254780388

254780388

hypothetical protein CLIBASIA_01365

GeneID in NCBI database:8209373Locus tag:CLIBASIA_01365
Protein GI in NCBI database:254780388Protein Accession:YP_003064801.1
Gene range:-(287740, 289116)Protein Length:458aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
MVFDTKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDYQRDSEGQPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRITK
cccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEcccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHEEEEEEccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHcccccccccccccHHHHHHHHccccccEEEEccccccEEEEEcccEEEEEccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHEEEEEEEccccccccccHHHHHHHHHcccEEEEEEEEEccHHHHHHHHHHHHccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHcc
cccccEEEEEEHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccEEEEEEEEEccccccEEEEEcccEEEEEcHHHHHHHHHccccEEEEEEcccccccccccccccEEEEEEEEcccccccccccccccccHccccHHHHHHHcccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHccHHHcccccccEEEccccEEccccccccccccccccccHHHHHHccccccccccccHHHHHHHHHHHHccccccHHccccccccccEEEEEEEccccccccccHHHHHHHHHHcccEEEEEEEEEcccccccHHHHHHHcccccccEccccHHHHHHHHHHHHHHHHHHHHHHHcc
MVFDTKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQSLEEVSSraknsftfpkQKIEEYLIRNFENNlkknftdrevRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMldyqrdsegqplncfgqpadrtvksyssqngkvgirdeklspymvscNKSLyymlypgpldpslseehfvdssslrhviKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFfndrvisdpsfswgVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTdgentqdnEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLsncaspnsffeanSTHELNKIFRDRIGNEIFERVIRITK
MVFDTKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQSLEEVssraknsftfpkqkiEEYLIRNFennlkknftdrevrDIVRDtavemnprksAYQVVLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVsrsyhkehgvsiQWVIDFSRSMLDYQRDSEgqplncfgqpadrtvksyssqngkvgirdeklspYMVSCNKSLYYMLYPGPLDPSLSEEHFVDSSslrhvikkkhlVRDALASVIrsikkidnvndtVRMGATffndrvisdpsfswgvHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTdgentqdnEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNkifrdrigneiferviritk
MVFDTKFIFYSKKLIKSCTGHFFIITAllmpvmlgvggmlvdvvRWSYYEHALKQAAQTAIITASVPLIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDlllnplslflRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDYQRDSEGQPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRITK
*****K**FYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLI***************FPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDYQRDSEGQPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNE*******NNLEAKKYIVLLTDGENTQDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRIT*
MVFDTKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDYQRDSEGQPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRITK
*VFDTKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSR*******D**GQPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVH**KNNLEAKKYIVLLTDGENTQDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRITK
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFDTKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDYQRDSEGQPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRITK
MVFDTKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDYQRDSEGQPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRITK
MVFDTKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDYQRDSEGQPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRITK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target458 hypothetical protein CLIBASIA_01365 [Candidatus Liberib
254780833371 hypothetical protein CLIBASIA_03630 [Candidatus Li 2e-20
254780833371 hypothetical protein CLIBASIA_03630 [Candidatus Li 4e-05
254780934374 hypothetical protein CLIBASIA_04165 [Candidatus Li 3e-17
254780934374 hypothetical protein CLIBASIA_04165 [Candidatus Li 2e-04
254781110420 von Willebrand factor type A [Candidatus Liberibac 1e-13
254781108398 von Willebrand factor type A [Candidatus Liberibac 4e-10
>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Back     alignment
 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 92/178 (51%), Gaps = 16/178 (8%)

Query: 285 IKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAIND-AM 343
           IK I +VN+ VR G   F+ +++     +WGV  +   I +         GST  +   +
Sbjct: 206 IKSIPDVNNVVRSGLVTFSSKIVQTFPLAWGVQHIQEKINRLI------FGSTTKSTPGL 259

Query: 344 QTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQ---DNEEGIAICNKAKSQGIRI 400
           + AY+ I  + E   H  K + + KKYI+ LTDGEN+    DN+E +  CN+AK +G  +
Sbjct: 260 EYAYNKIFDAKEKLEHIAKGHDDYKKYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIV 319

Query: 401 MTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRITK 458
             I       Q E A  FL NCASP+ F+   ++ +L+  F  RIG E+ ++ I   K
Sbjct: 320 YAIG-----VQAEAADQFLKNCASPDRFYSVQNSRKLHDAFL-RIGKEMVKQRILYNK 371

>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Back     alignment
 Score = 40.8 bits (94), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 86/179 (48%), Gaps = 9/179 (5%)

Query: 17  SCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAII-TASVPLIQSLEEV 75
           +C G   I+TA+L+PV+  V G++++     + +  L      +++ TA+  L Q     
Sbjct: 12  NCKGSISILTAILLPVIFIVMGLVIETSHKFFVKAKLHYILDHSLLYTATKILNQENGNN 71

Query: 76  SSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVE--MNPRKSAYQVVL 133
             + KN F++  + I+     +F N L++N   +++ +I R T++   ++ +   Y +  
Sbjct: 72  GKKQKNDFSY--RIIKNIWQTDFRNELRENGFAQDINNIERSTSLSIIIDDQHKDYNLSA 129

Query: 134 SSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDY 192
            SRY++     +    +    + L+ T     +V  S   + G+ +  V+D S SM D+
Sbjct: 130 VSRYEMPFIFCTFPWCANSSHAPLLIT----SSVKISSKSDIGLDMMMVLDVSLSMNDH 184

>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Back     alignment
 Score = 81.3 bits (199), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 100/210 (47%), Gaps = 21/210 (10%)

Query: 249 LDPSLSEEHFVDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVIS 308
           LD S S E F DSS     I K  +   ++ +++  +K I +VN+ V+ G   F++++  
Sbjct: 178 LDVSRSMESFFDSS-----ITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEE 232

Query: 309 DPSFSWGVHKLIRTI--VKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLE 366
                WGV  L R I  +  F +  N          ++ AY+ I        H    +  
Sbjct: 233 FFLLEWGVSHLQRKIKYLSKFGVSTNS------TPGLKYAYNQIFDMQGMRQHCNTEDAN 286

Query: 367 AKKYIVLLTDGEN--TQDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCAS 424
            KK IV +TDGEN  T+++++ +  CN+AK +G  +  I   V ++ +     FL  CAS
Sbjct: 287 YKKIIVFMTDGENLSTKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHE-----FLRACAS 341

Query: 425 PNSFFEANSTHELNKIFRDRIGNEIFERVI 454
           PNSF+   + H +   F   IG +I  + I
Sbjct: 342 PNSFYLVENPHSMYDAF-SHIGKDIVTKRI 370

>gi|254780934|ref|YP_003065347.1| hypothetical protein CLIBASIA_04165 [Candidatus Liberibacter asiaticus str. psy62] Length = 374 Back     alignment
 Score = 38.9 bits (89), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 60/134 (44%), Gaps = 23/134 (17%)

