | Back alignment and structure |
---|
>3a69_A Flagellar HOOK protein FLGE; the bacterial flagellar motor, universal joint, bacterial flagellum, motor protein; 7.10A {Salmonella enterica subsp} | Back alignment and structure |
---|
Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch
Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 90.00
Homologous Domains in MMDB70 Database Detected by RPS-BLAST
Original result of RPS-BLAST against MMDB70 database
No hit with e-value below 0.005
Homologous Domains in MMDB70 Database Detected by HHsearch
Original result of HHsearch against MMDB70 database
Identity | Alignment graph | Length | Definition | Probability |
Target | 130 | flagellar basal body rod protein FlgB [Candidatus Liber | ||
1ucu_A_1-40_455-494 | 80 | Phase 1 flagellin; flagellar filament, cryo-electr | 90.07 |
>1ucu_A (A:1-40,A:455-494) Phase 1 flagellin; flagellar filament, cryo-electron microscopy, helical reconstruction, structural protein; 4.00A {Salmonella typhimurium} | Back alignment and structure |
---|
Probab=90.07 E-value=0.94 Score=22.84 Aligned_cols=38 Identities=13% Similarity=0.198 Sum_probs=34.3 Q ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 52008999999999999999999999999999999636 Q gi|254780381|r 92 NTVGITNELYKSGHIKYLYELNTKLIKKLNSMVMHVVR 129 (130) Q Consensus 92 n~Vdl~~Em~~~~~~~~~Y~a~~~~~~~~~~~~~~al~ 129 (130) -.+|+..||+++.+.++..|+...++.....+=+.+++ T Consensus 40 ADaD~A~E~~~~tk~qIL~Qa~~amLaQAN~~pq~vl~ 77 (80) T 1ucu_A 40 ADSDYATEVSNMSRAQILQQAGTSVLAQANQVPQNVLS 77 (80) T ss_dssp SCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT T ss_pred CHCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH T ss_conf 21319999999999999999999999997416789998 |