254780384

254780384

serralysin

GeneID in NCBI database:8209369Locus tag:CLIBASIA_01345
Protein GI in NCBI database:254780384Protein Accession:YP_003064797.1
Gene range:-(280315, 282312)Protein Length:665aa
Gene description:serralysin
COG prediction:[Q] RTX toxins and related Ca2+-binding proteins
KEGG prediction:serralysin
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-----
MHNIKPVYTTERIADHLLRDQYWSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPKGSLGNNIYKIEVQQKDSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVYDANEHKQDFLSDVERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKHFYEFGLSEGRDITFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQVGKDHFSNFGCEEGRFVTFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQAGKDHFSNFGYEEGRSITFNPDLYLTSYDDLWNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVMNLSEKSRDKADLSLSFDHKKVDLYTDYFGDGNYYDSDLYSMHDINHDFS
cccccccccHHHHHHHHcccHHHccccEEEEEccccccEEEEEEccccHHHHHHHHHHHHHHHHHHccEEEEcccccccEEEEccccccccccccccccccccccccccEEccccccccccccEEEEcHHHcccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccccccccccccccEEEEEEccccccccEEEcccccccccccccccEEEcccccEEEEccccccEEEccccccEEEccccccEEEcccccEEEEEcccccEEEEEcccccEEEEccccccccEEEccccEEEccccccccccccccEEEccccccEEEEcccccEEEccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccHHHHHccccccccccccccccccccccccccccHHHHHccccccHHHccccccccHHHHHHHHHHcccccccccccEEEcccccccccccccHHHHHcccccEEEEccccccEEEEEcHHHHHcccccHHHHHccccHHHHHHHHHcccccccEEEEEHHHccEEEcHHHHHHcccccEEEEcccEEEEEEEEcccccccccccHHHHccccccc
cccccccccHHHHHHHHHccccccccccccccccccEEEcccccHHccHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEcccccccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHcEEccccccccccccccccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHccccccccccEcccccccccccEEEEEEccccccEEEEcccccccEEEEcccccEEEccccEccEEEcccccccEEEccccccEEEccccccEEEccccccEEEccccccEEEcccccccEEEccccccEEEEccccccccEEHccHHHccccccccEEcccccccccEEEEcccHccHcccHHHHHHHHHHHccccccccEEHHHHHHHHccccHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHcccccHEEEcHHcEcccccccccEEEEcHHHHHHcccHHHHHHcHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHcccccccEEEEcccEEEEcHHHHHHHHcccHHHHHHHHHHcccccccEEEEccccEEEHEcccccccccccEEEEcccccEEEEEEccccccccccccccHcccccccc
mhnikpvyttERIADHLLRDQYWSNYFirykpdvltthrlsfditelnpNAQEVARWALGewskvvdltfeetsihsdikfissnngyvctprydsryfmeinfdkadvwrygigkgtilsHNALHEIGHAlglmhpgsynggypvygvdndyendsFLTSVMSYfmpqdsmmdasfgycatpmvSDIVAVQKIygapkgslgnniykievqqkdspFIQTIydsggddlldltLIGGVKnyidlnteswssiggyeknmTIAQHTVIESvvgssgndvvignsannvffessgndvfdgssgldtffyyapsylykiyRFENAIIVYDANEHKQDFLSDVERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKHFYEFGlsegrditfdsylylgsyddlrnvfgsdrgAAARHYIThgvkegrnpdAFKALEYIASHEDLINAfadapdlvqvgkdhfsnfgceegrfvtfdsylylgsyddlrnvfgsdrgAAARHYIThgvkegrnpdAFKALEYIASHEDLINAFadapdlvqagkdhfsnfgyeegrsitfnpdlyltsyDDLWNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVmnlseksrdkadlslsfdhkkvdlytdyfgdgnyydsdlysmhdinhdfs
mhnikpvytteriadHLLRDQYWSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIhsdikfissnngyVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPKGSLGNNIYKIEVQQKDSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVYDANEHKQDFLSDVERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKHFYEFGLSEGRDITFDSYLYLGSYDDLRNVFGSDRGAAARHYIthgvkegrnPDAFKALEYIASHEDLINAFADAPDLVQVGKDHFSNFGCEEGRFVTFDSYLYLGSYDDLRNVFGSDRGAAARHYIthgvkegrnPDAFKALEYIASHEDLINAFADAPDLVQAGKDHFSNFGYEEGRSITFNPDLYLTSYDDLWNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVMNLSEKSRDKADlslsfdhkkvDLYTDYFGDGNYYDSDLYSMHDINHDFS
MHNIKPVYTTERIADHLLRDQYWSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPKGSLGNNIYKIEVQQKDSPFIQTIYdsggddlldltliggVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVYDANEHKQDFLSDVERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKHFYEFGLSEGRDITFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQVGKDHFSNFGCEEGRFVTFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQAGKDHFSNFGYEEGRSITFNPDLYLTSYDDLWNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVMNLSEKSRDKADLSLSFDHKKVDLYTDYFGDGNYYDSDLYSMHDINHDFS
***IKPVYTTERIADHLLRDQYWSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPKGSLGNNIYKIEVQQKDSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVYDANEHKQDFLSDVERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKHFYEFGLSEGRDITFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQVGKDHFSNFGCEEGRFVTFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQAGKDHFSNFGYEEGRSITFNPDLYLTSYDDLWNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVMNLSEKSRDKADLSLSFDHKKVDLYTDYFGDGNYYDSDLYSMHDIN****
MHNIKPVYTTERIADHLLRDQYWSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPKGSLGNNIYKIEVQQKDSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVYDANEHKQDFLSDVERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKHFYEFGLSEGRDITFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQVGKDHFSNFGCEEGRFVTFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQAGKDHFSNFGYEEGRSITFNPDLYLTSYDDLWNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVMNLSEKSRDKADLSLSFDHKKVDLYTDYFGDGNYYDSDLYSMHDINHDFS
****KPVYTTERIADHLLRDQYWSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPKGSLGNNIYKIEVQQKDSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVYDANEHKQDFLSDVERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKHFYEFGLSEGRDITFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQVGKDHFSNFGCEEGRFVTFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQAGKDHFSNFGYEEGRSITFNPDLYLTSYDDLWNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVMNLSEKSRDKADLSLSFDHKKVDLYTDYFGDGNYYDSDLYS*H*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHNIKPVYTTERIADHLLRDQYWSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPKGSLGNNIYKIEVQQKDSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVYDANEHKQDFLSDVERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKHFYEFGLSEGRDITFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQVGKDHFSNFGCEEGRFVTFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQAGKDHFSNFGYEEGRSITFNPDLYLTSYDDLWNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVMNLSEKSRDKADLSLSFDHKKVDLYTDYFGDGNYYDSDLYSMHDINHDFS
MHNIKPVYTTERIADHLLRDQYWSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPKGSLGNNIYKIEVQQKDSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVYDANEHKQDFLSDVERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKHFYEFGLSEGRDITFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQVGKDHFSNFGCEEGRFVTFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQAGKDHFSNFGYEEGRSITFNPDLYLTSYDDLWNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVMNLSEKSRDKADLSLSFDHKKVDLYTDYFGDGNYYDSDLYSMHDINHDFS
MHNIKPVYTTERIADHLLRDQYWSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALGEWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPKGSLGNNIYKIEVQQKDSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVYDANEHKQDFLSDVERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKHFYEFGLSEGRDITFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQVGKDHFSNFGCEEGRFVTFDSYLYLGSYDDLRNVFGSDRGAAARHYITHGVKEGRNPDAFKALEYIASHEDLINAFADAPDLVQAGKDHFSNFGYEEGRSITFNPDLYLTSYDDLWNVFGSDRSAAAQHYITHGMKEGRALGISGMQFKSVMNLSEKSRDKADLSLSFDHKKVDLYTDYFGDGNYYDSDLYSMHDINHDFS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target665 serralysin [Candidatus Liberibacter asiaticus str. psy6
315122203493 serralysin [Candidatus Liberibacter solanacearum CLso-Z 1 1e-169
315122203493 serralysin [Candidatus Liberibacter solanacearum CLso-Z 1 2e-18
315122203493 serralysin [Candidatus Liberibacter solanacearum CLso-Z 1 5e-18
328541869789 peptidase M10, serralysin-like protein [polymorphum gil 1 2e-91
328541869789 peptidase M10, serralysin-like protein [polymorphum gil 1 1e-26
328541869789 peptidase M10, serralysin-like protein [polymorphum gil 1 3e-12
254501291506 Peptidase M10 serralysin C terminal domain family [Labr 1 2e-46
254501291506 Peptidase M10 serralysin C terminal domain family [Labr 1 1e-10
254501291506 Peptidase M10 serralysin C terminal domain family [Labr 1 9e-08
254501291506 Peptidase M10 serralysin C terminal domain family [Labr 1 2e-07
>gi|315122203|ref|YP_004062692.1| serralysin [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 493 Back     alignment and organism information
 Score =  598 bits (1543), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 293/438 (66%), Positives = 345/438 (78%), Gaps = 1/438 (0%)

