255764467

255764467

Type I secretion system ATPase, PrtD

GeneID in NCBI database:8209370Locus tag:CLIBASIA_01350
Protein GI in NCBI database:255764467Protein Accession:YP_003064798.2
Gene range:+(282556, 284253)Protein Length:565aa
Gene description:Type I secretion system ATPase, PrtD
COG prediction:[R] ABC-type protease/lipase transport system, ATPase and permease components
KEGG prediction:type I secretion system ATPase, PrtD; K06148 ATP-binding cassette, subfamily C, bacterial
SEED prediction:hypothetical protein
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM4 TM-Helix
TOPPRED8 TM-Helix
HMMTOP7 TM-Helix
MEMSAT4 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-----
MYHLKYSANFMKIYFSFFCITILPSFFINILYLTNPLYMMHIYDSVIGTQSKINLIALSTITLFLYALFFGFDLIRSRLLIESSHLIERFFKPYIITVTKKYEMDGTSLFSIISSLDQLKQFITSPVLPALLDILFTPIFIILSFCIHPILGSWAILSGILLLTITILFQANNERLERRYKKSRQDEINFGKAILHNSEYIYAPSTRDFLLTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKLSAGAIIATSIITARAMAPLEQIINSKKSLNVGLKSLKYLINLNDFTTLLNSSDSKKEPISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTVTHNQIKI
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccccccccccccccccccEEEEEEEEEEcccccEEEEEccccccccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHcccEEcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccEEEEEEccEEEEEccHHHHHHcccHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEEEEEEEEcccccccHccEEEEEccccEEEEEccccccHHHHHHHHHHHccccccEEEEccccHHHccHHHHHHHccEEccccEEccccHHHHHHcccccccHHHHHHHHHHHcHHHHHHHcccccccEEcccccccHHHHHHHHHHHHHccccEEEEccccHHccHHHHHHHHHHHHHHHHcccEEEEEEEEccHHccccEEEEEEccEEEEEccHHHHHHccccEHHHEcc
MYHLKYSANFMKIYFSFFCITILPSFFINILyltnplymMHIYDSVIGTQSKINLIALSTITLFLYALFFGFDLIRSRLLIESSHLIERFFKPYIITVTKKYEMDGTSLFSIISSLDQLkqfitspvlpalldilfTPIFIILSFCIHPILGSWAILSGILLLTITILFQANNERLERRYKKSRQDEINFGkailhnseyiyapstrDFLLTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKLSAGAIIATSIITARAMAPLEQIINSKKSLNVGLKSLKYLINLNDfttllnssdskkepismrlsnntitaknivfrdkKTSRLICQNlsftipegscciiagpsgcgksnFLLCMLGLLtlekgtisfgdrqISRDFIEKFSAQIGYLsqhcslfpisitENIILSHDQNSLHIAQKTAKIVGCHEDILSLkngyqttycsdeipynIVQKIRLSRiiannpaillmdeplyhldneAKNNFYTLLKQFKEnkktiviishdptiismsdfslifhpiqgslfgltqDIFKFNTvthnqiki
MYHLKYSANFMKIYFSFFCITILPSFFINILYLTNPLYMMHIYDSVIGTQSKINLIALSTITLFLYALFFGFDLIRSRLLIESSHLIERFFKPYIITVTKKYEMDGTSLFSIISSLDQLKQFITSPVLPALLDILFTPIFIILSFCIHPILGSWAILSGILLLTITILFQANNERLERRYKKSRQDEINfgkailhnseyiyAPSTRDFLLTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKLSAGAIIATSIITARAMAPLEQIINSKKSLNVGLKSLKYLINLNDFTTllnssdskkepismrlsnntitaknivfrdkkTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTvthnqiki
MYHLKYSANFMKIYFSFFCITILPSFFINILYLTNPLYMMHIYDSVIGTQSKINLIALSTITLFLYALFFGFDLIRSRLLIESSHLIERFFKPYIITVTKKYEMDGTSLFSIISSLDQLKQFITSPVLPALLDILFTPIFIILSFCIHPILGSWAilsgillltitilFQANNERLERRYKKSRQDEINFGKAILHNSEYIYAPSTRDFLLTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKLsagaiiatsiitaramaPLEQIINSKKSLNVGLKSLKYLINLNDFTTLLNSSDSKKEPISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTVTHNQIKI
*YHLKYSANFMKIYFSFFCITILPSFFINILYLTNPLYMMHIYDSVIGTQSKINLIALSTITLFLYALFFGFDLIRSRLLIESSHLIERFFKPYIITV*****************LDQLKQFITSPVLPALLDILFTPIFIILSFCIHPILGSWAILSGILLLTITILFQANN******************KAILHNSEYIYAPSTRDFLLTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKLSAGAIIATSIITARAMAPLEQIINSKKSLNVGLKSLKYLINLN**********************NTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIISMSDFSLIFHPIQGSLFGLTQDIF************
MYHLKYSANFMKIYFSFFCITILPSFFINILYLTNPLYMMHIYDSVIGTQSKINLIALSTITLFLYALFFGFDLIRSRLLIESSHLIERFFKPYIITVTKKYEMDGTSLFSIISSLDQLKQFITSPVLPALLDILFTPIFIILSFCIHPILGSWAILSGILLLTITILFQANNERLERRYKKSRQDEINFGKAILHNSEYIYAPSTRDFLLTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKLSAGAIIATSIITARAMAPLEQIINSKKSLNVGLKSLKYLINLNDFTTLLNSSDSKKEPISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTVTHNQIKI
MYHLKYSANFMKIYFSFFCITILPSFFINILYLTNPLYMMHIYDSVIGTQSKINLIALSTITLFLYALFFGFDLIRSRLLIESSHLIERFFKPYIITVTKKYEMDGTSLFSIISSLDQLKQFITSPVLPALLDILFTPIFIILSFCIHPILGSWAILSGILLLTITILFQANNERLERRYKKSRQDEINFGKAILHNSEYIYAPSTRDFLLTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKLSAGAIIATSIITARAMAPLEQIINSKKSLNVGLKSLKYLINLNDFTTLLNSSDSKKEPISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTVTHNQIKI
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxx
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYHLKYSANFMKIYFSFFCITILPSFFINILYLTNPLYMMHIYDSVIGTQSKINLIALSTITLFLYALFFGFDLIRSRLLIESSHLIERFFKPYIITVTKKYEMDGTSLFSIISSLDQLKQFITSPVLPALLDILFTPIFIILSFCIHPILGSWAILSGILLLTITILFQANNERLERRYKKSRQDEINFGKAILHNSEYIYAPSTRDFLLTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKLSAGAIIATSIITARAMAPLEQIINSKKSLNVGLKSLKYLINLNDFTTLLNSSDSKKEPISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTVTHNQIKI
MYHLKYSANFMKIYFSFFCITILPSFFINILYLTNPLYMMHIYDSVIGTQSKINLIALSTITLFLYALFFGFDLIRSRLLIESSHLIERFFKPYIITVTKKYEMDGTSLFSIISSLDQLKQFITSPVLPALLDILFTPIFIILSFCIHPILGSWAILSGILLLTITILFQANNERLERRYKKSRQDEINFGKAILHNSEYIYAPSTRDFLLTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKLSAGAIIATSIITARAMAPLEQIINSKKSLNVGLKSLKYLINLNDFTTLLNSSDSKKEPISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTVTHNQIKI
MYHLKYSANFMKIYFSFFCITILPSFFINILYLTNPLYMMHIYDSVIGTQSKINLIALSTITLFLYALFFGFDLIRSRLLIESSHLIERFFKPYIITVTKKYEMDGTSLFSIISSLDQLKQFITSPVLPALLDILFTPIFIILSFCIHPILGSWAILSGILLLTITILFQANNERLERRYKKSRQDEINFGKAILHNSEYIYAPSTRDFLLTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKLSAGAIIATSIITARAMAPLEQIINSKKSLNVGLKSLKYLINLNDFTTLLNSSDSKKEPISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTVTHNQIKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target565 Type I secretion system ATPase, PrtD [Candidatus Liberi
254780193528 lipid A ABC exporter family, fused ATPase and inne 3e-15
254780917596 ABC transporter, nucleotide binding/ATPase protein 3e-14
254780576597 ABC transporter related protein [Candidatus Liberi 1e-12
254780704254 ABC transporter, nucleotide binding/ATPase protein 3e-12
254780596 438 ABC transporter nucleotide binding/ATPase protein 8e-11
254780273539 putative ABC transporter ATP-binding protein [Cand 1e-10
254780273 539 putative ABC transporter ATP-binding protein [Cand 0.007
254780744262 ABC transporter nucleotide binding/ATPase protein 2e-10
254780871227 lipoprotein-releasing system ATP-binding protein l 9e-09
254780139257 putative ATP-binding component of ABC transporter 1e-08
254780173257 ABC transporter related protein [Candidatus Liberi 1e-08
254780538280 ABC transporter, nucleotide binding/ATPase protein 1e-08
254780559234 thiamine transporter ATP-binding subunit [Candidat 1e-07
254780340348 proline/glycine betaine ABC transporter, ATP-bindi 2e-06
254781123 610 putative ABC transporter, ATP-binding protein [Can 6e-06
254780718240 putative high-affinity zinc uptake system ATP-bind 1e-05
254780184 959 excinuclease ABC subunit A [Candidatus Liberibacte 0.022
>gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Back     alignment
 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 95/203 (46%), Gaps = 9/203 (4%)