Query: 20  GHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLIQSLE------ 73
           G   I+TA+ +P++  V GM+++V    + +  L      +++ A+  ++          
Sbjct: 17  GGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVHAATQIMNEGNGNNRKK 76

Query: 74  ----EVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEM--NPRKS 127
               ++  R KN++             +F N L+ N    ++ DIVR T++++   P+  
Sbjct: 77  LKGGDILCRIKNTWNM-----------SFRNELRDNGFVNDIDDIVRSTSLDIVVVPQNE 125

Query: 128 AYQVVLSSRYDLLL 141
            Y +   SRY + L
Sbjct: 126 GYSISAISRYKIPL 139

>gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 420 Back     alignment
 Score = 69.3 bits (168), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 101/454 (22%), Positives = 195/454 (42%), Gaps = 69/454 (15%)

Query: 5   TKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITA 64
           ++F FY KK I S   +F II AL +   L + G L+ V+ W Y +++++ A   AI+  
Sbjct: 5   SRFRFYFKKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAG 64

Query: 65  SVPLIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNP 124
           +  ++ +L  +  R ++     K+ + +   R  +N++K++ +      +  +T ++   
Sbjct: 65  ASKMVSNLSRLGDRFESISNHAKRALIDDAKRFIKNHIKESLSGYSA--VFYNTEIQ--- 119

Query: 125 RKSAYQVVLSSRYDLLLNPLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVID 184
                 +V SSR  +               + +   + ++   +  Y+ +   S  + + 
Sbjct: 120 -----NIVNSSRISM---------------THMANNRLDSSNNTIFYNMDVMTSYDYRLQ 159

Query: 185 FSRSMLDYQRDSEGQPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYML 244
           F   +L+ QR    Q +  F     R          ++G R   L   +V  + S++  +
Sbjct: 160 FIEHLLN-QR--YNQKIVSFIPALLRI---------EMGERPIFLIELVVDLSGSMHCAM 207

Query: 245 YPGPLDPSLSEEHFVDSSSLRHVIKKKHL--VRDALASVIRSIKKIDNVNDTVRMGATFF 302
              P D        V+S+ +    K+  +  +++AL   + SI  + +V + V MG   +
Sbjct: 208 NSDPED--------VNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYMGLIGY 259

Query: 303 NDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMK 362
             RV  +   SWG  K+ + + +   +D   +  T    AM+ AY  + S   D+     
Sbjct: 260 TTRVEKNIEPSWGTEKVRQYVTRD--MDSLILKPTDSTPAMKQAYQILTS---DKKRSFF 314

Query: 363 NN----------LEAKKYIVLLTDGENT--QDNEEGIAICNKAKSQGIRIMTIAFSVNKT 410
            N          L  +K+I+ LTDGEN   + N   I IC+KAK   I+I+TI+ + +  
Sbjct: 315 TNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINASPN 374

Query: 411 QQEKARYFLSNC-ASPNSFFEANSTHELNKIFRD 443
            Q      L  C +SP   +   +   L  +F++
Sbjct: 375 GQR----LLKTCVSSPEYHYNVVNADSLIHVFQN 404

>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Back     alignment
 Score = 57.8 bits (138), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 94/446 (21%), Positives = 193/446 (43%), Gaps = 66/446 (14%)

Query: 25  ITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTAIITASVPLI--QSLEEVSSRAKNS 82
           +TA+++ V        +D+    Y  + ++ A   A+++    ++  +++++ +++   +
Sbjct: 1   MTAIIISVCFLFITYAIDLAHIMYIRNQMQSALDAAVLSGCASIVSDRTIKDPTTKKDQT 60

Query: 83  FTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAVEMNPRKSAYQVVLSSRYDLLLN 142
            T  K++I+++L +   + +++N  D   +  +  T  + NP     Q +  S+    + 
Sbjct: 61  STIFKKQIKKHLKQG--SYIRENAGDIAQKAQINITKDKNNP----LQYIAESKAQYEIP 114

Query: 143 PLSLFLRSMGIKSWLIQTKAEAETVSRSYHKEHGVSIQWVIDFSRSMLDY----QRDSEG 198
             +LFL+ + I S L      +  +     +   +SI  V+D SRSM D       D+  
Sbjct: 115 TENLFLKGL-IPSALTNLSLRSTGIIERSSENLAISICMVLDVSRSMEDLYLQKHNDNNN 173

Query: 199 QPLNCFGQPADRTVKSYSSQNGKVGIRDEKLSPYMVSCNKSLYYMLYPGPLDPSLSEEHF 258
              N +  P     KS+ S+N                  KS Y    P P   +   +  
Sbjct: 174 MTSNKYLLPPPPK-KSFWSKN----------------TTKSKYA---PAPAPANRKIDVL 213

Query: 259 VDSSSLRHVIKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISD--PSFSWGV 316
           ++S+             + + S+ ++I++  N+  +VR+G   +N  ++ +     S  +
Sbjct: 214 IESAG------------NLVNSIQKAIQEKKNL--SVRIGTIAYNIGIVGNQCTPLSNNL 259

Query: 317 HKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTD 376
           ++     VK+     N   +T    AM  AY  + +  E   H    +   KK+++ +TD
Sbjct: 260 NE-----VKSRLNKLNPYENTNTYPAMHHAYRELYNEKESS-HNTIGSTRLKKFVIFITD 313

Query: 377 GENT-----QDNEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCA-SPNSFFE 430
           GEN+     Q+    + IC   ++ G++I ++A S     Q+     L  C  S   FF 
Sbjct: 314 GENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQD----LLRKCTDSSGQFFA 369

Query: 431 ANSTHELNKIFRDRIGNEIFERVIRI 456
            N + EL + F D+I ++I E+ +RI
Sbjct: 370 VNDSRELLESF-DKITDKIQEQSVRI 394

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target458 hypothetical protein CLIBASIA_01365 [Candidatus Liberib
315122199463 hypothetical protein CKC_02245 [Candidatus Liberibacter 1 1e-86
209550922411 von Willebrand factor type A [Rhizobium leguminosarum b 1 1e-20
190893432410 hypothetical protein RHECIAT_CH0003859 [Rhizobium etli 1 1e-19
327189644415 hypothetical protein RHECNPAF_570041 [Rhizobium etli CN 1 2e-19
150397936419 von Willebrand factor type A [Sinorhizobium medicae WSM 1 7e-18
254780833371 hypothetical protein CLIBASIA_03630 [Candidatus Liberib 1 2e-16
86359182411 hypothetical protein RHE_CH03592 [Rhizobium etli CFN 42 1 6e-16
218662625389 hypothetical protein RetlI_26027 [Rhizobium etli IE4771 1 1e-15
218515283329 hypothetical protein Retl8_17130 [Rhizobium etli 8C-3] 1 3e-15
15966595410 hypothetical protein SMc04059 [Sinorhizobium meliloti 1 1 3e-15
>gi|315122199|ref|YP_004062688.1| hypothetical protein CKC_02245 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 463 Back     alignment and organism information
 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 189/477 (39%), Positives = 294/477 (61%), Gaps = 33/477 (6%)