Query: 1   MHNIKPVYTTERIADHLLRDQYWSNYFIRYKPDVLTTHRLSFDITELNPNAQEVARWALG 60
           M +IKPVYTTE IAD+LLRD YW+NYF++Y+P V T HRLSFD+TELN N QE+ RWA  
Sbjct: 1   MDDIKPVYTTESIADYLLRDSYWANYFLKYQPTVYTDHRLSFDVTELNANGQEIVRWAFR 60

Query: 61  EWSKVVDLTFEETSIHSDIKFISSNNGYVCTPRYDSRYFMEINFDKADVWRYGIGKGTIL 120
           EWSKVV++TFEETS  SDI+F S++ GY+C P+ + RYFMEIN D  DV  YGI KGTIL
Sbjct: 61  EWSKVVNITFEETSNLSDIQFKSNDFGYICIPKNNFRYFMEINLDARDVDFYGIDKGTIL 120

Query: 121 SHNALHEIGHALGLMHPGSYNGGYPVYGVDNDYENDSFLTSVMSYF-MPQDSMMDASFGY 179
           SHNA+HEIGHALGL+H G YNGG P YGVDN Y NDSFLTSVMSYF   ++   DASFGY
Sbjct: 121 SHNAIHEIGHALGLLHAGPYNGGSPTYGVDNQYANDSFLTSVMSYFDQNENRTTDASFGY 180

Query: 180 CATPMVSDIVAVQKIYGAPKGSLGNNIYKIEVQQKDSPFIQTIYDSGGDDLLDLTLIGGV 239
           CATPMV+DIVAVQKIYGAPK  +G+ I+KIEV+Q  SPFIQTIYDSGG DLLD+  +G  
Sbjct: 181 CATPMVADIVAVQKIYGAPKTLVGDTIHKIEVKQGYSPFIQTIYDSGGSDLLDVQSVGTF 240

Query: 240 KNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIGNSANNVFFESSGNDVFD 299
            NYIDLN ESWSSIGGY+KN+TIA+ T+IESV+G +GND +IGNSANN  F+S GND F 
Sbjct: 241 DNYIDLNPESWSSIGGYKKNVTIARDTIIESVIGGAGNDTIIGNSANNTLFKSGGNDTFY 300

Query: 300 GSSGLDTFFYYAPSYLYKIYRFENAIIVYDANEHKQDFLSDVERLRFADQCIDSVNVKQR 359
           G+ G D   Y      YKIYRF+N  I+YD   ++ D + DVE LRF++  ID  ++KQ+
Sbjct: 301 GADGWDVMVYSMLKNDYKIYRFKNEAIIYDMFRNEVDDIIDVESLRFSNDQIDLADIKQQ 360

Query: 360 SILEYTASYEDLIQVIGQDVFESMKHFYEFGLSEGRDITFDSYLYLGSYDDLRNVFGSDR 419
           SILEYTASY DL+Q IG DV  S KHF +FGL EGRDITF+ YLYLGSYDDLR VFGSD+
Sbjct: 361 SILEYTASYGDLVQCIGNDVNASKKHFVDFGLREGRDITFNPYLYLGSYDDLRQVFGSDK 420