Query: 342 KTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGD---RQISR 398
           K+ R I +N++FT+  G    + G SG GK++    +L       G++       R +S 
Sbjct: 300 KSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSL 359

Query: 399 DFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGY 458
           + I +F   I ++ QH  +   S+ +NI +     +    Q  A +   HE I  L+NGY
Sbjct: 360 EEIRRF---IAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGY 416

Query: 459 QTTYCSDEIPYNI--VQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENK 516
            T      +  +   +Q+I ++R I  +  ILL+DE    LD E +   + +L++ +  +
Sbjct: 417 DTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGR 476

Query: 517 KTIVIISHDPTIISMSDFSLIFH 539
            TI   SH  + I  +D   + H
Sbjct: 477 TTI-FASHRLSAIQDADMVFVLH 498

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score = 71.6 bits (174), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 117/270 (43%), Gaps = 10/270 (3%)

Query: 264 SAGAIIATSIITARAMA--PLEQIINSKKSLNVGLKSLKYLINLNDFTTLLNSSDSKKEP 321
           +AG I+  S ITA  MA  P ++I  ++  L  G+  ++ + +L D   ++  S      
Sbjct: 289 NAGEIM--SFITALLMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIMIEES---PHA 343

Query: 322 ISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGL 381
           +++ +   T   +++ F  K+    +   ++     G    + GPSG GKS  +  ++ +
Sbjct: 344 VNLPVGKGTTVFRDVFFSYKQ-GHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRM 402

Query: 382 LTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKT 441
                G+I      I          +I Y+ Q   LF  ++  NI++     +     + 
Sbjct: 403 YDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEI 462

Query: 442 AKIVGCHEDILSLKNGYQTTYCSD--EIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDN 499
           AK    H+ I+SL  GY T    +   +     Q+I ++R +  +  IL++DE    LD 
Sbjct: 463 AKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDT 522

Query: 500 EAKNNFYTLLKQFKENKKTIVIISHDPTII 529
             +N     L +  + + TIVI     TII
Sbjct: 523 HTENLVRQALSRLMQGRTTIVIAHRISTII 552

>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Back     alignment
 Score = 66.2 bits (160), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 87/361 (24%), Positives = 145/361 (40%), Gaps = 47/361 (13%)

Query: 211 LTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLVIHQKL--SAGAI 268
           + Y+N ++      +  I+K     ISV  +L             WL   Q L  S G +
Sbjct: 230 IQYFNSEKFEINRLEKYISKYKESAISVATSL------------GWLNFGQGLIFSIGMV 277