Query: 1   MVFDTKFIFYSKKLIKSCTGHFFIITALLMPVMLGVGGMLVDVVRWSYYEHALKQAAQTA 60
           MVF+    F  K+L K   G FF+I+ALL+PV+  V G+L+D+VRW YY ++L QA  TA
Sbjct: 1   MVFNKSLFFNFKRLKKCYNGSFFVISALLLPVIFMVIGLLIDLVRWGYYHNSLVQAVNTA 60

Query: 61  IITASVPLIQSLEEVSSRAKNSFTFPKQKIEEYLIRNFENNLKKNFTDREVRDIVRDTAV 120
            ++ASV L+ S+E+ S     S    +  I++YL+ N + +L  NF + + + I++ T V
Sbjct: 61  ALSASVQLLNSVEDKSKEKALSSVLGENNIKQYLLNNLKISLYNNFGEMDSQRIIQHTKV 120

Query: 121 EMNPRKSAYQVVLSSRYDLLLNPLSLFLRSM-GIKSWLIQTKAEAETVS-RSYHKEHGVS 178
            +  RK  + + + S Y+L LNP SLF  ++  IKSW I T  EAE  S ++YHKE GVS
Sbjct: 121 NIYNRKGTHIINVYSHYNLPLNPFSLFFMNLINIKSWPITTVGEAEVTSKKNYHKEEGVS 180

Query: 179 IQWVIDFSRSMLDYQRDSEGQPLN--CFGQPADRTVKSYSSQNGKVGI-RDEK------- 228
           +QW+ID S SM        G  ++  CFG    + +KS  +   K+GI R+E        
Sbjct: 181 VQWLIDDSGSM--------GSIIDRACFGS---KQLKSQYNVGSKIGIVRNENADTSDSF 229

Query: 229 --LSPYMVSCNKSLYYMLYPGPL--DPSLSEEHFVDSSSLRHVIKKKHLVRDALASVIRS 284
             +   +VSC++SLYY+L    +  D  L E++  + S  ++ I+K++LVRDALA+ I+ 
Sbjct: 230 YPIVGELVSCDRSLYYVLNDKKILEDDDLEEKNLDNHS--QYYIRKRYLVRDALATFIKR 287

Query: 285 IKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGSTAINDAMQ 344
           ++KIDN+ D +RM   +FN+R+      +WG+ K  +  V +    ++E  +T I+  +Q
Sbjct: 288 VRKIDNLKDKLRMSFMYFNERIDHYFPMTWGI-KEFKQEVSSHYKRKHENTATDIHPILQ 346

Query: 345 TAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDG---ENTQDNEEGIAICNKAKSQGIRIM 401
            AY+ + S NED+ H+ KN++E KK+IVLLTDG   E     +  + IC+ AK +GI+I 
Sbjct: 347 EAYNKLHSKNEDDEHKKKNSVEVKKFIVLLTDGAQNEGVHSVDSVLKICDAAKEEGIKIF 406

Query: 402 TIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDRIGNEIFERVIRITK 458
           TI++SV+ ++++KA  FLS CASP+ FFEA    +LN IF++ IG+ IFER+++I +
Sbjct: 407 TISYSVDSSERKKANDFLSRCASPDKFFEAYDADKLNMIFKEHIGDAIFERLVKIRR 463