Query: 420 GAAARHYITHGVKEGRNP 437
            +A RHYITHG +EGRNP
Sbjct: 421 DSATRHYITHGFREGRNP 438


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122203|ref|YP_004062692.1| serralysin [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 493 Back     alignment and organism information
>gi|315122203|ref|YP_004062692.1| serralysin [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 493 Back     alignment and organism information
>gi|328541869|ref|YP_004301978.1| peptidase M10, serralysin-like protein [polymorphum gilvum SL003B-26A1] Length = 789 Back     alignment and organism information
>gi|328541869|ref|YP_004301978.1| peptidase M10, serralysin-like protein [polymorphum gilvum SL003B-26A1] Length = 789 Back     alignment and organism information
>gi|328541869|ref|YP_004301978.1| peptidase M10, serralysin-like protein [polymorphum gilvum SL003B-26A1] Length = 789 Back     alignment and organism information
>gi|254501291|ref|ZP_05113442.1| Peptidase M10 serralysin C terminal domain family [Labrenzia alexandrii DFL-11] Length = 506 Back     alignment and organism information
>gi|254501291|ref|ZP_05113442.1| Peptidase M10 serralysin C terminal domain family [Labrenzia alexandrii DFL-11] Length = 506 Back     alignment and organism information
>gi|254501291|ref|ZP_05113442.1| Peptidase M10 serralysin C terminal domain family [Labrenzia alexandrii DFL-11] Length = 506 Back     alignment and organism information
>gi|254501291|ref|ZP_05113442.1| Peptidase M10 serralysin C terminal domain family [Labrenzia alexandrii DFL-11] Length = 506 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target665 serralysin [Candidatus Liberibacter asiaticus str. psy6
pfam08548220 pfam08548, Peptidase_M10_C, Peptidase M10 serralysin C 7e-13
cd04278157 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, matr 3e-07
pfam00413158 pfam00413, Peptidase_M10, Matrixin 2e-06
KOG1565469 KOG1565, KOG1565, KOG1565, Gelatinase A and related mat 3e-06
cd04268165 cd04268, ZnMc_MMP_like, Zinc-dependent metalloprotease, 1e-04
cd04277186 cd04277, ZnMc_serralysin_like, Zinc-dependent metallopr 9e-20
smart00235140 smart00235, ZnMc, Zinc-dependent metalloprotease 2e-06
cd04276197 cd04276, ZnMc_MMP_like_2, Zinc-dependent metalloproteas 2e-04
>gnl|CDD|117125 pfam08548, Peptidase_M10_C, Peptidase M10 serralysin C terminal Back     alignment and domain information
>gnl|CDD|58578 cd04278, ZnMc_MMP, Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>gnl|CDD|144126 pfam00413, Peptidase_M10, Matrixin Back     alignment and domain information
>gnl|CDD|36778 KOG1565, KOG1565, KOG1565, Gelatinase A and related matrix metalloproteases [Posttranslational modification, protein turnover, chaperones, Extracellular structures] Back     alignment and domain information
>gnl|CDD|58569 cd04268, ZnMc_MMP_like, Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>gnl|CDD|58577 cd04277, ZnMc_serralysin_like, Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>gnl|CDD|128531 smart00235, ZnMc, Zinc-dependent metalloprotease Back     alignment and domain information
>gnl|CDD|58576 cd04276, ZnMc_MMP_like_2, Zinc-dependent metalloprotease; MMP_like sub-family 2 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 665 serralysin [Candidatus Liberibacter asiaticus str. psy6
cd04277186 ZnMc_serralysin_like Zinc-dependent metalloprotease, se 100.0
pfam00413158 Peptidase_M10 Matrixin. The members of this family are 99.83
cd04278157 ZnMc_MMP Zinc-dependent metalloprotease, matrix metallo 99.8
cd04279156 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_lik 99.67
cd00203167 ZnMc Zinc-dependent metalloprotease. This super-family 99.66
KOG1565469 consensus 99.57
cd04268165 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like 99.47
cd04327198 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_lik 99.38
KOG3714411 consensus 98.74
cd04276197 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_lik 98.49
pfam08548220 Peptidase_M10_C Peptidase M10 serralysin C terminal. Se 100.0
smart00235140 ZnMc Zinc-dependent metalloprotease. Neutral zinc metal 99.26
cd04281200 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD- 98.94
pfam01400192 Astacin Astacin (Peptidase family M12A). The members of 98.92
cd04283182 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, ha 98.87
cd04280180 ZnMc_astacin_like Zinc-dependent metalloprotease, astac 98.76
cd04282230 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like 98.67
pfam02031132 Peptidase_M7 Streptomyces extracellular neutral protein 97.04
COG5549236 Predicted Zn-dependent protease [Posttranslational modi 96.97
pfam11350189 DUF3152 Protein of unknown function (DUF3152). Some mem 94.66
TIGR00181611 pepF oligoendopeptidase F; InterPro: IPR004438 Metallop 90.33
pfam12388211 Peptidase_M57 Dual-action HEIGH metallo-peptidase. The 99.12
pfam08548220 Peptidase_M10_C Peptidase M10 serralysin C terminal. Se 98.45
COG2931510 RTX toxins and related Ca2+-binding proteins [Secondary 98.4
COG2931510 RTX toxins and related Ca2+-binding proteins [Secondary 98.18
pfam05572152 Peptidase_M43 Pregnancy-associated plasma protein-A. Pr 97.7
cd04275225 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pa 97.37
pfam05548303 Peptidase_M11 Gametolysin peptidase M11. In the unicell 94.01
COG1913181 Predicted Zn-dependent proteases [General function pred 96.06
cd04272220 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, 96.01
PRK13267177 archaemetzincin-like protein; Reviewed 95.22
pfam10462304 Peptidase_M66 Peptidase M66. This family of metallopept 95.17
pfam07998176 Peptidase_M54 Peptidase family M54. This is a family of 95.05
cd04271228 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_f 94.78
cd04269194 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; 94.76
cd04273207 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS 94.52
pfam01421198 Reprolysin Reprolysin (M12B) family zinc metalloproteas 94.28
pfam12044419 Metallopep Putative peptidase family. This family of pr 93.85
cd04267192 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_lik 95.92
TIGR03296286 M6dom_TIGR03296 M6 family metalloprotease domain. This 92.61
pfam05547646 Peptidase_M6 Immune inhibitor A peptidase M6. The insec 95.61
pfam11996 934 DUF3491 Protein of unknown function (DUF3491). This fam 90.66
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily Back     alignment and domain information
>pfam00413 Peptidase_M10 Matrixin Back     alignment and domain information
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family Back     alignment and domain information
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1 Back     alignment and domain information
>cd00203 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>KOG1565 consensus Back     alignment and domain information
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily Back     alignment and domain information
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3 Back     alignment and domain information
>KOG3714 consensus Back     alignment and domain information
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2 Back     alignment and domain information
>pfam08548 Peptidase_M10_C Peptidase M10 serralysin C terminal Back     alignment and domain information
>smart00235 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily Back     alignment and domain information
>pfam01400 Astacin Astacin (Peptidase family M12A) Back     alignment and domain information
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily Back     alignment and domain information
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily Back     alignment and domain information
>pfam02031 Peptidase_M7 Streptomyces extracellular neutral proteinase (M7) family Back     alignment and domain information
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam11350 DUF3152 Protein of unknown function (DUF3152) Back     alignment and domain information
>TIGR00181 pepF oligoendopeptidase F; InterPro: IPR004438 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>pfam12388 Peptidase_M57 Dual-action HEIGH metallo-peptidase Back     alignment and domain information
>pfam08548 Peptidase_M10_C Peptidase M10 serralysin C terminal Back     alignment and domain information
>COG2931 RTX toxins and related Ca2+-binding proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2931 RTX toxins and related Ca2+-binding proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>pfam05572 Peptidase_M43 Pregnancy-associated plasma protein-A Back     alignment and domain information
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily Back     alignment and domain information
>pfam05548 Peptidase_M11 Gametolysin peptidase M11 Back     alignment and domain information
>COG1913 Predicted Zn-dependent proteases [General function prediction only] Back     alignment and domain information
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs Back     alignment and domain information
>PRK13267 archaemetzincin-like protein; Reviewed Back     alignment and domain information
>pfam10462 Peptidase_M66 Peptidase M66 Back     alignment and domain information
>pfam07998 Peptidase_M54 Peptidase family M54 Back     alignment and domain information
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup Back     alignment and domain information
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily Back     alignment and domain information
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup Back     alignment and domain information
>pfam01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease Back     alignment and domain information
>pfam12044 Metallopep Putative peptidase family Back     alignment and domain information
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup Back     alignment and domain information
>TIGR03296 M6dom_TIGR03296 M6 family metalloprotease domain Back     alignment and domain information
>pfam05547 Peptidase_M6 Immune inhibitor A peptidase M6 Back     alignment and domain information
>pfam11996 DUF3491 Protein of unknown function (DUF3491) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target665 serralysin [Candidatus Liberibacter asiaticus str. psy6
1k7g_A479 Prtc From Erwinia Chrysanthemi Length = 479 1e-61
1k7i_A479 Prtc From Erwinia Chrysanthemi: Y228f Mutant Length 4e-61
1k7q_A479 Prtc From Erwinia Chrysanthemi: E189a Mutant Length 6e-61
1go8_P462 The Metzincin's Methionine: Prtc M226l Mutant Lengt 5e-60
3hbv_P462 Prtc Methionine Mutants: M226a In-House Length = 46 1e-59
3hbu_P462 Prtc Methionine Mutants: M226h Desy Length = 462 1e-59
1go7_P462 The Metzincin's Methionine: Prtc M226c-E189k Double 2e-59
3hb2_P462 Prtc Methionine Mutants: M226i Length = 462 4e-59
1srp_A471 Structural Analysis Of Serratia Protease Length = 4 2e-58
1smp_A471 Crystal Structure Of A Complex Between Serratia Mar 4e-58
1af0_A471 Serratia Protease In Complex With Inhibitor Length 4e-58
1sat_A471 Crystal Structure Of The 50 Kda Metallo Protease Fr 8e-58
1g9k_A463 Crystal Structure Of A Psychrophilic Alkaline Prote 2e-57
1h71_P463 Psychrophilic Protease From Pseudoalteromonas 'tac 6e-57
1kap_P479 Three-Dimensional Structure Of The Alkaline Proteas 3e-54
1jiw_P470 Crystal Structure Of The Apr-Aprin Complex Length = 1e-53
1hv5_A165 Crystal Structure Of The Stromelysin-3 (Mmp-11) Cat 9e-10
1su3_A450 X-Ray Structure Of Human Prommp-1: New Insights Int 1e-08
1fbl_A370 Structure Of Full-Length Porcine Synovial Collagena 3e-08
3ba0_A365 Crystal Structure Of Full-Length Human Mmp-12 Lengt 2e-07
2clt_A367 Crystal Structure Of The Active Form (Full-Length) 1e-06
1slm_A255 Crystal Structure Of Fibroblast Stromelysin-1: The 6e-06
1qib_A161 Crystal Structure Of Gelatinase A Catalytic Domain 2e-05
2j0t_A170 Crystal Structure Of The Catalytic Domain Of Mmp-1 2e-05
3ayk_A169 Catalytic Fragment Of Human Fibroblast Collagenase 3e-05
1cge_A168 Crystal Structures Of Recombinant 19-Kda Human Fibr 4e-05
1cgl_A169 Structure Of The Catalytic Domain Of Fibroblast Col 4e-05
1cgf_A162 Crystal Structures Of Recombinant 19-Kda Human Fibr 3e-04
1ums_A174 Stromelysin-1 Catalytic Domain With Hydrophobic Inh 3e-04
966c_A157 Crystal Structure Of Fibroblast Collagenase-1 Compl 3e-04
1caq_A168 X-Ray Structure Of Human Stromelysin Catalytic Doma 4e-04
1qia_A162 Crystal Structure Of Stromelysin Catalytic Domain L 4e-04
1sln_A173 Crystal Structure Of The Catalytic Domain Of Human 4e-04
2d1o_A171 Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Aci 4e-04
1biw_A173 Design And Synthesis Of Conformationally-Constraine 4e-04
1qic_A161 Crystal Structure Of Stromelysin Catalytic Domain L 5e-04
1b8y_A167 X-Ray Structure Of Human Stromelysin Catalytic Doma 5e-04
1uea_A173 Mmp-3TIMP-1 Complex Length = 173 0.001
1c8t_A167 Human Stromelysin-1 (E202q) Catalytic Domain Comple 0.003
1rm8_A169 Crystal Structure Of The Catalytic Domain Of Mmp-16 2e-07
1gkc_A163 Mmp9-Inhibitor Complex Length = 163 1e-05
2k2g_A165 Solution Structure Of The Wild-Type Catalytic Domai 1e-05
1bqq_M174 Crystal Structure Of The Mt1-Mmp--Timp-2 Complex Le 2e-05
3ma2_D181 Complex Membrane Type-1 Matrix Metalloproteinase (M 2e-05
2z2d_A164 Solution Structure Of Human Macrophage Elastase (Mm 2e-05
1os2_A165 Ternary Enzyme-Product-Inhibitor Complexes Of Human 2e-05
2wo8_A164 Mmp12 Complex With A Beta Hydroxy Carboxylic Acid L 2e-05
2jsd_A160 Solution Structure Of Mmp20 Complexed With Nngh Len 3e-05
1rmz_A159 Crystal Structure Of The Catalytic Domain Of Human 4e-05
1ros_A163 Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dio 4e-05
1jiz_A166 Crystal Structure Analysis Of Human Macrophage Elas 4e-05
1gkd_A163 Mmp9 Active Site Mutant-Inhibitor Complex Length = 6e-05
3f15_A158 Crystal Structure Of The Catalytic Domain Of Human 7e-05
1utt_A159 Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dio 7e-05
2w0d_A164 Does A Fast Nuclear Magnetic Resonance Spectroscopy 8e-05
2ovx_A159 Mmp-9 Active Site Mutant With Barbiturate Inhibitor 8e-05
2poj_A164 Nmr Solution Structure Of The Inhibitor-Free State 1e-04
1cxv_A164 Structure Of Recombinant Mouse Collagenase-3 (Mmp-1 1e-04
1jk3_A158 Crystal Structure Of Human Mmp-12 (Macrophage Elast 2e-04
1q3a_A165 Crystal Structure Of The Catalytic Domain Of Human 0.001
1usn_A165 Crystal Structure Of The Catalytic Domain Of Human 0.001
2jnp_A161 Solution Structure Of Matrix Metalloproteinase 3 (M 0.001
1hfs_A160 Crystal Structure Of The Catalytic Domain Of Human 0.002
1fls_A165 Solution Structure Of The Catalytic Fragment Of Hum 0.003
3ljz_A164 Crystal Structure Of Human Mmp-13 Complexed With An 0.003
2d1n_A166 Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Ac 0.004
3kry_A164 Crystal Structure Of Mmp-13 In Complex With Sc-7808 0.004
2z8z_A617 Crystal Structure Of A Platinum-Bound S445c Mutant 5e-05
2zj7_A617 Crystal Structure Of D157a Mutant Of Pseudomonas Sp 6e-05
2zj6_A617 Crystal Structure Of D337a Mutant Of Pseudomonas Sp 6e-05
2z8x_A617 Crystal Structure Of Extracellular Lipase From Pseu 6e-05
2z8z_A617 Crystal Structure Of A Platinum-Bound S445c Mutant 2e-04
2zj7_A617 Crystal Structure Of D157a Mutant Of Pseudomonas Sp 1e-04
2zj6_A617 Crystal Structure Of D337a Mutant Of Pseudomonas Sp 1e-04
2z8x_A617 Crystal Structure Of Extracellular Lipase From Pseu 1e-04
2k9c_A152 Paramagnetic Shifts In Solid-State Nmr Of Proteins 9e-04
gi|24987447|pdb|1K7G|A Chain A, Prtc From Erwinia Chrysanthemi Length = 479 Back     alignment and structure
 Score =  242 bits (618), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 100/417 (23%), Positives = 165/417 (39%), Gaps = 38/417 (9%)