Query: 269 IATSIITARAMAPLEQIINSKKSLNVGLKSLKYLIN----------------------LN 306
           I T II++ A+   EQ +     +N  L  L   +N                      LN
Sbjct: 278 I-TMIISSHAVYIGEQTVGDFVFINTLLTQLAIPLNILGTIYRDSRQSFIEIEELLNILN 336

Query: 307 DFTTLLNSSDSKKEPISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGP 366
           +   + N+ +SK     +++ N  I   N+ F        I + +SF I       + G 
Sbjct: 337 EKIEIQNAVNSK----DLKIKNGHIVFNNVSF-SYNHHNCIFKGISFEIAPSKKTALIGE 391

Query: 367 SGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENI 426
           SG GKS     +  L  ++ G I+   + I +   E     IG + Q   LF  ++  NI
Sbjct: 392 SGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQTIGIIPQDTILFNDTLRYNI 451

Query: 427 ILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLS--RIIANN 484
           +  +   S        ++      I+ L NGY T      +  +  +K R+S  R I  N
Sbjct: 452 LYGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKN 511

Query: 485 PAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIISMSDFSLIFHPIQGS 544
           P I++ DE    LD   + +  T L    +N+ T+V I+H  + I+ +D  ++F   QG+
Sbjct: 512 PPIIIFDEATSSLDIITERHIQTALATLSKNRTTLV-IAHRLSTITDADNIIVFD--QGT 568

Query: 545 L 545
           +
Sbjct: 569 V 569

>gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 99/205 (48%), Gaps = 20/205 (9%)

Query: 350 NLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGL-LTLEK----GTISFGDRQISRDFIE-- 402
           +++  IP+ S   + GPSGCGKS FL C+  +  T++     G I    + I +  ++  
Sbjct: 24  DINLKIPQNSVTALIGPSGCGKSTFLRCLNRMNETIDNCVFTGEIILDGKNIYQSSVDVV 83

Query: 403 KFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTY 462
           +  A++G + Q  + FP SI +N+      + L      A I    E  +SLK       
Sbjct: 84  RLRARVGMVFQRPNPFPKSIYDNVAYGPRIHGL--GNNKADIDQIVE--MSLKKASLFNE 139

Query: 463 CSDEIPYNIV-------QKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKEN 515
             D + ++         Q++ ++R +A NP ++LMDEP   LD  A  +   L+ + +E+
Sbjct: 140 VKDRLFHDASLLSGGQQQRVCIARALAVNPEVILMDEPCSALDPIATASVEELIHELRES 199

Query: 516 KKTIVIISHD-PTIISMSDFSLIFH 539
             TIVI++H       +S  + +FH
Sbjct: 200 -LTIVIVTHSMQQAARVSQRAAMFH 223

>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score = 60.5 bits (145), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 99/199 (49%), Gaps = 14/199 (7%)

Query: 346 LICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFS 405
           L+   ++F +  G    + G SG GKS  L  + GL++   G + F  ++     I+   
Sbjct: 31  LVLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGLVSPSSGQVLFKGKK-----IKDPP 85

Query: 406 AQIGYLSQHCSLFP-ISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCS 464
             I  + Q  +LFP +++ EN+ L      +   ++  + +    D++ L +G+++ + +
Sbjct: 86  KDISVVFQTFALFPWLTVLENVELGLKAKGIDKEERRKRALSAI-DLIGL-DGFESAHTT 143

Query: 465 DEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYT-LLKQFKENK---KTIV 520
            EI   ++Q++  +R     P++LLMDEP   LD     N  T L+  + E +   ++++
Sbjct: 144 -EISGGMLQRVGFARAFVVFPSLLLMDEPFSALDVLTAENLRTDLIDLWIEGRLPIESML 202

Query: 521 IISHD-PTIISMSDFSLIF 538
           +++H+    + M D  L+F
Sbjct: 203 MVTHNIEEAVLMCDRVLVF 221

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 89/221 (40%), Gaps = 50/221 (22%)

Query: 321 PISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLG 380
           P+  RL +  I AK I        RL+  NLSF +P G    + GP+G GK+     + G
Sbjct: 308 PVGKRLGHVVIEAKGI--SKSYNDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTG 365

Query: 381 LLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQK 440
             + + GTI  G+           +  + Y+ Q                  ++SL   + 
Sbjct: 366 DESPDSGTIHVGE-----------TVCLSYVDQ-----------------SRDSLEAEKT 397

Query: 441 TAKIVGCHEDILSLKNGYQ---TTYCS-------------DEIPYNIVQKIRLSRIIANN 484
             + +   +DI+ L NG++     YCS               +      ++ L++I+ + 
Sbjct: 398 VWEDISGGDDIVKL-NGHEINSRAYCSAFNFKGGDQQQRIGSLSGGQRGRVHLAKILKSG 456

Query: 485 PAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHD 525
             ++L+DEP   LD E  +     L+ F       VIISHD
Sbjct: 457 GNVILLDEPTNDLDTETLSALEDALENF---AGCAVIISHD 494

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 33.9 bits (76), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 93/203 (45%), Gaps = 43/203 (21%)

Query: 350 NLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIG 409
           NLSF  P+    I+ GP+G GKS  L  M G+           D++ + +        +G
Sbjct: 26  NLSF-YPDAKIGIL-GPNGAGKSTILRIMAGI-----------DKEYNGEAWLATGFTVG 72

Query: 410 YLSQHCSL-FPISITENII--LSHDQ------NSLHI--AQKTAKIVGCHEDILSLKNGY 458
           YL Q   L    ++ ENII  ++H Q      N L +  ++KT + +   +DI+  K  +
Sbjct: 73  YLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEIAKLQDIIDSKGLW 132

Query: 459 ----------QTTYCSDE------IPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAK 502
                     ++ +C  +      +     +++ L +++ ++P +LL+DEP  HLD E  
Sbjct: 133 DLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLLLLDEPTNHLDAET- 191

Query: 503 NNFYTLLKQFKENKKTIVIISHD 525
                + K  +E    +++++HD
Sbjct: 192 --IAWMEKYLREYSGAVLMVTHD 212

>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 99/225 (44%), Gaps = 14/225 (6%)

Query: 341 KKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISR-D 399
           K  S  + + +   +  G    + GP+G GK+ F   M GL+  + G+I      I++  
Sbjct: 34  KYNSVYVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMP 93

Query: 400 FIEKFSAQIGYLSQHCSLF-PISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGY 458
              +    I YL Q  S+F  +++ ENI+       L + +K  K    HE + SL   +
Sbjct: 94  MYRRARLGISYLPQEASIFRGLTVEENILA-----VLEVYEKDKK--KRHEKLDSLLKEF 146

Query: 459 QTT----YCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKE 514
             T      +  +     +++ ++R + + P+ +L+DEP   +D  A ++ + L++    
Sbjct: 147 NITKWRHVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLAS 206

Query: 515 NKKTIVIISHD-PTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTV 558
               I+I  H+   I+++ D + I H       G  Q+I     V
Sbjct: 207 RGIGILITDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQDV 251

>gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Back     alignment
 Score = 53.5 bits (127), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 86/171 (50%), Gaps = 12/171 (7%)

Query: 347 ICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTL-EKGTISFGDRQISRDFIEKFS 405
           + +N+  ++ +G    +  PSG GKS  +L + GLL + ++G +   ++  ++   +K S
Sbjct: 25  VLENVHLSLKKGEIVALVSPSGTGKST-ILHIAGLLEVPDQGNVIIANQLCNKLSDDKKS 83

Query: 406 ----AQIGYLSQ-HCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQ- 459
               ++IG++ Q H  L   S+ ENII    Q    I  KTA       D+LS  +  Q 
Sbjct: 84  FLRCSKIGFVYQEHRLLMDFSVIENIIFP--QIIAGINHKTAYQRAM--DLLSYMDMSQY 139

Query: 460 TTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLK 510
               S +I     Q++ + R IAN P I+L DEP  +LD +     +++LK
Sbjct: 140 ANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILK 190

>gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 86/182 (47%), Gaps = 24/182 (13%)

Query: 358 GSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQIS-----RDFIEKFSAQIGYLS 412
           G    + G SG GKS  +  +LGL+    G +      ++     ++F   FSA++G L 
Sbjct: 39  GEILGVIGSSGTGKSILMRGILGLIPRVSGEVKVLGEHLNLAKGKQNF--AFSAKLGVLF 96

Query: 413 QHCSLF-PISITENIILSHDQN-------SLHIAQKTAKIVGCHEDILSLKNGYQTTYCS 464
           QH +LF  +++ ENI +   ++         HI      IVG   +  +L          
Sbjct: 97  QHGALFSSMTVQENISMPIKEHLNLPADLIEHIVHTKIAIVGLPPETANL--------MP 148

Query: 465 DEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKEN-KKTIVIIS 523
            ++   +++++ L+R +A +P +L +DEP   LD  A   F  LL + + +   ++ +I+
Sbjct: 149 FQLSGGMIKRVSLARALAIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSLGLSVYMIT 208

Query: 524 HD 525
           HD
Sbjct: 209 HD 210

>gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 83/180 (46%), Gaps = 5/180 (2%)

Query: 349 QNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDF--IEKFSA 406
           ++++  +  G   IIAGPSG GKS  + C+  +   + G I      ++ D   I +   
Sbjct: 34  RDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRR 93

Query: 407 QIGYLSQHCSLFP-ISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTYCSD 465
            +G + QH +LF  +S+ EN  L        + +K A+ +  H  +  +K   ++   S 
Sbjct: 94  DVGMVFQHFNLFSNLSVLENCTLGPIW-VRKMPKKDAEELAMHY-LNKVKIADKSHRSSS 151

Query: 466 EIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHD 525
            +     Q+  ++R +   P I+L DEP   LD E       ++ +  E   T+V ++H+
Sbjct: 152 LLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHE 211

>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Back     alignment
 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 97/228 (42%), Gaps = 35/228 (15%)

Query: 349 QNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQI 408
           ++++  IPE +   + G +G GKS     ++GL+ L+KG+IS  ++ +           I
Sbjct: 29  EDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGSISIFNQTVENALKADL---I 85

Query: 409 GYLSQHCSL---FPISITENIILSH----------DQNSLHIAQKTAKIVGC----HEDI 451
            Y+ Q  S+   FPI + + +++              N   I  +  + VG        I
Sbjct: 86  AYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVGMSSMRQRQI 145

Query: 452 LSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQ 511
             L  G Q             +++ L+R +A    +++MDEP   +D + +     LLK 
Sbjct: 146 GELSIGQQ-------------KRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKS 192

Query: 512 FKENKKTIVIISHD-PTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTV 558
                  I++ +H+  +I S  D + IF        GLT DIF  + +
Sbjct: 193 LLNEDIMILVSTHNINSIPSFCDRT-IFLKKTVLASGLTSDIFNEDNI 239

>gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Back     alignment
 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 79/184 (42%), Gaps = 23/184 (12%)

Query: 352 SFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYL 411
            F + +    +I GPSG GKS  L  M G     +G+I    +  +R    K    I  L
Sbjct: 19  DFQVNKAERIVILGPSGAGKSTLLSLMAGFKYPTRGSIFLNGQNHTRSSPSKRPLSI--L 76

Query: 412 SQHCSLF---------PISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQTTY 462
            Q  +LF          + I  N+ L H Q++  + Q   K+    ED     N + +  
Sbjct: 77  FQENNLFSHLTVWQNIALGIAPNLRLDHYQHA-QVKQMLEKVF--LEDFF---NRFPSQM 130

Query: 463 CSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQF-KENKKTIVI 521
              +      Q++ L+R +     ILL+DEP    D   ++    LLKQ   E + T+++
Sbjct: 131 SGGQ-----RQRVALARCLIRQKPILLLDEPFAVFDPALRHEILGLLKQVCDERQLTLLM 185