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209550922|ref|YP_002282839.1| von Willebrand factor type A [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 411 Back     alignment and organism information
>gi|190893432|ref|YP_001979974.1| hypothetical protein RHECIAT_CH0003859 [Rhizobium etli CIAT 652] Length = 410 Back     alignment and organism information
>gi|327189644|gb|EGE56794.1| hypothetical protein RHECNPAF_570041 [Rhizobium etli CNPAF512] Length = 415 Back     alignment and organism information
>gi|150397936|ref|YP_001328403.1| von Willebrand factor type A [Sinorhizobium medicae WSM419] Length = 419 Back     alignment and organism information
>gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Back     alignment and organism information
>gi|86359182|ref|YP_471074.1| hypothetical protein RHE_CH03592 [Rhizobium etli CFN 42] Length = 411 Back     alignment and organism information
>gi|218662625|ref|ZP_03518555.1| hypothetical protein RetlI_26027 [Rhizobium etli IE4771] Length = 389 Back     alignment and organism information
>gi|218515283|ref|ZP_03512123.1| hypothetical protein Retl8_17130 [Rhizobium etli 8C-3] Length = 329 Back     alignment and organism information
>gi|15966595|ref|NP_386948.1| hypothetical protein SMc04059 [Sinorhizobium meliloti 1021] Length = 410 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target458 hypothetical protein CLIBASIA_01365 [Candidatus Liberib
cd01467180 cd01467, vWA_BatA_type, VWA BatA type: Von Willebrand f 2e-06
cd00198161 cd00198, vWFA, Von Willebrand factor type A (vWA) domai 7e-06
smart00327177 smart00327, VWA, von Willebrand factor (vWF) type A dom 2e-05
cd01450161 cd01450, vWFA_subfamily_ECM, Von Willebrand factor type 3e-07
pfam00092177 pfam00092, VWA, von Willebrand factor type A domain 2e-05
>gnl|CDD|29240 cd01467, vWA_BatA_type, VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|29222 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|128622 smart00327, VWA, von Willebrand factor (vWF) type A domain Back     alignment and domain information
>gnl|CDD|29223 cd01450, vWFA_subfamily_ECM, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|143873 pfam00092, VWA, von Willebrand factor type A domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 458 hypothetical protein CLIBASIA_01365 [Candidatus Liberib
PRK13685326 hypothetical protein; Provisional 99.79
cd01467180 vWA_BatA_type VWA BatA type: Von Willebrand factor type 99.77
cd01465170 vWA_subgroup VWA subgroup: Von Willebrand factor type A 99.72
cd01461171 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin 99.67
cd01466155 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor ty 99.59
cd01463190 vWA_VGCC_like VWA Voltage gated Calcium channel like: V 99.49
cd01456206 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type 99.47
cd01480186 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) typ 99.46
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extr 99.39
cd01470198 vWA_complement_factors Complement factors B and C2 are 99.36
cd01451178 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelata 99.34
pfam00092177 VWA von Willebrand factor type A domain. 99.33
cd01464176 vWA_subfamily VWA subfamily: Von Willebrand factor type 99.32
cd01469177 vWA_integrins_alpha_subunit Integrins are a class of ad 99.21
smart00327177 VWA von Willebrand factor (vWF) type A domain. VWA doma 99.18
cd01472164 vWA_collagen von Willebrand factor (vWF) type A domain; 99.16
cd01473192 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhe 99.15
cd01471186 vWA_micronemal_protein Micronemal proteins: The Toxopla 99.1
cd01481165 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) li 99.06
cd01477193 vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand facto 99.02
cd01482164 vWA_collagen_alphaI-XII-like Collagen: The extracellula 98.94
cd01476163 VWA_integrin_invertebrates VWA_integrin (invertebrates) 98.92
COG1240261 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] 98.16
COG4245207 TerY Uncharacterized protein encoded in toxicity protec 98.1
KOG2353 1104 consensus 97.78
PRK13406584 bchD magnesium chelatase subunit D; Provisional 97.22
TIGR02031705 BchD-ChlD magnesium chelatase ATPase subunit D; InterPr 96.9
cd01453183 vWA_transcription_factor_IIH_type Transcription factors 96.18
TIGR02442688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 96.17
COG4961185 TadG Flp pilus assembly protein TadG [Intracellular tra 99.52
COG4655 565 Predicted membrane protein [Function unknown] 97.74
pfam0781143 TadE TadE-like protein. The members of this family are 96.44
COG4726196 PilX Tfp pilus assembly protein PilX [Cell motility and 90.9
cd01474185 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is 99.33
TIGR00868 874 hCaCC calcium-activated chloride channel protein 1; Int 99.32
cd01450161 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) d 99.27
cd00198161 vWFA Von Willebrand factor type A (vWA) domain was orig 99.07
TIGR03436296 acidobact_VWFA VWFA-related Acidobacterial domain. Memb 99.04
cd01454174 vWA_norD_type norD type: Denitrifying bacteria contain 98.5
COG4548637 NorD Nitric oxide reductase activation protein [Inorgan 97.05
COG2425437 Uncharacterized protein containing a von Willebrand fac 95.53
pfam11775220 CobT_C Cobalamin biosynthesis protein CobT VWA domain. 94.92
cd01455191 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) do 90.92
cd01462152 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type 98.93
cd01457199 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor 94.67
COG384758 Flp Flp pilus assembly protein, pilin Flp [Intracellula 93.35
>PRK13685 hypothetical protein; Provisional Back     alignment and domain information
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information
>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation Back     alignment and domain information
>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>pfam00092 VWA von Willebrand factor type A domain Back     alignment and domain information
>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration Back     alignment and domain information
>smart00327 VWA von Willebrand factor (vWF) type A domain Back     alignment and domain information
>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology Back     alignment and domain information
>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell Back     alignment and domain information
>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01477 vWA_F09G8-8_type VWA F09G8 Back     alignment and domain information
>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions Back     alignment and domain information
>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] Back     alignment and domain information
>KOG2353 consensus Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D; InterPro: IPR011776 This entry represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX Back     alignment and domain information
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR012804 Cobalamin (vitamin B12) can be complexed with metal via ATP-dependent reactions (aerobic pathway) (e Back     alignment and domain information
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4655 Predicted membrane protein [Function unknown] Back     alignment and domain information
>pfam07811 TadE TadE-like protein Back     alignment and domain information
>COG4726 PilX Tfp pilus assembly protein PilX [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1; InterPro: IPR004727 This entry represents a family of Ca(2+)-regulated chloride channels (CLCA) which includes bovine, murine and human proteins , Back     alignment and domain information
>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain Back     alignment and domain information
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases Back     alignment and domain information
>COG4548 NorD Nitric oxide reductase activation protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>pfam11775 CobT_C Cobalamin biosynthesis protein CobT VWA domain Back     alignment and domain information
>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>COG3847 Flp Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target458 hypothetical protein CLIBASIA_01365 [Candidatus Liberib
2xwb_F 732 Crystal Structure Of Complement C3b In Complex With 2e-04
3hrz_D 741 Cobra Venom Factor (Cvf) In Complex With Human Fact 2e-04
2win_I 507 C3 Convertase (C3bbb) Stabilized By Scin Length = 5 2e-04
2ok5_A 752 Human Complement Factor B Length = 752 2e-04
1q0p_A223 A Domain Of Factor B Length = 223 0.002
>gi|317455060|pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732 Back     alignment and structure
 Score = 52.3 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/154 (13%), Positives = 42/154 (27%), Gaps = 18/154 (11%)

Query: 313 SWGVHKLIRTIVKTFAIDENEMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIV 372
           S     + + + +    D      T    A+Q  Y  +     D+V     N      I+
Sbjct: 295 SSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMS--WPDDVPPEGWNRTRH-VII 351

Query: 373 LLTDGENTQDNEEGIAICNKAKS--------QGIR-----IMTIAFSVNKTQQEKARYFL 419
           L+TDG +     + I + ++ +         +  R     +          Q        
Sbjct: 352 LMTDGLHNMG-GDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINALAS 410

Query: 420 SNCASPNSFFEANSTHELNKIFRDRIGNEIFERV 453
               +    F+      L  +F   I       +
Sbjct: 411 KKD-NEQHVFKVKDMENLEDVFYQMIDESQSLSL 443


>gi|251837060|pdb|3HRZ|D Chain D, Cobra Venom Factor (Cvf) In Complex With Human Factor B Length = 741 Back     alignment and structure
>gi|239781743|pdb|2WIN|I Chain I, C3 Convertase (C3bbb) Stabilized By Scin Length = 507 Back     alignment and structure
>gi|134105218|pdb|2OK5|A Chain A, Human Complement Factor B Length = 752 Back     alignment and structure
>gi|47168593|pdb|1Q0P|A Chain A, A Domain Of Factor B Length = 223 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target458 hypothetical protein CLIBASIA_01365 [Candidatus Liberib
2odp_A 509 Complement C2; C3/C5 convertase, complement serine prot 4e-09
3hrz_D 741 Complement factor B; serine protease, glycosilated, mul 7e-09
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell adhesi 1e-08
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} S 4e-08
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, blood 2e-07
1pt6_A213 Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.8 5e-06
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, I do 6e-06
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sapiens 9e-06
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hydrola 5e-05
2nvo_A535 RO sixty-related protein, RSR; alpha helical repeats, V 9e-04
>2odp_A Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
 Score = 58.0 bits (139), Expect = 4e-09
 Identities = 27/188 (14%), Positives = 54/188 (28%), Gaps = 12/188 (6%)

Query: 277 ALASVIRSIKKIDNVNDTVRMGATFFNDRVIS----DPSFSWGVHKLIRTIVKTFAIDEN 332
              S    + +I +    V +    F              S  + ++I ++      D  
Sbjct: 30  FKESASLMVDRIFSFEINVSVAIITFASEPKVLMSVLNDNSRDMTEVISSLENANYKDHE 89

Query: 333 EMGSTAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGEN--------TQDNE 384
               T    A+ + Y  + +             E +  I+LLTDG++          D+ 
Sbjct: 90  NGTGTNTYAALNSVYLMMNNQMRLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTAVDHI 149