Query: 3   NIKPVYTTERIADHLLRD--------QYWSNYFIRYKPDVLTTHRLSFD--ITELNPNAQ 52
           N K  Y+ ++ A  + R+         +  +  + +K     +   S D    + N    
Sbjct: 43  NGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQI 102

Query: 53  EVARWALGEWSKVVDLTFEETSIHSDIKFISSNN-------------GYVCTPRYDSRYF 99
           E A+ +L  WS V +LTF E + +        N               Y   P  + +  
Sbjct: 103 EQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYP-GNYQGA 161

Query: 100 MEINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGG-YPVYGVDNDYENDSF 158
               ++         G          HEIGHALGL HPG YN G       D  Y  DS+
Sbjct: 162 GSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSY 221

Query: 159 LTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAP-KGSLGNNIYKIEVQQ---- 213
             S+MSY+   ++  D +  Y   PM+ DI A+Q++YGA      G+++Y          
Sbjct: 222 QFSIMSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDF 281

Query: 214 -----KDSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVI 268
                     I +++D+GG D  D +     +  I+LN  S+S +GG + N++IA    I
Sbjct: 282 YTATDSSKALIFSVWDAGGTDTFDFSGYSNNQ-RINLNEGSFSDVGGLKGNVSIAHGVTI 340

Query: 269 ESVVGSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYRFENAIIVY 328
           E+ +G SGND+++GNSA+N+    +GNDV  G +G DT +    +               
Sbjct: 341 ENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLY--GGAGRDTFVYGSGQDSTV 398

Query: 329 DANEHKQDFLSDVERLRFADQCIDSVNVKQRSILEYTASYEDLIQVIGQDVFESMKH 385
            A +   DF   ++++  +    +      +           L       +     H
Sbjct: 399 AAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLH 455