Query: 522 ISHD 525
           ISH+
Sbjct: 186 ISHN 189

>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score = 45.8 bits (107), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 83/188 (44%), Gaps = 21/188 (11%)

Query: 352 SFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYL 411
           +  + +G   ++ G SG GKS  L  + GL  + +G +        + F+  ++A    L
Sbjct: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLV---DTDKGFVNPYAADANVL 105

Query: 412 S-----------QHCSLFPI-SITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQ 459
                       Q  +L P  ++  N+ L  +   +   ++ ++ V  H +I++L    +
Sbjct: 106 RKLRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSR-VAEHLEIVNL---TK 161

Query: 460 TTYCS-DEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFY-TLLKQFKENKK 517
              C  + +   + Q++  +R  A    ILLMDEP   LD   +      LL   ++ KK
Sbjct: 162 WADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKK 221

Query: 518 TIVIISHD 525
           TIV +SHD
Sbjct: 222 TIVFVSHD 229

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 44.3 bits (103), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 86/209 (41%), Gaps = 21/209 (10%)

Query: 322 ISMRLSNNTITAKNIVFRDKKT----SRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLC 377
           I   L     + K ++  DK T     RL+ ++ S  I  G C  I GP+G GK+  L  
Sbjct: 270 IQTHLQTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKL 329

Query: 378 MLGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQ-HCSLFPISITENIILSHDQNSLH 436
           + G +  + G I+ G            + +I  + Q    + P     + +     +SL 
Sbjct: 330 LTGKIKPDCGFITLG-----------TNLKIATIDQKREDIDPDKSLASYLTGSSGDSLM 378

Query: 437 IAQKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYH 496
           +  ++  + G  +D L   +  Q       +      +  ++R++A     L+MDEP   
Sbjct: 379 VRGESRHVAGYIKDFLFHPD--QAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTND 436

Query: 497 LDNEAKNNFYTLLKQFKENKKTIVIISHD 525
           LD E  +     + Q    + TI+I+SHD
Sbjct: 437 LDFETLDFLERTITQL---QGTILIVSHD 462

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 87/198 (43%), Gaps = 31/198 (15%)

Query: 347 ICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFSA 406
           I Q+++FTI       + GP+G GKS     + G++    G++    + I          
Sbjct: 25  ILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITGIIKPTIGSVKRHPQLI---------- 74

Query: 407 QIGYLSQHCSL---FPISITENIIL---SHDQNSLHIAQKTAKIVGCHEDILSLKNGYQT 460
            +GY+ Q  ++    P+S+   + L   S   + L I  +   I   + +I  L  G   
Sbjct: 75  -VGYVPQKVTIENTLPLSLMRFMTLSMPSSRDDVLQILDRVNLIGKYNRNIKDLSGGE-- 131

Query: 461 TYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKK-TI 519
                       Q+  L++ +   P +L++DEPL  +D   + + Y L+   +++    I
Sbjct: 132 -----------FQRALLAKALLRKPNLLVLDEPLQGIDFPGELSLYELITSVRQSTGCGI 180

Query: 520 VIISHDPTIISMSDFSLI 537
           ++ISH+  ++  S  ++I
Sbjct: 181 LLISHNLHMVMASTDTVI 198

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 32.3 bits (72), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 32/73 (43%), Gaps = 2/73 (2%)

Query: 473 QKIRLSRIIAN--NPAILLMDEPLYHLDNEAKNNFYTLLKQFKENKKTIVIISHDPTIIS 530
           Q+IRL+  I +     + ++DEP   L           LK  ++   T++++ HD   + 
Sbjct: 510 QRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVIVVEHDEETML 569

Query: 531 MSDFSLIFHPIQG 543
            +D  +   P  G
Sbjct: 570 AADHIVDIGPEAG 582

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target565 Type I secretion system ATPase, PrtD [Candidatus Liberi
315122202487 Type I secretion system ATPase, PrtD [Candidatus Liberi 1 0.0
159042695579 type I secretion system ATPase [Dinoroseobacter shibae 1 3e-66
260429157580 lipase B [Citreicella sp. SE45] Length = 580 1 5e-66
99077969570 Type I secretion system ATPase, PrtD [Ruegeria sp. TM10 1 8e-63
56698546577 type I secretion system ATPase [Ruegeria pomeroyi DSS-3 1 9e-63
85705069563 type I secretion system ATPase [Roseovarius sp. 217] Le 1 6e-62
163745369578 type I secretion system ATPase [Oceanibulbus indolifex 1 6e-62
163747674572 Type I secretion system ATPase, PrtD [Oceanibulbus indo 1 1e-61
126726164574 ABC protein toxin exporter, fused ATPase and inner memb 1 2e-61
149200827577 type I secretion system ATPase [Roseovarius sp. TM1035] 1 2e-61
>gi|315122202|ref|YP_004062691.1| Type I secretion system ATPase, PrtD [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 487 Back     alignment and organism information
 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/486 (65%), Positives = 385/486 (79%)

Query: 79  LLIESSHLIERFFKPYIITVTKKYEMDGTSLFSIISSLDQLKQFITSPVLPALLDILFTP 138
           + IESSH IER FK YIIT  KK++ D TSL S +S+LDQLKQFI SPVLPA  D+LFTP
Sbjct: 1   MFIESSHSIERLFKFYIITTIKKHDSDHTSLLSTVSALDQLKQFIRSPVLPAFFDLLFTP 60

Query: 139 IFIILSFCIHPILGSWAILSGILLLTITILFQANNERLERRYKKSRQDEINFGKAILHNS 198
           IFII S CIHP+LGSWAI+S ILLLT + LFQ  NERLE+R   ++Q+EINF KAIL N 
Sbjct: 61  IFIISSLCIHPLLGSWAIVSAILLLTTSYLFQKKNERLEQRNATNKQNEINFSKAILSNP 120