Query: 385 EGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKIFRDR 444
             I   N+ ++  + I  I          +     S        F    T  L+++F   
Sbjct: 150 REILNINQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQVFEHM 209

Query: 445 IGNEIFER 452
           +       
Sbjct: 210 LDVSKLTD 217


>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* Length = 741 Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Length = 198 Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 1n9z_A 1bhq_1 1bho_1 1idn_1 Length = 194 Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Length = 202 Back     alignment and structure
>1pt6_A Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Length = 213 Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Length = 223 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Length = 178 Back     alignment and structure
>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- sheet, RNA binding protein; 1.89A {Deinococcus radiodurans} Length = 535 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target458 hypothetical protein CLIBASIA_01365 [Candidatus Liberib
2odp_A 509 Complement C2; C3/C5 convertase, complement serine prot 99.55
1rrk_A 497 Complement factor B; BB, hydrolase; 2.00A {Homo sapiens 99.48
3ibs_A218 Conserved hypothetical protein BATB; structural genomic 99.48
1q0p_A223 Complement factor B; VON willebrand factor, MAC-1, I do 99.47
1shu_X182 Anthrax toxin receptor 2; alpha/beta rossmann fold, mem 99.44
1n3y_A198 Integrin alpha-X; alpha/beta rossmann fold, cell adhesi 99.38
3hrz_D 741 Complement factor B; serine protease, glycosilated, mul 99.33
1v7p_C200 Integrin alpha-2; snake venom, C-type lectin, antagonis 99.31
1mf7_A194 Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} S 99.31
2b2x_A223 Integrin alpha-1; computational design, antibody-antige 99.28
1pt6_A213 Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.8 99.28
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; nucle 99.27
3gxb_A184 VON willebrand factor; VWA-like fold, blood coagulation 99.26
1atz_A189 VON willebrand factor; collagen-binding, hemostasis, di 99.25
1ijb_A202 VON willebrand factor; dinucleotide-binding fold, blood 99.2
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacteriochl 98.84
1mjn_A179 Integrin alpha-L; rossmann fold, immune system; 1.30A { 98.74
3k6s_A 1095 Integrin alpha-X; cell receptor, adhesion molecule, cel 98.53
2iue_A212 Pactolus I-domain; membrane protein, CD, ITC, limbs, mi 98.41
2xgg_A178 Microneme protein 2; A/I domain, cell adhesion, hydrola 99.0
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EGF dom 97.33
2vdr_B461 Integrin beta-3; cell adhesion/immune system, alternati 97.33
1yvr_A538 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kD 93.07
2nvo_A535 RO sixty-related protein, RSR; alpha helical repeats, V 96.93
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, cell 95.63
>2odp_A Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
Probab=99.55  E-value=5.1e-14  Score=106.55  Aligned_cols=165  Identities=15%  Similarity=0.088  Sum_probs=104.4

Q ss_pred             HHHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCC-----CCCCCCCCHHHHHHHHH
Q ss_conf             7776652211234677566652012110067766556557681210056666564125-----67777764588999998
Q gi|254780388|r  274 VRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDE-----NEMGSTAINDAMQTAYD  348 (458)
Q Consensus       274 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~-----~~~g~T~~~~gl~~g~~  348 (458)
                      .+..+..++..+...   ....+.+...|+.......++..... .++..+...+..+     .+.|+|+...+|..++.
T Consensus        30 ~k~~~~~~i~~~~~~---~~~~rv~lv~fs~~~~~~~~l~~~~~-~~~~~~~~~i~~i~~~~~~~~g~T~~~~Al~~a~~  105 (509)
T 2odp_A           30 FKESASLMVDRIFSF---EINVSVAIITFASEPKVLMSVLNDNS-RDMTEVISSLENANYKDHENGTGTNTYAALNSVYL  105 (509)
T ss_dssp             HHHHHHHHHHHHHTT---CCCEEEEEEEESSSEEEEECTTSGGG-GCHHHHHHHHHTCCGGGGTTCCSCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCC---CCCCEEEEEEECCEEEEEEECCCCCC-CCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             999999999961448---99748999998883579971788875-57999999997173456778997779999999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCHHHHHHHH---------HHHCCCEEEEEEECCCCCCCCHHHHHH
Q ss_conf             62366665444456677750699999606688885408999999---------998796899999437887431178999
Q gi|254780388|r  349 TIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAICNK---------AKSQGIRIMTIAFSVNKTQQEKARYFL  419 (458)
Q Consensus       349 ~Ls~~~~~~~~~~~~~~~~~K~iil~TDG~n~~~~~~~~~~C~~---------~K~~gI~IytI~f~~~~~~~~~~~~~l  419 (458)
                      .+...............+..|++||+|||..|.+.... ...+.         .|++||.||+||++...    .....|
T Consensus       106 ~~~~~~~~~~~~~~~~~~~~~~iillTDG~~n~g~~~~-~~~~~~~~~~~~~~~~~~~v~i~~igvG~~~----~d~~~L  180 (509)
T 2odp_A          106 MMNNQMRLLGMETMAWQEIRHAIILLTDGKSNMGGSPK-TAVDHIREILNINQKRNDYLDIYAIGVGKLD----VDWREL  180 (509)
T ss_dssp             HHHHHHHHHCTTSHHHHTEEEEEEEESCSCCCSSSCTH-HHHHHHHHHTTCCSTTGGGEEEEEEEESSSC----CCHHHH
T ss_pred             HHHHHHHHCCCCCCCCCCCCEEEEEECCCCCCCCCCHH-HHHHHHHHHHHHHHHHCCCCEEEEEEECCCC----CCHHHH
T ss_conf             99987643023556667886299999488756699848-9999987666665663069659999958864----589999


Q ss_pred             HHHCC-C---CCEEEECCHHHHHHHHHHHHHH
Q ss_conf             86068-9---8378829989999999999875
Q gi|254780388|r  420 SNCAS-P---NSFFEANSTHELNKIFRDRIGN  447 (458)
Q Consensus       420 k~CAs-~---~~yy~a~~~~eL~~aF~~~i~~  447 (458)
                      +..|| +   .|+|.+.+.++|.+.|.+|+.+
T Consensus       181 ~~ias~~~~~~h~f~~~~~~~L~~~~~~i~~~  212 (509)
T 2odp_A          181 NELGSKKDGERHAFILQDTKALHQVFEHMLDV  212 (509)
T ss_dssp             HHHSCCCTTCCCEEEESSHHHHHHHHHHHEEC
T ss_pred             HHHHCCCCCCCEEEEECCHHHHHHHHHHCCCC
T ss_conf             99865999971599948888999999740442