>gi|24987448|pdb|1K7I|A Chain A, Prtc From Erwinia Chrysanthemi: Y228f Mutant Length = 479 Back     alignment and structure
>gi|24987449|pdb|1K7Q|A Chain A, Prtc From Erwinia Chrysanthemi: E189a Mutant Length = 479 Back     alignment and structure
>gi|24987255|pdb|1GO8|P Chain P, The Metzincin's Methionine: Prtc M226l Mutant Length = 462 Back     alignment and structure
>gi|242556628|pdb|3HBV|P Chain P, Prtc Methionine Mutants: M226a In-House Length = 462 Back     alignment and structure
>gi|254574998|pdb|3HBU|P Chain P, Prtc Methionine Mutants: M226h Desy Length = 462 Back     alignment and structure
>gi|24987254|pdb|1GO7|P Chain P, The Metzincin's Methionine: Prtc M226c-E189k Double Mutant Length = 462 Back     alignment and structure
>gi|255311883|pdb|3HB2|P Chain P, Prtc Methionine Mutants: M226i Length = 462 Back     alignment and structure
>gi|157833854|pdb|1SRP|A Chain A, Structural Analysis Of Serratia Protease Length = 471 Back     alignment and structure
>gi|1431808|pdb|1SMP|A Chain A, Crystal Structure Of A Complex Between Serratia Marcescens Metallo-Protease And An Inhibitor From Erwinia Chrysanthemi Length = 471 Back     alignment and structure
>gi|3114529|pdb|1AF0|A Chain A, Serratia Protease In Complex With Inhibitor Length = 471 Back     alignment and structure
>gi|157833779|pdb|1SAT|A Chain A, Crystal Structure Of The 50 Kda Metallo Protease From S. Marcescens Length = 471 Back     alignment and structure
>gi|28948337|pdb|1G9K|A Chain A, Crystal Structure Of A Psychrophilic Alkaline Protease From Pseudomonas Tac Ii 18 Length = 463 Back     alignment and structure
>gi|28948368|pdb|1H71|P Chain P, Psychrophilic Protease From Pseudoalteromonas 'tac Ii 18' Length = 463 Back     alignment and structure
gi|1311334|pdb|1KAP|P Chain P, Three-Dimensional Structure Of The Alkaline Protease Of Pseudomonas Aeruginosa: A Two-Domain Protein With A Calcium Binding Parallel Beta Roll Motif Length = 479 Back     alignment and structure
>gi|15825671|pdb|1JIW|P Chain P, Crystal Structure Of The Apr-Aprin Complex Length = 470 Back     alignment and structure
>gi|13786841|pdb|1HV5|A Chain A, Crystal Structure Of The Stromelysin-3 (Mmp-11) Catalytic Domain Complexed With A Phosphinic Inhibitor Length = 165 Back     alignment and structure
>gi|58176727|pdb|1SU3|A Chain A, X-Ray Structure Of Human Prommp-1: New Insights Into Collagenase Action Length = 450 Back     alignment and structure
>gi|157831037|pdb|1FBL|A Chain A, Structure Of Full-Length Porcine Synovial Collagenase (Mmp1) Reveals A C-Terminal Domain Containing A Calcium- Linked, Four-Bladed Beta-Propeller Length = 370 Back     alignment and structure
>gi|194709131|pdb|3BA0|A Chain A, Crystal Structure Of Full-Length Human Mmp-12 Length = 365 Back     alignment and structure
>gi|114793614|pdb|2CLT|A Chain A, Crystal Structure Of The Active Form (Full-Length) Of Human Fibroblast Collagenase. Length = 367 Back     alignment and structure
>gi|157833825|pdb|1SLM|A Chain A, Crystal Structure Of Fibroblast Stromelysin-1: The C- Truncated Human Proenzyme Length = 255 Back     alignment and structure
>gi|6573493|pdb|1QIB|A Chain A, Crystal Structure Of Gelatinase A Catalytic Domain Length = 161 Back     alignment and structure
>gi|118138582|pdb|2J0T|A Chain A, Crystal Structure Of The Catalytic Domain Of Mmp-1 In Complex With The Inhibitory Domain Of Timp-1 Length = 170 Back     alignment and structure
>gi|5542534|pdb|3AYK|A Chain A, Catalytic Fragment Of Human Fibroblast Collagenase Complexed With Cgs-27023a, Nmr, Minimized Average Structure Length = 169 Back     alignment and structure
>gi|157830597|pdb|1CGE|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 168 Back     alignment and structure
>gi|1000037|pdb|1CGL|A Chain A, Structure Of The Catalytic Domain Of Fibroblast Collagenase Complexed With An Inhibitor Length = 169 Back     alignment and structure
>gi|1000001|pdb|1CGF|A Chain A, Crystal Structures Of Recombinant 19-Kda Human Fibroblast Collagenase Complexed To Itself Length = 162 Back     alignment and structure
>gi|159163166|pdb|1UMS|A Chain A, Stromelysin-1 Catalytic Domain With Hydrophobic Inhibitor Bound, Ph 7.0, 32oc, 20 Mm Cacl2, 15% Acetonitrile; Nmr Ensemble Of 20 Structures Length = 174 Back     alignment and structure
>gi|157837185|pdb|966C|A Chain A, Crystal Structure Of Fibroblast Collagenase-1 Complexed To A Diphenyl-Ether Sulphone Based Hydroxamic Acid Length = 157 Back     alignment and structure
>gi|5821975|pdb|1CAQ|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexes With Non-Peptide Inhibitors: Implication For Inhibitor Selectivity Length = 168 Back     alignment and structure
>gi|28949129|pdb|1QIA|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 162 Back     alignment and structure
>gi|157833826|pdb|1SLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With The N-Carboxy- Alkyl Inhibitor L-702,842 Length = 173 Back     alignment and structure
>gi|110591109|pdb|2D1O|A Chain A, Stromelysin-1 (Mmp-3) Complexed To A Hydroxamic Acid Inhibitor Length = 171 Back     alignment and structure
>gi|5821823|pdb|1BIW|A Chain A, Design And Synthesis Of Conformationally-Constrained Mmp Inhibitors Length = 173 Back     alignment and structure
>gi|28949133|pdb|1QIC|A Chain A, Crystal Structure Of Stromelysin Catalytic Domain Length = 161 Back     alignment and structure
>gi|6137649|pdb|1B8Y|A Chain A, X-Ray Structure Of Human Stromelysin Catalytic Domain Complexed With Non-Peptide Inhibitors: Implications For Inhibitor Selectivity Length = 167 Back     alignment and structure
>gi|4140010|pdb|1UEA|A Chain A, Mmp-3TIMP-1 Complex Length = 173 Back     alignment and structure
>gi|9955201|pdb|1C8T|A Chain A, Human Stromelysin-1 (E202q) Catalytic Domain Complexed With Ro-26-2812 Length = 167 Back     alignment and structure
>gi|47168806|pdb|1RM8|A Chain A, Crystal Structure Of The Catalytic Domain Of Mmp-16MT3- Mmp: Characterization Of Mt-Mmp Specific Features Length = 169 Back     alignment and structure
>gi|21465442|pdb|1GKC|A Chain A, Mmp9-Inhibitor Complex Length = 163 Back     alignment and structure
>gi|188595815|pdb|2K2G|A Chain A, Solution Structure Of The Wild-Type Catalytic Domain Of Human Matrix Metalloproteinase 12 (Mmp-12) In Complex With A Tight-Binding Inhibitor Length = 165 Back     alignment and structure
>gi|5821877|pdb|1BQQ|M Chain M, Crystal Structure Of The Mt1-Mmp--Timp-2 Complex Length = 174 Back     alignment and structure
>gi|299856788|pdb|3MA2|D Chain D, Complex Membrane Type-1 Matrix Metalloproteinase (Mt1-Mmp) With Tissue Inhibitor Of Metalloproteinase-1 (Timp-1) Length = 181 Back     alignment and structure
>gi|160877869|pdb|2Z2D|A Chain A, Solution Structure Of Human Macrophage Elastase (Mmp-12) Catalytic Domain Complexed With A Gamma-Keto Butanoic Acid Inhibitor Length = 164 Back     alignment and structure
>gi|34810827|pdb|1OS2|A Chain A, Ternary Enzyme-Product-Inhibitor Complexes Of Human Mmp12 Length = 165 Back     alignment and structure
>gi|257471715|pdb|2WO8|A Chain A, Mmp12 Complex With A Beta Hydroxy Carboxylic Acid Length = 164 Back     alignment and structure
>gi|160877666|pdb|2JSD|A Chain A, Solution Structure Of Mmp20 Complexed With Nngh Length = 160 Back     alignment and structure
>gi|58176632|pdb|1RMZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor Nngh At 1.3 A Resolution Length = 159 Back     alignment and structure
>gi|58176639|pdb|1ROS|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dioxo-1,3- Dihydro-2h-Isoindol-2-Yl)ethyl-4-(4-Ethoxy[1, 1-Biphenyl]-4- Yl)-4-Oxobutanoic Acid Length = 163 Back     alignment and structure
>gi|21730383|pdb|1JIZ|A Chain A, Crystal Structure Analysis Of Human Macrophage Elastase Mmp- 12 Length = 166 Back     alignment and structure
>gi|21465444|pdb|1GKD|A Chain A, Mmp9 Active Site Mutant-Inhibitor Complex Length = 163 Back     alignment and structure
>gi|213424472|pdb|3F15|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mmp12 Complexed With The Inhibitor (S)-N-(2,3-Dihydroxypropyl)-4- Methoxy-N-(2-Nitroso-2-Oxoethyl)benzenesulfonamide Length = 158 Back     alignment and structure
>gi|58176944|pdb|1UTT|A Chain A, Crystal Structure Of Mmp-12 Complexed To 2-(1,3-Dioxo-1,3- Dihydro-2h-Isoindol-2-Yl)ethyl-4-(4-Ethoxy[1, 1-Biphenyl]-4- Yl)-4-Oxobutanoic Acid Length = 159 Back     alignment and structure
>gi|224510512|pdb|2W0D|A Chain A, Does A Fast Nuclear Magnetic Resonance Spectroscopy- And X-Ray Crystallography Hybrid Approach Provide Reliable Structural Information Of Ligand-Protein Complexes? A Case Study Of Metalloproteinases. Length = 164 Back     alignment and structure
>gi|150261347|pdb|2OVX|A Chain A, Mmp-9 Active Site Mutant With Barbiturate Inhibitor Length = 159 Back     alignment and structure
>gi|161761033|pdb|2POJ|A Chain A, Nmr Solution Structure Of The Inhibitor-Free State Of Macrophage Metalloelastase (Mmp-12) Length = 164 Back     alignment and structure
>gi|10120630|pdb|1CXV|A Chain A, Structure Of Recombinant Mouse Collagenase-3 (Mmp-13) Length = 164 Back     alignment and structure
>gi|15988148|pdb|1JK3|A Chain A, Crystal Structure Of Human Mmp-12 (Macrophage Elastase) At True Atomic Resolution Length = 158 Back     alignment and structure
>gi|47168608|pdb|1Q3A|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Matrix Metalloproteinase 10 Length = 165 Back     alignment and structure
>gi|157834101|pdb|1USN|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With Thiadiazole Inhibitor Pnu-142372 Length = 165 Back     alignment and structure
>gi|162329902|pdb|2JNP|A Chain A, Solution Structure Of Matrix Metalloproteinase 3 (Mmp-3) In The Presence Of N-Isobutyl-N-[4- Methoxyphenylsulfonyl]glycyl Hydroxamic Acid (Nngh) Length = 161 Back     alignment and structure
>gi|157831330|pdb|1HFS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Fibroblast Stromelysin-1 Inhibited With The N-Carboxy- Alkyl Inhibitor L-764,004 Length = 160 Back     alignment and structure
>gi|15825642|pdb|1FLS|A Chain A, Solution Structure Of The Catalytic Fragment Of Human Collagenase-3 (Mmp-13) Complexed With A Hydroxamic Acid Inhibitor Length = 165 Back     alignment and structure
>gi|321159779|pdb|3LJZ|A Chain A, Crystal Structure Of Human Mmp-13 Complexed With An Amino-2-Indanol Compound Length = 164 Back     alignment and structure
>gi|110591107|pdb|2D1N|A Chain A, Collagenase-3 (Mmp-13) Complexed To A Hydroxamic Acid Inhibitor Length = 166 Back     alignment and structure
>gi|308198518|pdb|3KRY|A Chain A, Crystal Structure Of Mmp-13 In Complex With Sc-78080 Length = 164 Back     alignment and structure
>gi|159795741|pdb|2Z8Z|A Chain A, Crystal Structure Of A Platinum-Bound S445c Mutant Of Pseudomonas Sp. Mis38 Lipase Length = 617 Back     alignment and structure
>gi|215794564|pdb|2ZJ7|A Chain A, Crystal Structure Of D157a Mutant Of Pseudomonas Sp. Mis38 Lipase Length = 617 Back     alignment and structure
>gi|215794563|pdb|2ZJ6|A Chain A, Crystal Structure Of D337a Mutant Of Pseudomonas Sp. Mis38 Lipase Length = 617 Back     alignment and structure
>gi|159795740|pdb|2Z8X|A Chain A, Crystal Structure Of Extracellular Lipase From Pseudomonas Sp. Mis38 Length = 617 Back     alignment and structure
>gi|159795741|pdb|2Z8Z|A Chain A, Crystal Structure Of A Platinum-Bound S445c Mutant Of Pseudomonas Sp. Mis38 Lipase Length = 617 Back     alignment and structure
>gi|215794564|pdb|2ZJ7|A Chain A, Crystal Structure Of D157a Mutant Of Pseudomonas Sp. Mis38 Lipase Length = 617 Back     alignment and structure
>gi|215794563|pdb|2ZJ6|A Chain A, Crystal Structure Of D337a Mutant Of Pseudomonas Sp. Mis38 Lipase Length = 617 Back     alignment and structure
>gi|159795740|pdb|2Z8X|A Chain A, Crystal Structure Of Extracellular Lipase From Pseudomonas Sp. Mis38 Length = 617 Back     alignment and structure
>gi|213424023|pdb|2K9C|A Chain A, Paramagnetic Shifts In Solid-State Nmr Of Proteins To Elicit Structural Information Length = 152 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target665 serralysin [Candidatus Liberibacter asiaticus str. psy6
1k7i_A479 PROC, secreted protease C; metalloprotease, hydrolase; 3e-31
1kap_P479 Alkaline protease; calcium binding protein, zinc metall 5e-31
1g9k_A463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomo 1e-30
1sat_A471 Serratia protease; parallel beta helix, parallel beta r 2e-20
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, hydrol 2e-14
1mmq_A170 Matrilysin; metalloprotease; HET: RRS; 1.90A {Homo sapi 9e-13
1qib_A161 Protein (gelatinase A); inhibitor, matrixin, matrix met 3e-11
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, virulence 3e-10
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibroblast, 6e-10
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, zinc 8e-10
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex (met 5e-09
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease); 1. 6e-09
1su3_A450 Interstitial collagenase; prodomain, hemopexin domain, 1e-07
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural genom 1e-07
1y93_A159 Macrophage metalloelastase; matrix metalloproteinase, M 2e-07
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP- 9) (92 4e-07
3ma2_D181 Matrix metalloproteinase-14; protein - protein complex, 4e-07
1bqq_M174 CDMT1-MMP, membrane-type matrix metalloproteinase, MMP- 4e-07
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane 2e-06
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A 2e-06
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, hemopex 7e-07
1l6j_A425 Matrix metalloproteinase-9; twisted beta sheet flanked 2e-04
2z8x_A617 Lipase; beta roll, calcium binding protein, RTX protein 2e-05
2qub_A615 Extracellular lipase; beta roll, alpha/beta hydrolase, 0.002
2qub_A615 Extracellular lipase; beta roll, alpha/beta hydrolase, 0.003
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 5e-04
1eak_A421 72 kDa type IV collagenase; hydrolyse, matrix metallopr 8e-04
2qub_A615 Extracellular lipase; beta roll, alpha/beta hydrolase, 0.003
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Length = 479 Back     alignment and structure
 Score =  132 bits (332), Expect = 3e-31
 Identities = 93/339 (27%), Positives = 149/339 (43%), Gaps = 34/339 (10%)