Query: 199 EYIYAPSTRDFLLTYWNKKRATSQEYQSLIAKKYYFGISVTKTLRMTLQSSILGIGAWLV 258
           EY++ P+TRDFLLT+W+++R +SQ  QSLIAKK +FGIS+ KTLRMTLQSSILG GAWLV
Sbjct: 121 EYMHIPTTRDFLLTHWDQRRFSSQASQSLIAKKNFFGISLIKTLRMTLQSSILGTGAWLV 180

Query: 259 IHQKLSAGAIIATSIITARAMAPLEQIINSKKSLNVGLKSLKYLINLNDFTTLLNSSDSK 318
           IHQ LSAG+IIATSIIT RA+APLEQ++N+KK L +G +SLKYLI+L   + LLNSS+  
Sbjct: 181 IHQNLSAGSIIATSIITTRAIAPLEQMMNAKKYLKIGFESLKYLIDLKKNSDLLNSSNQT 240

Query: 319 KEPISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCM 378
             PI+ +L N+TI   NI  R KKTSRLIC+NLSFTIPEG+CC+++GP+ CGK++F LCM
Sbjct: 241 NHPITTQLPNSTIIFNNITLRHKKTSRLICKNLSFTIPEGTCCVVSGPNYCGKTSFFLCM 300

Query: 379 LGLLTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIA 438
           LGL +LE GTIS GDR+ISR+FIE F  QIGYLSQ+C+LFP++I ENI LS+D+NSL IA
Sbjct: 301 LGLHSLENGTISCGDREISRNFIEYFPTQIGYLSQNCTLFPMNIIENITLSNDENSLKIA 360

Query: 439 QKTAKIVGCHEDILSLKNGYQTTYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLD 498
           QK  K +GC +DI SLK+GYQT   S  I  N+ QKI LSRIIA+NP ILL+DE L+ LD
Sbjct: 361 QKATKTIGCDDDISSLKDGYQTICPSQAISDNLAQKICLSRIIAHNPQILLIDESLHQLD 420

Query: 499 NEAKNNFYTLLKQFKENKKTIVIISHDPTIISMSDFSLIFHPIQGSLFGLTQDIFKFNTV 558
           N  KNNFY LLK+FKENKKTI+I SHDP II +SDF+LIF+PI    FG  QDIF     
Sbjct: 421 NVTKNNFYMLLKKFKENKKTIIIASHDPKIIDISDFALIFNPITDPFFGSIQDIFNTKVS 480