>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for structural genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y* Back     alignment and structure
>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* Back     alignment and structure
>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhesion, glycoprotein, toxin/cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A Back     alignment and structure
>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 1n9z_A 1bhq_1 1bho_1 1idn_1 Back     alignment and structure
>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune system; 2.20A {Rattus norvegicus} SCOP: c.62.1.1 Back     alignment and structure
>1pt6_A Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3gxb_A VON willebrand factor; VWA-like fold, blood coagulation, cell adhesion, cleavage on PAIR of basic residues, disease mutation, disulfide bond; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 2adf_A 1fe8_A 1ao3_A Back     alignment and structure
>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C Back     alignment and structure
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Back     alignment and structure
>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ... Back     alignment and structure
>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>2iue_A Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} Back     alignment and structure
>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, alternative splicing, cell adhesion, disease mutation, glycoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vdr_B Integrin beta-3; cell adhesion/immune system, alternative splicing, platelet integrin ALPHAIIBBETA3, polymorphism, glycoprotein, cell adhesion, calcium; HET: NAG MAN; 2.40A {Homo sapiens} PDB: 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A Back     alignment and structure
>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- sheet, RNA binding protein; 1.89A {Deinococcus radiodurans} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 458 hypothetical protein CLIBASIA_01365 [Candidatus Liberib
d1jeyb2236 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Huma 1e-05
d1n3ya_189 c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapie 4e-05
d1pt6a_192 c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapien 0.001
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 236 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: vWA-like
superfamily: vWA-like
family: Ku80 subunit N-terminal domain
domain: Ku80 subunit N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 45.0 bits (105), Expect = 1e-05
 Identities = 13/133 (9%), Positives = 37/133 (27%), Gaps = 4/133 (3%)

Query: 277 ALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDENEMGS 336
           A   +   +++     +   +    F      +P      ++ I         D + +  
Sbjct: 29  AKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLED 88

Query: 337 TAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKY----IVLLTDGENTQDNEEGIAICNK 392
                   +     + +    +  +++    KK+    I + TD  +     +   I + 
Sbjct: 89  IESKIQPGSQQADFLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHS 148

Query: 393 AKSQGIRIMTIAF 405
            K   I +     
Sbjct: 149 LKKCDISLQFFLP 161


>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target458 hypothetical protein CLIBASIA_01365 [Candidatus Liberib
d1q0pa_209 Complement factor B domain {Human (Homo sapiens) [TaxId 99.51
d1shux_181 Capillary morphogenesis protein 2 domain {Human (Homo s 99.46
d1n3ya_189 Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 96 99.42
d1ijba_202 von Willebrand factor A1 domain, vWA1 {Human (Homo sapi 99.32
d1mf7a_194 Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) 99.31
d1pt6a_192 Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 960 99.29
d1atza_184 von Willebrand factor A3 domain, vWA3 {Human (Homo sapi 99.28
d1v7pc_193 Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 960 99.18
d1mjna_179 Integrin CD11a/CD18 (Leukocyte function associated anti 98.95
d1jeyb2236 Ku80 subunit N-terminal domain {Human (Homo sapiens) [T 98.88
d1jeya2220 Ku70 subunit N-terminal domain {Human (Homo sapiens) [T 98.8
d1tyeb2248 Integrin beta A domain {Human (Homo sapiens) [TaxId: 96 98.24
d1yvra2174 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed 97.81
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: vWA-like
superfamily: vWA-like
family: Integrin A (or I) domain
domain: Complement factor B domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.51  E-value=2.3e-13  Score=100.80  Aligned_cols=167  Identities=13%  Similarity=0.122  Sum_probs=108.8

Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCC-----CCCCCCCCHHHHHHH
Q ss_conf             667776652211234677566652012110067766556557681210056666564125-----677777645889999
Q gi|254780388|r  272 HLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVHKLIRTIVKTFAIDE-----NEMGSTAINDAMQTA  346 (458)
Q Consensus       272 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~-----~~~g~T~~~~gl~~g  346 (458)
                      +..+.++..++..+...   ....+.+...|+.......++..... .....+...++.+     .+.|+|+...+|.++
T Consensus        20 ~~~k~~~~~li~~l~~~---~~~~rv~lv~f~~~~~~~~~l~~~~~-~~~~~l~~~i~~i~~~~~~~~g~t~~~~al~~a   95 (209)
T d1q0pa_          20 TGAKKSLVNLIEKVASY---GVKPRYGLVTYATYPKIWVKVSEADS-SNADWVTKQLNEINYEDHKLKSGTNTKKALQAV   95 (209)
T ss_dssp             HHHHHHHHHHHHHHHTT---TCCCEEEEEEESSSEEEEECTTSGGG-GCHHHHHHHHHTCCTTSCSCTTCCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCC---CCCCEEEEEEECCCEEEEECCCCCHH-HHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             99999999999961047---88767999996585058864765116-678999999997210136678885498999999


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCHHHHH------------HHHHHHCCCEEEEEEECCCCCCCCH
Q ss_conf             9862366665444456677750699999606688885408999------------9999987968999994378874311
Q gi|254780388|r  347 YDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQDNEEGIAI------------CNKAKSQGIRIMTIAFSVNKTQQEK  414 (458)
Q Consensus       347 ~~~Ls~~~~~~~~~~~~~~~~~K~iil~TDG~n~~~~~~~~~~------------C~~~K~~gI~IytI~f~~~~~~~~~  414 (458)
                      ...+.....+..   ...++..|++||+|||..+.........            +..++..||.||+||++...+    
T Consensus        96 ~~~~~~~~~~~~---~~~~~~~kvvvl~TDG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gi~i~~vgvg~~~~----  168 (209)
T d1q0pa_          96 YSMMSWPDDVPP---EGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVN----  168 (209)
T ss_dssp             HHHHCCTTSSCC---TTGGGCEEEEEEEECSCCCSSSCTHHHHHHHHHHTTCSCBTTBCCGGGEEEEEEECSSCCC----
T ss_pred             HHHHHHHHCCCC---CCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCC----
T ss_conf             999975222476---5667775189997578766789858999999985443789999986699559842776689----


Q ss_pred             HHHHHHHHCC-C---CCEEEECCHHHHHHHHHHHHHHHHH
Q ss_conf             7899986068-9---8378829989999999999875875
Q gi|254780388|r  415 ARYFLSNCAS-P---NSFFEANSTHELNKIFRDRIGNEIF  450 (458)
Q Consensus       415 ~~~~lk~CAs-~---~~yy~a~~~~eL~~aF~~~i~~~~~  450 (458)
                       ...|+.+|+ +   .+||.+.+.++|.++|.+|+.+..+
T Consensus       169 -~~~L~~iAs~~~~~~~~f~~~~~~~L~~~~~~ii~~~~s  207 (209)
T d1q0pa_         169 -QVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQS  207 (209)
T ss_dssp             -HHHHHHHSCCCTTCCCEEETTC-----------------
T ss_pred             -HHHHHHHHCCCCCCEEEEEECCHHHHHHHHHHHHHHHCC
T ss_conf             -999999974989971599938999999999999885257