Query: 3   NIKPVYTTERIADHLLRDQY-WSNYFIRYKPDVLTTHRLS---------FDITELNPNAQ 52
           N K  Y+ ++ A  + R+   W+   +  K   LT   L              + N    
Sbjct: 43  NGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQI 102

Query: 53  EVARWALGEWSKVVDLTFEETSIHS--DIKFISSNNGYVCTPRYDSRYFM---------- 100
           E A+ +L  WS V +LTF E + +   +I F +          Y ++ +           
Sbjct: 103 EQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAG 162

Query: 101 EINFDKADVWRYGIGKGTILSHNALHEIGHALGLMHPGSYNGGYPVYGVDN-DYENDSFL 159
              ++         G          HEIGHALGL HPG YN G      ++  Y  DS+ 
Sbjct: 163 SSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQ 222

Query: 160 TSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPK----------GSLGNNIYKI 209
            S+MS++   ++  D +  Y   PM+ DI A+Q++YGA             +   +    
Sbjct: 223 FSIMSFWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFY 282

Query: 210 EVQQKDSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIE 269
                    I +++D+GG D  D +        I+LN  S+S +GG + N++IA    IE
Sbjct: 283 TATDSSKALIFSVWDAGGTDTFDFSGYSN-NQRINLNEGSFSDVGGLKGNVSIAHGVTIE 341

Query: 270 SVVGSSGNDVVIGNSANNVFFESSGNDVFDGSSGLDTFF 308
           + +G SGND+++GNSA+N+    +GNDV  G +G DT +
Sbjct: 342 NAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLY 380