Query: 559 THNQIK 564
            + QIK
Sbjct: 481 ANTQIK 486


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|159042695|ref|YP_001531489.1| type I secretion system ATPase [Dinoroseobacter shibae DFL 12] Length = 579 Back     alignment and organism information
>gi|260429157|ref|ZP_05783134.1| lipase B [Citreicella sp. SE45] Length = 580 Back     alignment and organism information
>gi|99077969|ref|YP_611228.1| Type I secretion system ATPase, PrtD [Ruegeria sp. TM1040] Length = 570 Back     alignment and organism information
>gi|56698546|ref|YP_168922.1| type I secretion system ATPase [Ruegeria pomeroyi DSS-3] Length = 577 Back     alignment and organism information
>gi|85705069|ref|ZP_01036169.1| type I secretion system ATPase [Roseovarius sp. 217] Length = 563 Back     alignment and organism information
>gi|163745369|ref|ZP_02152729.1| type I secretion system ATPase [Oceanibulbus indolifex HEL-45] Length = 578 Back     alignment and organism information
>gi|163747674|ref|ZP_02155019.1| Type I secretion system ATPase, PrtD [Oceanibulbus indolifex HEL-45] Length = 572 Back     alignment and organism information
>gi|126726164|ref|ZP_01742006.1| ABC protein toxin exporter, fused ATPase and inner membrane domain [Rhodobacterales bacterium HTCC2150] Length = 574 Back     alignment and organism information
>gi|149200827|ref|ZP_01877802.1| type I secretion system ATPase [Roseovarius sp. TM1035] Length = 577 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target565 Type I secretion system ATPase, PrtD [Candidatus Liberi
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 4e-80
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 5e-53
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 3e-40
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 5e-38
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion system ABC 3e-31
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 4e-23
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 8e-22
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 5e-85
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 4e-27
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 4e-23
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp 1e-17
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding protein 3e-13
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind 2e-11
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil 2e-11
COG4178604 COG4178, COG4178, ABC-type uncharacterized transport sy 4e-11
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin 2e-10
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 9e-08
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 1e-26
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 2e-24
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 3e-24
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 9e-24
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 1e-23
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB 2e-23
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are 3e-23
cd03259213 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So 4e-23
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t 7e-23
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 1e-22
cd03245220 cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc 1e-22
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 2e-22
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 3e-21
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 6e-21
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 6e-21
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 6e-21
cd03260227 cd03260, ABC_PstB_phosphate_transporter, Phosphate upta 3e-20
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 8e-20
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 1e-19
cd03251234 cd03251, ABCC_MsbA, MsbA is an essential ABC transporte 2e-19
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 3e-19
cd03252237 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin 4e-19
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 4e-19
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, ATPase 5e-19
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 7e-19
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 1e-18
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 2e-18
COG4619223 COG4619, COG4619, ABC-type uncharacterized transport sy 2e-18
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 2e-18
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 2e-18
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 3e-18
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine transport 3e-18
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 8e-18
cd03262213 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the 1e-17
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 3e-17
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b 5e-17
cd03294269 cd03294, ABC_Pro_Gly_Bertaine, This family comprises th 5e-17
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine transpo 5e-17
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB 5e-17
COG1117253 COG1117, PstB, ABC-type phosphate transport system, ATP 7e-17
cd03300232 cd03300, ABC_PotA_N, PotA is an ABC-type transporter an 1e-16
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 2e-16
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 3e-16
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 3e-16
cd03296239 cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra 3e-16
cd03250204 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil 4e-16
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 1e-15
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 1e-15
cd03215182 cd03215, ABC_Carb_Monos_II, This family represents doma 1e-15
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 2e-15
TIGR02868529 TIGR02868, CydC, thiol reductant ABC exporter, CydC sub 2e-15
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 2e-15
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 3e-15
COG1123 539 COG1123, COG1123, ATPase components of various ABC-type 3e-15
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP-bindi 4e-15
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind 5e-15
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 7e-15
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain of th 7e-15
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate transp 7e-15
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP-bindi 7e-15
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su 7e-15
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 1e-14
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transport sy 2e-14
COG0488530 COG0488, Uup, ATPase components of ABC transporters wit 2e-14
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport 2e-14
cd03263220 cd03263, ABC_subfamily_A, The ABCA subfamily mediates t 3e-14
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 6e-14
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 6e-14
COG4525259 COG4525, TauB, ABC-type taurine transport system, ATPas 8e-14
COG1135339 COG1135, AbcC, ABC-type metal ion transport system, ATP 9e-14
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 9e-14
PRK10789569 PRK10789, PRK10789, putative multidrug transporter memb 1e-13
TIGR00960216 TIGR00960, 3a0501s02, Type II (General) Secretory Pathw 1e-13
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP-bindi 1e-13
cd03248226 cd03248, ABCC_TAP, TAP, the Transporter Associated with 2e-13
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transport AT 2e-13
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding subunit; 3e-13
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 5e-13
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-binding p 8e-13
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 9e-13
COG0488 530 COG0488, Uup, ATPase components of ABC transporters wit 1e-12
COG4136213 COG4136, COG4136, ABC-type uncharacterized transport sy 1e-12
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 1e-12
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP-bindi 1e-12
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multidrug t 2e-12
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transporter 2e-12
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP-bindi 2e-12
cd03213194 cd03213, ABCG_EPDR, ABCG transporters are involved in e 3e-12
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding subunit 3e-12
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 4e-12
COG4181228 COG4181, COG4181, Predicted ABC-type transport system i 4e-12
COG4148 352 COG4148, ModC, ABC-type molybdate transport system, ATP 5e-12
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 6e-12
cd03247178 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat 6e-12
TIGR03415 382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP 6e-12
COG1129 500 COG1129, MglA, ABC-type sugar transport system, ATPase 7e-12
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi 7e-12
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 7e-12
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP-bindi 9e-12
cd03266218 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c 1e-11
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 1e-11
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC 1e-11
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 1e-11
cd03244221 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil 2e-11
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP-bindi 2e-11
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-binding p 2e-11
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP-bindi 2e-11
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 3e-11
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-binding p 3e-11
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 3e-11
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 3e-11
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-binding p 3e-11
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 4e-11
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 4e-11
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 6e-11
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 6e-11
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding subunit 6e-11
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP-bindi 8e-11
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter NodI; Pr 9e-11
cd03234226 cd03234, ABCG_White, The White subfamily represents ABC 1e-10
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP-bindi 1e-10
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP-bindi 1e-10
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter family nod 1e-10
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP-bindi 1e-10
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 2e-10
cd03290218 cd03290, ABCC_SUR1_N, The SUR domain 1 2e-10
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-binding p 2e-10
COG4133209 COG4133, CcmA, ABC-type transport system involved in cy 3e-10
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP-bindi 3e-10
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p 3e-10
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP-bindi 3e-10
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 4e-10
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protein Ccm 4e-10
PRK13536340 PRK13536, PRK13536, nodulation factor exporter subunit 4e-10
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 6e-10
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP-bindi 7e-10
cd03269210 cd03269, ABC_putative_ATPase, This subfamily is involve 8e-10
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 9e-10
COG4161242 COG4161, ArtP, ABC-type arginine transport system, ATPa 1e-09
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP-bindi 1e-09
KOG0061 613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 2e-09
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, ATPa 2e-09
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily 2e-09
KOG0060659 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transpor 2e-09
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 2e-09
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding subunit; 2e-09
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP-bindi 2e-09
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-binding p 2e-09
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding subu 3e-09
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter ATP-bin 3e-09
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP-bindi 4e-09
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 5e-09
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami 7e-09
COG4152300 COG4152, COG4152, ABC-type uncharacterized transport sy 7e-09
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transporter A 7e-09
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP-bindi 7e-09
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP-bindi 8e-09
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 8e-09
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 8e-09
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding subunit; 1e-08
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 1e-08
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP-bindi 1e-08
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 1e-08
cd03220224 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC tr 2e-08
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein 2e-08
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Provisi 2e-08
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP-bindi 2e-08
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 2e-08
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 2e-08
cd03291282 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 3e-08
cd03267236 cd03267, ABC_NatA_like, Similar in sequence to NatA, th 3e-08
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 3e-08
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 3e-08
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 3e-08
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding prote 3e-08
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 3e-08
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 3e-08
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 4e-08
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 4e-08
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding 4e-08
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP-bindi 4e-08
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP-bindi 5e-08
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP-bindi 5e-08
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 6e-08
KOG0927614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 6e-08
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 6e-08
KOG00541381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 9e-08
KOG0059885 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel 1e-07
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 1e-07
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 1e-07