>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 458 hypothetical protein CLIBASIA_01365 [Candidatus Li
2odp_A_1-224224 (A:1-224) Complement C2; C3/C5 convertase, complem 2e-08
1jey_B_1-236_463-505279 (B:1-236,B:463-505) KU80; double-strand DNA break 3e-08
2ww8_A_221-279_318-447_506-585269 (A:221-279,A:318-447,A:506-585) RRGA, cell WALL su 1e-06
3hrz_D_199-457259 (D:199-457) Complement factor B; serine protease, 1e-06
1jey_A_1-252252 (A:1-252) KU70; double-strand DNA break repair, no 7e-06
3k6s_A_125-315191 (A:125-315) Integrin alpha-X; hetero dimer, cell r 2e-05
1q0p_A_223 (A:) Complement factor B; VON willebrand factor, M 9e-05
2ww8_A_221-279_318-447_506-585269 (A:221-279,A:318-447,A:506-585) RRGA, cell WALL su 8e-06
1yvr_A_365-538174 (A:365-538) RO autoantigen, 60-kDa SS-A/RO ribonuc 3e-04
>2odp_A (A:1-224) Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A*Length = 224 Back     alignment and structure
 Score = 55.4 bits (132), Expect = 2e-08
 Identities = 25/183 (13%), Positives = 62/183 (33%), Gaps = 15/183 (8%)

Query: 273 LVRDALASVIRSIKKIDNVNDTVRMGATFFNDRV---ISDPSFSWGVHKLIRTIVKTFAI 329
           + +++ + ++    +I +    V +    F       +S  + +      + + ++    
Sbjct: 29  IFKESASLMVD---RIFSFEINVSVAIITFASEPKVLMSVLNDNSRDMTEVISSLENANY 85

Query: 330 DENEMGS-TAINDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQD------ 382
            ++E G+ T    A+ + Y  + +             E +  I+LLTDG++         
Sbjct: 86  KDHENGTGTNTYAALNSVYLMMNNQMRLLGMETMAWQEIRHAIILLTDGKSNMGGSPKTA 145

Query: 383 --NEEGIAICNKAKSQGIRIMTIAFSVNKTQQEKARYFLSNCASPNSFFEANSTHELNKI 440
             +   I   N+ ++  + I  I          +     S        F    T  L+++
Sbjct: 146 VDHIREILNINQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQV 205

Query: 441 FRD 443
           F  
Sbjct: 206 FEH 208


>1jey_B (B:1-236,B:463-505) KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens}Length = 279 Back     alignment and structure
>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae}Length = 269 Back     alignment and structure
>3hrz_D (D:199-457) Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A*Length = 259 Back     alignment and structure
>1jey_A (A:1-252) KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens}Length = 252 Back     alignment and structure
>3k6s_A (A:125-315) Integrin alpha-X; hetero dimer, cell receptor, adhesion molecule, calcium, cell adhesion, disulfide bond, glycoprotein, magnesium, membrane; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A*Length = 191 Back     alignment and structure
>1q0p_A (A:) Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens}Length = 223 Back     alignment and structure
>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae}Length = 269 Back     alignment and structure
>1yvr_A (A:365-538) RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis}Length = 174 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target458 hypothetical protein CLIBASIA_01365 [Candidatus Liberib
2ww8_A_221-279_318-447_506-585269 RRGA, cell WALL surface anchor family protein; IGG 99.9
3hrz_D_199-457259 Complement factor B; serine protease, glycosilated 99.51
1rrk_A_1-214214 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.47
1shu_X_182 Anthrax toxin receptor 2; alpha/beta rossmann fold 99.44
2odp_A_1-224224 Complement C2; C3/C5 convertase, complement serine 99.43
3ibs_A_218 Conserved hypothetical protein BATB; structural ge 99.42
3gxb_A_184 VON willebrand factor; VWA-like fold, blood coagul 99.39
1q0p_A_223 Complement factor B; VON willebrand factor, MAC-1, 99.36
1atz_A_189 VON willebrand factor; collagen-binding, hemostasi 99.33
1jey_A_1-252252 KU70; double-strand DNA break repair, non-homologo 99.32
1n3y_A_198 Integrin alpha-X; alpha/beta rossmann fold, cell a 99.28
1jey_B_1-236_463-505279 KU80; double-strand DNA break repair, non-homologo 99.25
1ijb_A_202 VON willebrand factor; dinucleotide-binding fold, 99.25
3k6s_A_125-315191 Integrin alpha-X; hetero dimer, cell receptor, adh 99.22
2b2x_A_223 Integrin alpha-1; computational design, antibody-a 99.19
1mf7_A_194 Integrin alpha M; cell adhesion; 1.25A {Homo sapie 99.18
1v7p_C_200 Integrin alpha-2; snake venom, C-type lectin, anta 99.17
1pt6_A_213 Integrin alpha-1; X-RAY diffraction, cell adhesion 99.11
1mjn_A_179 Integrin alpha-L; rossmann fold, immune system; 1. 98.94
2iue_A_212 Pactolus I-domain; membrane protein, CD, ITC, limb 98.52
1yvr_A_365-538174 RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 98.86
2vdr_B_110-351242 Integrin beta-3; cell adhesion/immune system, alte 98.79
2nvo_A_53-64_359-535189 RO sixty-related protein, RSR; alpha helical repea 98.79
3fcs_B_109-352244 Integrin beta-3; beta propeller, rossmann fold, EG 98.4
3k6s_B_102-342241 Integrin beta-2; hetero dimer, cell receptor, adhe 98.19
>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
Probab=99.90  E-value=5.4e-23  Score=164.81  Aligned_cols=166  Identities=14%  Similarity=0.160  Sum_probs=113.7

Q ss_pred             CCCCHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCHH---------HHHHHHHHHHHHCCCCCCCCC
Q ss_conf             43306677766522112346775666520121100677665565576812---------100566665641256777776
Q gi|254780388|r  268 IKKKHLVRDALASVIRSIKKIDNVNDTVRMGATFFNDRVISDPSFSWGVH---------KLIRTIVKTFAIDENEMGSTA  338 (458)
Q Consensus       268 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~i~~~~~~g~T~  338 (458)
                      ..+++..+.....++......    ...+.+.+.|+..........+...         ..+...+...++.+.+.|+|+
T Consensus        25 ~~~~~~~~~~~~~~~~~~~~~----~~~~v~lv~f~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~~i~~~~~~GgT~  100 (269)
T 2ww8_A           25 ARRAERAGEATRSLIDKITSD----SENRVALVTYASTIDYSYLKLTNDKNDIVELKNKVPTEAEDHDGNRLMYQFGATF  100 (269)
T ss_dssp             CCHHHHHHHHHHHHHHHHHTS----TTCEEEEEEESSSBBCCEEEEECCHHHHHHHHHHSCSCCCCSCTTSGGGGGCSCC
T ss_pred             CEEEEECCCCEEEEEEEEEEC----CCCEEEEEEECCCCCCCEEEEEECCCCEEEECCEEEEEECCCCCCCEEECCCCEE
T ss_conf             305652264504642577753----7860578840231042025554125411330310123210245641010146246