>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa PAO1} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Length = 479 Back     alignment and structure
>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Length = 463 Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A 1smp_A 1srp_A Length = 471 Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Length = 165 Back     alignment and structure
>1mmq_A Matrilysin; metalloprotease; HET: RRS; 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 1mmp_A* 1mmr_A* 2ddy_A* Length = 170 Back     alignment and structure
>1qib_A Protein (gelatinase A); inhibitor, matrixin, matrix metalloproteinase-2 (MMP-2), metzincin, hydrolase; 2.80A {Homo sapiens} SCOP: d.92.1.11 PDB: 1hov_A* Length = 161 Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Length = 167 Back     alignment and structure
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Length = 255 Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrolase; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A* 1d8f_A* 1d8m_A* 1g05_A* 1g49_A* 1c3i_A* 1sln_A* 1uea_A 2srt_A* 1ums_A* 1umt_A* 2d1o_A* 1ciz_A* 1caq_A* ... Length = 173 Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Length = 163 Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* Length = 168 Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Length = 450 Back     alignment and structure
>2jsd_A Matrix metalloproteinase-20; MMP-NNGH, structural genomics, structural proteomics in europe, spine, spine-2, spine2-complexes, hydrolase; HET: NGH; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>1y93_A Macrophage metalloelastase; matrix metalloproteinase, MMP12, complex (elastase/inhibitor), acetohydroxamic acid, hydrolase; 1.03A {Homo sapiens} SCOP: d.92.1.11 PDB: 1rmz_A 1ycm_A* 1z3j_A* 2hu6_A* 2oxu_A 2oxw_A 2oxz_A 1os9_A 1os2_A 3f17_A* 3ehy_A* 3ehx_A* 3f15_A* 3f16_A* 3f18_A* 3f19_A* 3f1a_A* 2wo9_A* 2wo8_A* 2woa_A* ... Length = 159 Back     alignment and structure
>2ovx_A Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP- 9) (92 kDa type IV collagenase) (92...; hydrolase, S1-prime pocket; HET: 4MR; 2.00A {Homo sapiens} SCOP: d.92.1.11 PDB: 2ovz_A* 2ow0_A* 2ow1_A* 2ow2_A* 1gkd_A* 1gkc_A* Length = 159 Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} PDB: 1bqq_M 1buv_M Length = 181 Back     alignment and structure
>1bqq_M CDMT1-MMP, membrane-type matrix metalloproteinase, MMP-14; matrix metalloproteinase, tissue inhibitor of metalloproteinases, proteinase complex; 2.75A {Homo sapiens} SCOP: d.92.1.11 PDB: 1buv_M Length = 174 Back     alignment and structure
>1rm8_A MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane type - matrix metalloproteinase, batimastat, hydroxamate inhibitor, protease, hydrolase; HET: BAT; 1.80A {Homo sapiens} SCOP: d.92.1.11 Length = 169 Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 3elm_A* 2ow9_A* 2ozr_A* 2d1n_A* 1fls_A* 1fm1_A* 1ztq_A* 2e2d_A 2pjt_A* 1cxv_A* Length = 168 Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Length = 365 Back     alignment and structure
>1l6j_A Matrix metalloproteinase-9; twisted beta sheet flanked by helices, hydrolase; 2.50A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 Length = 425 Back     alignment and structure
>2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2z8z_A 2zj6_A 2zj7_A Length = 617 Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin; 1.80A {Serratia marcescens} PDB: 2qua_A Length = 615 Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin; 1.80A {Serratia marcescens} PDB: 2qua_A Length = 615 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>1eak_A 72 kDa type IV collagenase; hydrolyse, matrix metalloproteinase, gelatinase A; 2.66A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 g.14.1.2 g.14.1.2 g.14.1.2 PDB: 1ks0_A 1cxw_A Length = 421 Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin; 1.80A {Serratia marcescens} PDB: 2qua_A Length = 615 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target665 serralysin [Candidatus Liberibacter asiaticus str. psy6
1kap_P479 Alkaline protease; calcium binding protein, zinc metall 100.0
1g9k_A463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomo 100.0
1sat_A471 Serratia protease; parallel beta helix, parallel beta r 100.0
1k7i_A479 PROC, secreted protease C; metalloprotease, hydrolase; 100.0
1slm_A255 Stromelysin-1; hydrolase, metalloprotease, fibroblast, 99.93
1mmq_A170 Matrilysin; metalloprotease; HET: RRS; 1.90A {Homo sapi 99.91
1hv5_A165 Stromelysin 3; inhibition, phosphinic inhibitor, hydrol 99.91
1i76_A163 MMP-8;, neutrophil collagenase; hydrolase, complex (met 99.91
2xs4_A167 Karilysin protease; hydrolase, bacterial MMP, virulence 99.9
1cge_A168 Fibroblast collagenase; hydrolase (metalloprotease); 1. 99.9
830c_A168 MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A 99.9
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, hemopex 99.89
1qib_A161 Protein (gelatinase A); inhibitor, matrixin, matrix met 99.89
3ma2_D181 Matrix metalloproteinase-14; protein - protein complex, 99.89
1hy7_A173 Stromelysin-1, MMP-3; mixed alpha beta structure, zinc 99.89
1rm8_A169 MMP-16, matrix metalloproteinase-16, MT3-MMP; membrane 99.88
2jsd_A160 Matrix metalloproteinase-20; MMP-NNGH, structural genom 99.87
1su3_A450 Interstitial collagenase; prodomain, hemopexin domain, 99.87
1y93_A159 Macrophage metalloelastase; matrix metalloproteinase, M 99.86
2ovx_A159 Matrix metalloproteinase-9 (EC 3.4.24.35) (MMP- 9) (92 99.86
1c7k_A132 NCNP, zinc endoprotease; alpha and beta protein, metall 99.46
1ck7_A631 Protein (gelatinase A); hydrolase (metalloprotease), FU 99.69
1eak_A421 72 kDa type IV collagenase; hydrolyse, matrix metallopr 99.66
1l6j_A425 Matrix metalloproteinase-9; twisted beta sheet flanked 99.33
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, altern 99.16
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, metallop 99.15
3lq0_A235 Proastacin; metallopeptidase, zymogen activation, proen 98.89
2z8x_A617 Lipase; beta roll, calcium binding protein, RTX protein 99.23
2qub_A615 Extracellular lipase; beta roll, alpha/beta hydrolase, 99.15
2z8x_A617 Lipase; beta roll, calcium binding protein, RTX protein 99.05
2agm_A167 Poly(beta-D-mannuronate) C5 epimerase 4; parallel beta- 98.86
1sat_A471 Serratia protease; parallel beta helix, parallel beta r 98.76
2qub_A615 Extracellular lipase; beta roll, alpha/beta hydrolase, 98.76
1g9k_A463 Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomo 98.67
2agm_A167 Poly(beta-D-mannuronate) C5 epimerase 4; parallel beta- 98.58
1kap_P479 Alkaline protease; calcium binding protein, zinc metall 98.55
1k7i_A479 PROC, secreted protease C; metalloprotease, hydrolase; 98.51
1l6j_A425 Matrix metalloproteinase-9; twisted beta sheet flanked 98.35
2cki_A262 Ulilysin; metalloprotease, hypothetical protein, hydrol 97.78
2ddf_A257 ADAM 17; hydrolase; HET: INN CIT; 1.70A {Homo sapiens} 95.73
2x7m_A195 Archaemetzincin; metalloprotease, protease, hydrolase, 95.08
3lmc_A210 Peptidase, zinc-dependent; structural genomics, PSI-2, 94.91
2w15_A202 Zinc metalloproteinase BAP1; hydrolase inhibitor comple 94.88
1bud_A197 Protein (acutolysin A); metalloproteinase, snake venom, 94.78
2ero_A427 VAP-1, vascular apoptosis-inducing protein 1; metallopr 94.71
1qua_A197 Acutolysin-C, hemorrhagin III; metalloprotease, hemorrh 94.68
2i47_A288 ADAM 17; TACE-inhibitor complex, hydrolase; HET: INN KG 94.62
1atl_A202 Atrolysin C; metalloendopeptidase; HET: MTJ; 1.80A {Cro 94.61
1kuf_A203 Atrolysin E, metalloproteinase; alpha/beta protein, hyd 94.45
3k7n_A397 K-like; SVMP, hydrolase; HET: NAG FUC FUL; 2.30A {Naja 94.45
2dw0_A419 Catrocollastatin; apoptotic toxin, SVMP, metalloprotein 94.42
1yp1_A202 FII; FII hydrolase; 1.90A {Deinagkistrodon acutus} 94.37
2rjp_A316 Adamts-4; metalloprotease domain, aggrecanase, cleavage 94.37
3k7l_A422 Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2. 94.23
2v4b_A300 Adamts-1; zinc, zymogen, protease, hydrolase, metallopr 94.06
3b8z_A217 Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40 94.02
1r55_A214 ADAM 33; metalloprotease, inhibitor, asthma, hydrolase; 93.98
2rjq_A378 Adamts-5; metalloprotease domain, aggrecanase, cleavage 93.89
2e3x_A427 Coagulation factor X-activating enzyme heavy chain; dis 93.78
3g5c_A510 ADAM 22; alpha/beta fold, cross-linked domain, alternat 93.41
>1kap_P Alkaline protease; calcium binding protein, zinc metalloprotease; 1.64A {Pseudomonas aeruginosa PAO1} SCOP: b.80.7.1 d.92.1.6 PDB: 1jiw_P 1akl_A Back     alignment and structure
Probab=100.00  E-value=0  Score=507.80  Aligned_cols=316  Identities=28%  Similarity=0.464  Sum_probs=265.0

Q ss_pred             CCCCCCCCHHHHHHHHHC-CEEECCC------EEEEECCCCCC------------CEEEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             488755579999998735-8354043------46750576567------------5026887507999999999999988
Q gi|254780384|r    2 HNIKPVYTTERIADHLLR-DQYWSNY------FIRYKPDVLTT------------HRLSFDITELNPNAQEVARWALGEW   62 (665)
Q Consensus         2 ~n~kp~~t~d~~ad~l~~-~~~~~~~------~~~~~~d~~~~------------~~~t~~it~l~~~~~~~~R~Al~~w   62 (665)
                      -|+||+||+||+|+||+| +..|...      .++++|-....            ......+++|+++||+++|+||++|
T Consensus        33 ~~~~~~~~~~~~~~~l~r~~~~W~~~~~~~~~~lTYsF~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~q~~~~r~Al~~w  112 (479)
T 1kap_P           33 VNGHPSYTVDQAAEQILREQASWQKAPGDSVLTLSYSFLTKPNDFFNTPWKYVSDIYSLGKFSAFSAQQQAQAKLSLQSW  112 (479)
T ss_dssp             ETTEECCCHHHHHHHHTTTCCCCCCCTTCSSEEEEEEECSSCCHHHHCGGGTCSSCSCCCCCBCCCHHHHHHHHHHHHHH
T ss_pred             ECCCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             57864578899877640088844267999835999998458743346654345676565663269999999999999998


Q ss_pred             HHHHCCEEEEECCC--CCEEEEC-----CCCEEEEECCCCCCCCCCCCCCCCC--CCCCCCCCCCEEEEEHHHHHHHHHC
Q ss_conf             65747568982478--7168961-----5853566314677531224433544--3336666673466300323465518
Q gi|254780384|r   63 SKVVDLTFEETSIH--SDIKFIS-----SNNGYVCTPRYDSRYFMEINFDKAD--VWRYGIGKGTILSHNALHEIGHALG  133 (665)
Q Consensus        63 s~va~ItF~Ev~~~--~d~~f~~-----~~~g~a~~p~~~~~~~~~~~~~~~~--~~~~~~~~g~y~~~t~iHEIGHALG  133 (665)
                      ++|++|+|+||++.  ++++|..     ...++++.|........++|++...  ..+..+.+|+|+++|+|||||||||
T Consensus       113 s~VanI~F~Ev~~~~~adi~f~~~~~~~g~~a~a~~p~~~~~~~gd~~~~~~~~~~~~~~~~~G~y~~~tllHEIGHALG  192 (479)
T 1kap_P          113 SDVTNIHFVDAGQGDQGDLTFGNFSSSVGGAAFAFLPDVPDALKGQSWYLINSSYSANVNPANGNYGRQTLTHEIGHTLG  192 (479)
T ss_dssp             HTTBSEEEEEEEESSCSSEEEEEECSCCSSSEEECCTTSCTTTTTEEEEECSSSCCTTTSCCTTSHHHHHHHHHHHHHHT
T ss_pred             HHHHCCEEEECCCCCCCEEEEEECCCCCCCCEEEECCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCHHEEHHHHHHHHC
T ss_conf             87629789986788753499995258887745996689987734416897467655666767786421000101324405


Q ss_pred             CCCCCCCCCCC-CCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCEECCHHHHHHHHHHHHCCCCC-CCCCCCEEECCC
Q ss_conf             78888766676-6667775410142024467523567766665520002112214899998608766-666773463257
Q gi|254780384|r  134 LMHPGSYNGGY-PVYGVDNDYENDSFLTSVMSYFMPQDSMMDASFGYCATPMVSDIVAVQKIYGAPK-GSLGNNIYKIEV  211 (665)
Q Consensus       134 L~Hp~~~~~g~-~~~~~~~~~~~d~~~~TvMSY~~~~~~~~~~~~~~~~tpm~~DI~Alq~lYGan~-~~~gdt~y~~~~  211 (665)
                      |+|||+++++. .+.....++.+|++++|||||+.+.++..+.+..+|.+||++||+|||+|||++. +++|+++|+|++
T Consensus       193 L~HP~d~~~~~~~~~~~~~~~~~D~~~~tvMSY~~~~~~~~~~~~~~~~tpm~~DIaAlQ~LYG~n~~t~tGdt~Y~~~~  272 (479)
T 1kap_P          193 LSHPGDYNAGEGDPTYADATYAEDTRAYSVMSYWEEQNTGQDFKGAYSSAPLLDDIAAIQKLYGANLTTRTGDTVYGFNS  272 (479)
T ss_dssp             CCCSSSCCTTSSCCCGGGCSSTTCSTTTCTTCCSCGGGGTCBCTTCCCSSCCHHHHHHHHHHHCBCTTTTCSCCEEETTC
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHEEECCCCCCCCCCCCEECCC
T ss_conf             86754345666786667754466285641775415677775555433467634344343223034332236873000144


Q ss_pred             CC---------CCCCEEEEEECCCCCEEEEEEECCCCCCEEECCCCCCCEECCCCCCEEEECCCEEEEEECCCCCCEEEE
Q ss_conf             67---------876358987228973259985047874247445873101035557547734825744661776516882
Q gi|254780384|r  212 QQ---------KDSPFIQTIYDSGGDDLLDLTLIGGVKNYIDLNTESWSSIGGYEKNMTIAQHTVIESVVGSSGNDVVIG  282 (665)
Q Consensus       212 ~~---------~~~~~~~tI~D~gG~DTid~s~~~~~~~~IdL~~g~~S~~~g~~~n~~Ia~gt~IEna~g~~g~D~i~g  282 (665)
                      +.         .......+|||.+|.||++++.....+ +|+|+++.++.+.+..+|+.|+.+++|||++|++|+|+|+|
T Consensus       273 ~~~~~~~~~~~~~~~~~~tI~d~gG~Dtid~s~~~~~~-~i~l~~g~~s~~~g~~gn~~i~~g~~~e~~~gg~g~D~l~G  351 (479)
T 1kap_P          273 NTERDFYSATSSSSKLVFSVWDAGGNDTLDFSGFSQNQ-KINLNEKALSDVGGLKGNVSIAAGVTVENAIGGSGSDLLIG  351 (479)
T ss_dssp             CSCCGGGBCCSTTCCCCEEECCCSSCCEEECTTCCSCC-EEECSTTCEEBCTTCBSCEEECTTCCCCEEECCSSCCEEEC
T ss_pred             CCCCCCCCCCCCCCCCCEEEEECCCCEEEEECCCCCCC-CCCCCCCCEEEECCCCCCEEECCCCCCEEEEECCCCCEEEC
T ss_conf             34531002345678641256606860465301211111-00356663256216888604506654206995389874763


Q ss_pred             CCCCCEEECCCCCCEEECCCCCEEEEEECCCCCEEEEE
Q ss_conf             66674686678634588888733899823665137872
Q gi|254780384|r  283 NSANNVFFESSGNDVFDGSSGLDTFFYYAPSYLYKIYR  320 (665)
Q Consensus       283 n~~~n~l~gg~g~d~~~g~~g~Dt~~~~~~~~~~~~~~  320 (665)
                      |.++|+|.|+.|+|+|.|+.|.|++.  +..+.+++..
T Consensus       352 n~~~d~l~Gg~GnD~l~Gg~G~D~l~--GG~G~Dt~~~  387 (479)
T 1kap_P          352 NDVANVLKGGAGNDILYGGLGADQLW--GGAGADTFVY  387 (479)
T ss_dssp             CSSCCEEECCSSCCEEECCSSCCEEE--CCSSCCEEEC
T ss_pred             CCCCCCCCCCCCCCEECCCCCCEEEE--CCCCCEEEEE
T ss_conf             32775334777873552788860797--8987528983



>1g9k_A Serralysin; beta jelly roll, hydrolase; 1.96A {Pseudomonas} SCOP: b.80.7.1 d.92.1.6 PDB: 1o0q_A 1o0t_A 1om6_A 1om7_A 1om8_A 1omj_A 1h71_P Back     alignment and structure
>1sat_A Serratia protease; parallel beta helix, parallel beta roll, hydrolase (serine protease); 1.75A {Serratia marcescens} SCOP: b.80.7.1 d.92.1.6 PDB: 1af0_A 1smp_A 1srp_A Back     alignment and structure
>1k7i_A PROC, secreted protease C; metalloprotease, hydrolase; 1.59A {Erwinia chrysanthemi} SCOP: b.80.7.1 d.92.1.6 PDB: 1k7g_A 1k7q_A 1go8_P 3hbv_P 3hda_P 3hbu_P 1go7_P 3hb2_P Back     alignment and structure
>1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} SCOP: a.20.1.2 d.92.1.11 Back     alignment and structure
>1mmq_A Matrilysin; metalloprotease; HET: RRS; 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 1mmp_A* 1mmr_A* 2ddy_A* Back     alignment and structure
>1hv5_A Stromelysin 3; inhibition, phosphinic inhibitor, hydrolase; HET: CPS RXP; 2.60A {Mus musculus} SCOP: d.92.1.11 Back     alignment and structure
>1i76_A MMP-8;, neutrophil collagenase; hydrolase, complex (metalloprotease/inhibitor); HET: BSI; 1.20A {Homo sapiens} SCOP: d.92.1.11 PDB: 1i73_A* 1jao_A* 1jap_A 1jaq_A* 1jj9_A* 1mmb_A* 1zp5_A* 1zs0_A* 1zvx_A* 3dng_A* 3dpe_A* 3dpf_A* 1kbc_A* 1jan_A* 1bzs_A* 1mnc_A* 2oy2_A 1a86_A* 1jh1_A* 1a85_A ... Back     alignment and structure
>2xs4_A Karilysin protease; hydrolase, bacterial MMP, virulence factor, metalloprotease, dependent, peptidase; 1.70A {Tannerella forsythia} PDB: 2xs3_A Back     alignment and structure
>1cge_A Fibroblast collagenase; hydrolase (metalloprotease); 1.90A {Homo sapiens} SCOP: d.92.1.11 PDB: 2j0t_A 1ayk_A 1hfc_A* 2ayk_A 2tcl_A* 3ayk_A* 4ayk_A* 1cgl_A* 1cgf_A 966c_A* Back     alignment and structure
>830c_A MMP-13, MMP-13; matrix metalloprotease; HET: RS1; 1.60A {Homo sapiens} SCOP: d.92.1.11 PDB: 456c_A* 1you_A* 1eub_A* 1xuc_A* 1xud_A* 1xur_A* 3elm_A* 3i7g_A* 3i7i_A* 2ow9_A* 2ozr_A* 2d1n_A* 1fls_A* 1fm1_A* 1ztq_A* 2e2d_A 2pjt_A* 1cxv_A* Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>1qib_A Protein (gelatinase A); inhibitor, matrixin, matrix metalloproteinase-2 (MMP-2), metzincin, hydrolase; 2.80A {Homo sapiens} SCOP: d.92.1.11 PDB: 1hov_A* Back     alignment and structure
>3ma2_D Matrix metalloproteinase-14; protein - protein complex, cleavage on PAIR of basic residue disulfide bond, membrane, metal-binding; 2.05A {Homo sapiens} PDB: 1bqq_M 1buv_M Back     alignment and structure
>1hy7_A Stromelysin-1, MMP-3; mixed alpha beta structure, zinc protease, inhibited, hydrolase; HET: MBS; 1.50A {Homo sapiens} SCOP: d.92.1.11 PDB: 1biw_A* 1bm6_A* 1bqo_A* 1b3d_A* 1cqr_A 1d5j_A* 1d7x_A*