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 2e-07
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport syste 2e-07
COG4604252 COG4604, CeuD, ABC-type enterochelin transport system, 2e-07
TIGR02314 343 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP- 2e-07
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 2e-07
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 2e-07
cd03265220 cd03265, ABC_DrrA, DrrA is the ATP-binding protein comp 3e-07
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 3e-07
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 3e-07
COG4778235 COG4778, PhnL, ABC-type phosphonate transport system, A 4e-07
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding subunit; 4e-07
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-binding sub 5e-07
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protein Ccm 6e-07
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate ester t 6e-07
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 6e-07
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP-bindi 6e-07
cd03231201 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding 8e-07
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP-bindi 9e-07
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-binding p 9e-07
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transport sy 1e-06
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding subunit; 1e-06
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter 1e-06
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phosphate 2e-06
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 2e-06
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 2e-06
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP-bindi 2e-06
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 2e-06
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding prote 2e-06
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic 2e-06
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 3e-06
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 4e-06
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding prote 4e-06
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATPase; 4e-06
PRK11124242 PRK11124, artP, arginine transporter ATP-binding subuni 4e-06
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 4e-06
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 4e-06
cd03369207 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length M 5e-06
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding subunit; 5e-06
COG4107258 COG4107, PhnK, ABC-type phosphonate transport system, A 6e-06
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP-bindi 6e-06
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p 6e-06
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding protein 8e-06
COG4586325 COG4586, COG4586, ABC-type uncharacterized transport sy 1e-05
KOG0066807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 1e-05
KOG0062582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 1e-05
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predicted 1e-05
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding subuni 1e-05
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra 1e-05
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-binding 1e-05
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-binding p 1e-05
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 1e-05
cd03232192 cd03232, ABC_PDR_domain2, The pleiotropic drug resistan 2e-05
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 2e-05
PRK11153 343 PRK11153, metN, DL-methionine transporter ATP-binding s 2e-05
KOG0062 582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 4e-05
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 5e-05
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding subunit; 7e-05
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 7e-05
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 8e-05
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 8e-05
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP-bindi 8e-05
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisional 1e-04
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 2e-04
cd03233202 cd03233, ABC_PDR_domain1, The pleiotropic drug resistan 2e-04
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding subunit; 2e-04
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 3e-04
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding protein 3e-04
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC transp 4e-04
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 4e-04
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associated AB 4e-04
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 5e-04
KOG0064728 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl- 7e-04
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-binding 7e-04
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protein Ccm 8e-04
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family member; Pr 0.001
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 0.001
PRK10790592 PRK10790, PRK10790, putative multidrug transporter memb 0.001
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Provision 0.002
KOG2355291 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport 0.003
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 0.003
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 6e-22
KOG0056790 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A 7e-21
TIGR03796710 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC 9e-21
TIGR03797686 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC 2e-19
KOG00551228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 1e-18
KOG0054 1381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 5e-14
COG5265497 COG5265, ATM1, ABC-type transport system involved in Fe 3e-12
COG4615546 COG4615, PvdE, ABC-type siderophore export system, fuse 2e-08
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transporter 5e-12
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP-bindi 6e-12
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-binding p 9e-12
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP-bindi 3e-09
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-binding p 5e-08
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 5e-08
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP-bindi 1e-05
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 6e-10
PRK11432 351 PRK11432, fbpC, ferric transporter ATP-binding subunit; 9e-08
PRK11650 356 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-bi 7e-07
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su 5e-06
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transporter AT 5e-06
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b 1e-05
pfam00005119 pfam00005, ABC_tran, ABC transporter 2e-05
cd03289275 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2 7e-05
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protein Ccm 1e-04
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 2e-04
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 2e-09
KOG0927 614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 2e-05
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family member; Pr 8e-05
PLN032321495 PLN03232, PLN03232, ABC transporter C family member; Pr 0.002
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 4e-09
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/perme 5e-08
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 6e-08
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 8e-07
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 0.004
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 8e-06
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-binding pro 2e-04
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase component; R 1e-05
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding subu 4e-05
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-binding / 5e-05
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 2e-04
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide transport 2e-04
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 7e-04
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 0.002
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC transport 0.003
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 0.003
>gnl|CDD|162555 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|163239 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|162558 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|34241 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|162132 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|33918 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|163042 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>gnl|CDD|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters Back     alignment and domain information
>gnl|CDD|73004 cd03245, ABCC_bacteriocin_exporters, ABC-type bacteriocin exporters Back     alignment and domain information
>gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>gnl|CDD|31322 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>gnl|CDD|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73011 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|72989 cd03230, ABC_DR_subfamily_A, This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|34242 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|73054 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>gnl|CDD|73053 cd03294, ABC_Pro_Gly_Bertaine, This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>gnl|CDD|33915 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73056 cd03297, ABC_ModC_molybdenum_transporter, ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>gnl|CDD|31314 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73059 cd03300, ABC_PotA_N, PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>gnl|CDD|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>gnl|CDD|73009 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamily C Back     alignment and domain information
>gnl|CDD|73058 cd03299, ABC_ModC_like, Archeal protein closely related to ModC Back     alignment and domain information
>gnl|CDD|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>gnl|CDD|72974 cd03215, ABC_Carb_Monos_II, This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>gnl|CDD|163051 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|130045 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|73060 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|73051 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|73022 cd03263, ABC_subfamily_A, The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|34177 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163352 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|130034 TIGR00960, 3a0501s02, Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>gnl|CDD|184592 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73007 cd03248, ABCC_TAP, TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|184206 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>gnl|CDD|184581 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|33892 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73023 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|72972 cd03213, ABCG_EPDR, ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|30760 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33919 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31332 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|73006 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>gnl|CDD|132456 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73025 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163196 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|73003 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamily C Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>gnl|CDD|72980 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184124 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|72993 cd03234, ABCG_White, The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>gnl|CDD|184595 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172753 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|34233 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73049 cd03290, ABCC_SUR1_N, The SUR domain 1 Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|33889 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|72983 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>gnl|CDD|184126 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184123 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|72982 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73028 cd03269, ABC_putative_ATPase, This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>gnl|CDD|184192 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|33907 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|73027 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>gnl|CDD|35283 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism, General function prediction only] Back     alignment and domain information
>gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184201 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184591 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73057 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>gnl|CDD|33903 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|181868 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183003 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|184133 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|72979 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>gnl|CDD|162243 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73050 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 Back     alignment and domain information
>gnl|CDD|73026 cd03267, ABC_NatA_like, Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|34291 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|162277 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|183331 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|183014 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|33894 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184589 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|72975 cd03216, ABC_Carb_Monos_I, This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>gnl|CDD|36145 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|179632 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|35282 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism, General function prediction only] Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|31298 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|34235 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73024 cd03265, ABC_DrrA, DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>gnl|CDD|184194 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|173501 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|34390 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information