Q ss_pred             CHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEECCCCCC-------------------------------------
Q ss_conf             4588999998623666654444566777506999996066888-------------------------------------
Q gi|254780388|r  339 INDAMQTAYDTIISSNEDEVHRMKNNLEAKKYIVLLTDGENTQ-------------------------------------  381 (458)
Q Consensus       339 ~~~gl~~g~~~Ls~~~~~~~~~~~~~~~~~K~iil~TDG~n~~-------------------------------------  381 (458)
                      .+.||.|+++.+.+.+         .....|+|||||||.++.                                     
T Consensus       101 ~~~AL~~a~~~l~~~~---------~~~~~kvIiliTDG~~~~~~~~~~~~~~~~~~~~v~i~~i~~~~~~~~~~~~~~~  171 (269)
T 2ww8_A          101 TQKALMKADEILTQQA---------RQNSQKVIFHITDGVPTMSYPINFNHATFAPSYQNQLNAFFSKSPNKDGILLSDF  171 (269)
T ss_dssp             HHHHHHHHHHHHHHHS---------CSSSEEEEEEEESSCCSEECCBCCCCSTTCCCHHHHHHHHHHTSTTSSSCCGGGB
T ss_pred             EEEECCCCCEEEEECC---------CCCCCEEEEECCCCCCCEEECCCCCCCCCCEEEECCCEEEEEECCCCCEEEECCE
T ss_conf             6530022414776215---------7765204786156631000001344541004763131056651121120661110


Q ss_pred             ----------------------------CCCHHHHHHHHHHHCCCEEEEEEECCCCCCC---CHHHHHHHHHCC-CCCEE
Q ss_conf             ----------------------------8540899999999879689999943788743---117899986068-98378
Q gi|254780388|r  382 ----------------------------DNEEGIAICNKAKSQGIRIMTIAFSVNKTQQ---EKARYFLSNCAS-PNSFF  429 (458)
Q Consensus       382 ----------------------------~~~~~~~~C~~~K~~gI~IytI~f~~~~~~~---~~~~~~lk~CAs-~~~yy  429 (458)
                                                  .+.++..+|+++|++||+||||||+.+++..   +.++++||+||| |.|||
T Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~k~~~i~i~ti~~~~~~~~~~~~~~~~~~l~~cas~~~~y~  251 (269)
T 2ww8_A          172 ITQATSGEHTIVRGDGQSNSNTAKITNHGDPTRWYYNGNIAPDGYDVFTVGIGINGDPGTDEATATSFMQSISSKPENYT  251 (269)
T ss_dssp             CCCCTTCGGGTCEECSSCTCSSCCBCBSHHHHHHHHHHHTGGGCCEEEEEEESCCCTTTSCHHHHHHHHHHTSSSGGGEE
T ss_pred             EEEECCCCCEEECCCCEECCCCEEEEECCCCEEEEEEEECCCCCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCEE
T ss_conf             12310122102037742753205762047430578875204676303577677156421002343057756611665326


Q ss_pred             EECCHHHHHHHHHHHHHHHHH
Q ss_conf             829989999999999875875
Q gi|254780388|r  430 EANSTHELNKIFRDRIGNEIF  450 (458)
Q Consensus       430 ~a~~~~eL~~aF~~~i~~~~~  450 (458)
                      +|.   ||.++|++ |+++++
T Consensus       252 ~~~---~~~~~f~~-ia~~~~  268 (269)
T 2ww8_A          252 NVT---DTTKILEQ-LNRYFH  268 (269)
T ss_dssp             EES---SGGGHHHH-HHHHHT
T ss_pred             EEC---CCCCEECC-CCCCCE
T ss_conf             405---66511113-355412



>3hrz_D (D:199-457) Complement factor B; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 3hs0_D* 2ok5_A* Back     alignment and structure
>1rrk_A (A:1-214) Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} Back     alignment and structure
>1shu_X (X:) Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} Back     alignment and structure
>2odp_A (A:1-224) Complement C2; C3/C5 convertase, complement serine protease, human complement system, glycoprotein, SP, VWFA, hydrolase; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3ibs_A (A:) Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for structural genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gxb_A (A:) VON willebrand factor; VWA-like fold, blood coagulation, cell adhesion, cleavage on PAIR of basic residues, disease mutation, disulfide bond; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1q0p_A (A:) Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1atz_A (A:) VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} Back     alignment and structure
>1jey_A (A:1-252) KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>1n3y_A (A:) Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} Back     alignment and structure
>1jey_B (B:1-236,B:463-505) KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>1ijb_A (A:) VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} Back     alignment and structure
>3k6s_A (A:125-315) Integrin alpha-X; hetero dimer, cell receptor, adhesion molecule, calcium, cell adhesion, disulfide bond, glycoprotein, magnesium, membrane; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A* Back     alignment and structure
>2b2x_A (A:) Integrin alpha-1; computational design, antibody-antigen complex, immune system; 2.20A {Rattus norvegicus} Back     alignment and structure
>1mf7_A (A:) Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} Back     alignment and structure
>1v7p_C (C:) Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhesion, glycoprotein, toxin/cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>1pt6_A (A:) Integrin alpha-1; X-RAY diffraction, cell adhesion; 1.87A {Homo sapiens} Back     alignment and structure
>1mjn_A (A:) Integrin alpha-L; rossmann fold, immune system; 1.30A {Escherichia coli} Back     alignment and structure
>2iue_A (A:) Pactolus I-domain; membrane protein, CD, ITC, limbs, midas, admidas, membrane, integrin, titration, rossman fold, cell adhesion, transmembrane; NMR {Mus musculus} Back     alignment and structure
>1yvr_A (A:365-538) RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} Back     alignment and structure
>2vdr_B (B:110-351) Integrin beta-3; cell adhesion/immune system, alternative splicing, platelet integrin ALPHAIIBBETA3, polymorphism, glycoprotein, cell adhesion, calcium; HET: NAG MAN; 2.40A {Homo sapiens} PDB: 2vc2_B* 2vdk_B* 2vdm_B* 2vdn_B* 2vdl_B* 2vdp_B* 2vdq_B* 2vdo_B* 3fcu_B* 1txv_B* 1ty3_B* 1ty5_B* 1ty6_B* 1ty7_B* 1tye_B* Back     alignment and structure
>2nvo_A (A:53-64,A:359-535) RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- sheet, RNA binding protein; 1.89A {Deinococcus radiodurans} Back     alignment and structure
>3fcs_B (B:109-352) Integrin beta-3; beta propeller, rossmann fold, EGF domain, alternative splicing, cell adhesion, disease mutation, glycoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3k6s_B (B:102-342) Integrin beta-2; hetero dimer, cell receptor, adhesion molecule, calcium, cell adhesion, disulfide bond, glycoprotein, magnesium, membrane; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure