254780387

254780387

C4-dicarboxylate transporter DctA

GeneID in NCBI database:8209372Locus tag:CLIBASIA_01360
Protein GI in NCBI database:254780387Protein Accession:YP_003064800.1
Gene range:+(285887, 287167)Protein Length:426aa
Gene description:C4-dicarboxylate transporter DctA
COG prediction:[C] Na+/H+-dicarboxylate symporters
KEGG prediction:C4-dicarboxylate transporter DctA; K11103 aerobic C4-dicarboxylate transport protein
SEED prediction:C4-dicarboxylate transport protein
Pathway involved in KEGG:Two-component system [PATH:las02020]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM7 TM-Helix
TOPPRED8 TM-Helix
HMMTOP10 TM-Helix
MEMSAT10 TM-Helix
MEMSAT_SVM9 TM-Helix
PHOBIUS8 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420------
MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE
cccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHcccccccHHHHHHHHHccccHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccc
ccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHcHEEEEHHHHcccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccEEEEEEccccEEcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccc
mkesvqvhgdirpplYKILYIQVLVAIFSGmalghfvpqigvqmqplgDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIvgniakpgigmnvdlkslnteSIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIaplgafgamSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLStsssesalPGLMKKMEEAGCHRSIVSmvvptgysfnldgsnIYITLATLFISqatnvplsltDQLSLLLIAMVSskgaagvtgSAFITLAATItlvpslpiaGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRwekkldpklfnkyigie
mkesvqvhgdirpplYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTvstgiarmKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVvvsrwekkldpklfnkyigie
MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFlkeevllvlstsssesalPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPlsltdqlslllIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE
****************KILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLN*************SFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNK*IG**
********GDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE
*********DIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGI*
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRoooHHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE
MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE
MKESVQVHGDIRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNKYIGIE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target426 C4-dicarboxylate transporter DctA [Candidatus Liberibac
254781171420 hypothetical protein CLIBASIA_05390 [Candidatus Li 1e-09
>gi|254781171|ref|YP_003065584.1| hypothetical protein CLIBASIA_05390 [Candidatus Liberibacter asiaticus str. psy62] Length = 420 Back     alignment
 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 80/384 (20%), Positives = 173/384 (45%), Gaps = 38/384 (9%)

Query: 49  DIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIV--- 105
           ++FV+  K +  P+I L++   +++    + +G+++ K +F   + +M A  + L     
Sbjct: 46  NVFVRIFKFISLPLISLSLIVSLSKCVPEQGMGKLWGKTVFYTMLTTMLAASVALCTYGL 105

Query: 106 ----GNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQ 161
                 I KP + +N+                   +F  ++ ++IP+  ++      ++ 
Sbjct: 106 ISPSNMITKPDVAVNIG----------------KMNFWNYVANLIPNNVVAPFLESQVIG 149

Query: 162 TLIVALLFGISLSLVGE---KSDTIRKCLEEINFPVFRMVSIVMRIAP--LGAFGAMSFT 216
            L+++   GI+   + +   KS TI    E I+     + + VM+I P  LG+F A++  
Sbjct: 150 ILLISGSIGIATHFITDKHIKSSTIV-FFEGIHSIFLTITNWVMKIIPIALGSFIAVTIL 208

Query: 217 IGKYGL--SSISNLIFLVFCLYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLS 274
             K GL  S +   + +V        F +L V+  +  F   +I+K +      + +   
Sbjct: 209 QFKKGLNISGLGEYLSVVILSNLIQGFIVLPVILYIKGFNPLTIVKGMF---PALAVAFF 265

Query: 275 TSSSESALPGLMKKMEEA-GCHRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPL 333
           + SS   LP  M+  E+       +   ++P   S N++G   +I +  +++ Q   +  
Sbjct: 266 SKSSAGTLPVTMRTAEKNLNISPEVSRSILPFCTSINMNGCAAFICITLIYVMQNNGIEA 325

Query: 334 SLTDQ-LSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIAGMTLILGVDRFMSECR 392
           + +   L +L+ +++S+ G AGV    F  L+A++     +PI  M++IL     +    
Sbjct: 326 TFSTLFLWILMASVISAIGTAGVPMGCFF-LSASLLTNMGIPINIMSMILPFYSIVDMFE 384

Query: 393 SVTNFIGNAVMTVVVSR-WEKKLD 415
           +  N   ++ +TV+V++ + K  D
Sbjct: 385 TTLNVWSDSCVTVIVNKSYPKSSD 408

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target426 C4-dicarboxylate transporter DctA [Candidatus Liberibac
315122200426 C4-dicarboxylate transporter DctA [Candidatus Liberibac 1 0.0
183598133449 hypothetical protein PROSTU_01499 [Providencia stuartii 1 1e-141
150376320454 C4-dicarboxylate transporter DctA [Sinorhizobium medica 1 1e-141
227820414442 C4-dicarboxylate transporter DctA [Sinorhizobium fredii 1 1e-141
153010801444 C4-dicarboxylate transporter DctA [Ochrobactrum anthrop 1 1e-140
239833782461 C4-dicarboxylate transport protein [Ochrobactrum interm 1 1e-140
332716088448 C4-dicarboxylate transport protein [Agrobacterium sp. H 1 1e-140
218674572444 C4-dicarboxylate transporter DctA [Rhizobium etli GR56] 1 1e-140
15891635448 C4-dicarboxylate transporter DctA [Agrobacterium tumefa 1 1e-140
261343531448 aerobic C4-dicarboxylate transport protein [Providencia 1 1e-140
>gi|315122200|ref|YP_004062689.1| C4-dicarboxylate transporter DctA [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 426 Back     alignment and organism information
 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/425 (81%), Positives = 388/425 (91%), Gaps = 2/425 (0%)

Query: 4   SVQVHGDIRPP-LYKILYIQVLVAIFSGMALGHFVPQIGVQMQPLGDIFVKTTKMLITPV 62
           +++V+ D +PP LYK LYIQVLVAI  G+ALGHF PQIGVQMQPLG+IF+K TKMLITP+
Sbjct: 2   NIKVYEDRQPPPLYKRLYIQVLVAISIGIALGHFFPQIGVQMQPLGEIFIKITKMLITPI 61

Query: 63  IFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL 122
           IFLTVSTG+ARM DMKVIG+IFWK+M LF +FS+ ALVIGL+VGNIA PG+GMNVDLKSL
Sbjct: 62  IFLTVSTGMARMTDMKVIGRIFWKSMVLFTIFSLLALVIGLVVGNIAGPGVGMNVDLKSL 121

Query: 123 NTESIAH-IKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSD 181
           N   I+  I SSH+KSF+ F++DMIP TALSALTSGNILQTL+VALLFGISLSLVG+KS 
Sbjct: 122 NQTGISMPIGSSHSKSFVHFLEDMIPHTALSALTSGNILQTLVVALLFGISLSLVGKKSS 181

Query: 182 TIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAF 241
           TI KCLEEINFPVF+MVSIVMR AP+GAFGAMSFTIGKYGLSS+ NLIFLV CLY TSAF
Sbjct: 182 TITKCLEEINFPVFKMVSIVMRAAPVGAFGAMSFTIGKYGLSSVYNLIFLVACLYMTSAF 241

Query: 242 FILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSM 301
           FIL +LG LARF +FS+IKLI+FLKEE+LLVLSTSSSESALPGLMKKMEEAGC RSIVSM
Sbjct: 242 FILVILGSLARFFKFSVIKLILFLKEEILLVLSTSSSESALPGLMKKMEEAGCDRSIVSM 301

Query: 302 VVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFI 361
           VVPTGYSFNLDGSNIY+TLATLFI+QATN+P+SL +Q+SL+LIAMVSSKGAAGVTGSAFI
Sbjct: 302 VVPTGYSFNLDGSNIYMTLATLFIAQATNIPMSLEEQISLVLIAMVSSKGAAGVTGSAFI 361

Query: 362 TLAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPKLFNK 421
           TLAATI+L PSLPIAGMTLILGVDRFMSECRSVTNFIGNA+MTVVVS+WE KLD K F K
Sbjct: 362 TLAATISLFPSLPIAGMTLILGVDRFMSECRSVTNFIGNAIMTVVVSKWENKLDQKEFKK 421

Query: 422 YIGIE 426
           +IGIE
Sbjct: 422 HIGIE 426


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|183598133|ref|ZP_02959626.1| hypothetical protein PROSTU_01499 [Providencia stuartii ATCC 25827] Length = 449 Back     alignment and organism information
>gi|150376320|ref|YP_001312916.1| C4-dicarboxylate transporter DctA [Sinorhizobium medicae WSM419] Length = 454 Back     alignment and organism information
>gi|227820414|ref|YP_002824385.1| C4-dicarboxylate transporter DctA [Sinorhizobium fredii NGR234] Length = 442 Back     alignment and organism information
>gi|153010801|ref|YP_001372015.1| C4-dicarboxylate transporter DctA [Ochrobactrum anthropi ATCC 49188] Length = 444 Back     alignment and organism information
>gi|239833782|ref|ZP_04682110.1| C4-dicarboxylate transport protein [Ochrobactrum intermedium LMG 3301] Length = 461 Back     alignment and organism information
>gi|332716088|ref|YP_004443554.1| C4-dicarboxylate transport protein [Agrobacterium sp. H13-3] Length = 448 Back     alignment and organism information
>gi|218674572|ref|ZP_03524241.1| C4-dicarboxylate transporter DctA [Rhizobium etli GR56] Length = 444 Back     alignment and organism information
>gi|15891635|ref|NP_357307.1| C4-dicarboxylate transporter DctA [Agrobacterium tumefaciens str. C58] Length = 448 Back     alignment and organism information
>gi|261343531|ref|ZP_05971176.1| aerobic C4-dicarboxylate transport protein [Providencia rustigianii DSM 4541] Length = 448 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target426 C4-dicarboxylate transporter DctA [Candidatus Liberibac
PRK01663428 PRK01663, PRK01663, C4-dicarboxylate transporter DctA; 1e-155
PRK13027421 PRK13027, PRK13027, C4-dicarboxylate transporter DctA; 1e-129
pfam00375387 pfam00375, SDF, Sodium:dicarboxylate symporter family 2e-81
PRK11283437 PRK11283, gltP, glutamate/aspartate:proton symporter; P 2e-73
KOG3787507 KOG3787, KOG3787, KOG3787, Glutamate/aspartate and neut 7e-30
COG1301415 COG1301, GltP, Na+/H+-dicarboxylate symporters [Energy 3e-89
COG3633407 COG3633, SstT, Na+/serine symporter [Amino acid transpo 2e-20
PRK13628402 PRK13628, PRK13628, serine/threonine transporter SstT; 4e-13
COG1823458 COG1823, COG1823, Predicted Na+/dicarboxylate symporter 2e-18
PRK14695319 PRK14695, PRK14695, serine/threonine transporter SstT; 3e-11
>gnl|CDD|179317 PRK01663, PRK01663, C4-dicarboxylate transporter DctA; Reviewed Back     alignment and domain information
>gnl|CDD|183850 PRK13027, PRK13027, C4-dicarboxylate transporter DctA; Reviewed Back     alignment and domain information
>gnl|CDD|144095 pfam00375, SDF, Sodium:dicarboxylate symporter family Back     alignment and domain information
>gnl|CDD|183075 PRK11283, gltP, glutamate/aspartate:proton symporter; Provisional Back     alignment and domain information
>gnl|CDD|38991 KOG3787, KOG3787, KOG3787, Glutamate/aspartate and neutral amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31492 COG1301, GltP, Na+/H+-dicarboxylate symporters [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|33431 COG3633, SstT, Na+/serine symporter [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184190 PRK13628, PRK13628, serine/threonine transporter SstT; Provisional Back     alignment and domain information
>gnl|CDD|32008 COG1823, COG1823, Predicted Na+/dicarboxylate symporter [General function prediction only] Back     alignment and domain information
>gnl|CDD|173158 PRK14695, PRK14695, serine/threonine transporter SstT; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 426 C4-dicarboxylate transporter DctA [Candidatus Liberibac
PRK01663428 C4-dicarboxylate transporter DctA; Reviewed 100.0
PRK13027442 C4-dicarboxylate transporter DctA; Reviewed 100.0
PRK11283436 gltP glutamate/aspartate:proton symporter; Provisional 100.0
COG1301415 GltP Na+/H+-dicarboxylate symporters [Energy production 100.0
pfam00375387 SDF Sodium:dicarboxylate symporter family. 100.0
PRK13628402 serine/threonine transporter SstT; Provisional 100.0
KOG3787507 consensus 100.0
COG1823458 Predicted Na+/dicarboxylate symporter [General function 100.0
COG3633407 SstT Na+/serine symporter [Amino acid transport and met 100.0
PRK01663428 C4-dicarboxylate transporter DctA; Reviewed 95.43
TIGR00832375 acr3 arsenical-resistance protein; InterPro: IPR004706 93.62
>PRK01663 C4-dicarboxylate transporter DctA; Reviewed Back     alignment and domain information
>PRK13027 C4-dicarboxylate transporter DctA; Reviewed Back     alignment and domain information
>PRK11283 gltP glutamate/aspartate:proton symporter; Provisional Back     alignment and domain information
>COG1301 GltP Na+/H+-dicarboxylate symporters [Energy production and conversion] Back     alignment and domain information
>pfam00375 SDF Sodium:dicarboxylate symporter family Back     alignment and domain information
>PRK13628 serine/threonine transporter SstT; Provisional Back     alignment and domain information
>KOG3787 consensus Back     alignment and domain information
>COG1823 Predicted Na+/dicarboxylate symporter [General function prediction only] Back     alignment and domain information
>COG3633 SstT Na+/serine symporter [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01663 C4-dicarboxylate transporter DctA; Reviewed Back     alignment and domain information
>TIGR00832 acr3 arsenical-resistance protein; InterPro: IPR004706 The arsenical-resistance protein ACR3 is an integral membrane protein involved in resistance to arsenic compounds Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target426 C4-dicarboxylate transporter DctA [Candidatus Liberibac
1xfh_A422 Structure Of Glutamate Transporter Homolog From Pyr 1e-62
3kbc_A425 Crystal Structure Of Gltph K55c-A364c Mutant Crossl 7e-62
2nwl_A422 Crystal Structure Of Gltph In Complex With L-Asp Le 4e-60
>gi|56554522|pdb|1XFH|A Chain A, Structure Of Glutamate Transporter Homolog From Pyrococcus Horikoshii Length = 422 Back     alignment and structure
 Score =  245 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 108/426 (25%), Positives = 209/426 (49%), Gaps = 28/426 (6%)

Query: 9   GDIRPPLYKILYIQVLVAIFSGMALGHFVPQIG------VQMQPLGDIFVKTTKMLITPV 62
           G  R  +   +  ++L+ +  G  +G  +   G        ++P GD+FV+  KML+ P+
Sbjct: 2   GLYRKYIEYPVLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPI 61

Query: 63  IFLTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSL 122
           +F ++  G A +     +G++  K +  + + S FA+ +G+I+  +  PG G+++ +   
Sbjct: 62  VFASLVVGAASI-SPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGG- 119

Query: 123 NTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS-------- 174
                   +   A   +  + D++P     AL +G +L T+  A++ GI+++        
Sbjct: 120 -----QQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENE 174

Query: 175 LVGEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFC 234
            V + ++T+   +  +   ++++V+ VM+ AP+G F  +++ + + G+  +  L  +   
Sbjct: 175 KVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAA 234

Query: 235 LYATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGC 294
           +Y      IL V  +L +      I  I   K+ +L    T SS   LP  M+  +E G 
Sbjct: 235 VYVGLTLQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGI 294

Query: 295 HRSIVSMVVPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAG 354
              I S  +P G + N+DG+ +Y  + T FI+ A    L++  QL+++L A+++S G AG
Sbjct: 295 SEGIYSFTLPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAG 354

Query: 355 VTGSAFITLAATITLVPSLPI------AGMTLILGVDRFMSECRSVTNFIGNAVMTVVVS 408
           V G+  I LA  +  V  LP+      A   +ILG+D  +   R++ N  G+   T +V+
Sbjct: 355 VPGAGAIMLAMVLHSV-GLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVA 413

Query: 409 RWEKKL 414
           + E  L
Sbjct: 414 KTEGTL 419


>gi|270047765|pdb|3KBC|A Chain A, Crystal Structure Of Gltph K55c-A364c Mutant Crosslinked With Divalent Mercury Length = 425 Back     alignment and structure
>gi|134104970|pdb|2NWL|A Chain A, Crystal Structure Of Gltph In Complex With L-Asp Length = 422 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target426 C4-dicarboxylate transporter DctA [Candidatus Liberibac
2nwl_A422 GLTPH, glutamate symport protein; alpha helical, membra 3e-52
>2nwl_A GLTPH, glutamate symport protein; alpha helical, membrane protein, helical hairpin, unwound region, transport protein; HET: PLM; 2.96A {Pyrococcus horikoshii} PDB: 2nww_A* 1xfh_A* 2nwx_A* Length = 422 Back     alignment and structure
 Score =  201 bits (511), Expect = 3e-52
 Identities = 104/418 (24%), Positives = 206/418 (49%), Gaps = 26/418 (6%)

Query: 19  LYIQVLVAIFSGMALGHFVPQ------IGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
           + I++L+ +  G  +G  +        +   ++P GD+FV+  KML+ P++F ++  G A
Sbjct: 12  VLIKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAA 71

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            +   ++ G++  K +  + + S FA+ +G+I+  +  PG G+++             + 
Sbjct: 72  SISPARL-GRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLA------VGGQQFQP 124

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVG--------EKSDTIR 184
             A   +  + D++P     AL +G +L T+  A++ GI+++ +         + ++T+ 
Sbjct: 125 HQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLL 184

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
             +  +   ++++V+ VM+ AP+G F  +++ + + G+  +  L  +   +Y      IL
Sbjct: 185 DAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQIL 244

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
            V  +L +      I  I   K+ +L    T SS   LP  M+  +E G    I S  +P
Sbjct: 245 LVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLP 304

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
            G + N+DG+ +Y  + T FI+ A    L++  QL+++L A+++S G AGV G+  I LA
Sbjct: 305 LGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLA 364

Query: 365 ATITLV-----PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPK 417
             +  V          A   +ILG+D  +   R++ N  G+   T +V++ E  L P+
Sbjct: 365 MVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTEGTLVPR 422


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target426 C4-dicarboxylate transporter DctA [Candidatus Liberibac
2nwl_A422 GLTPH, glutamate symport protein; alpha helical, membra 100.0
>2nwl_A GLTPH, glutamate symport protein; alpha helical, membrane protein, helical hairpin, unwound region, transport protein; HET: PLM; 2.96A {Pyrococcus horikoshii} PDB: 2nww_A* 1xfh_A* 2nwx_A* 3kbc_A Back     alignment and structure
Probab=100.00  E-value=0  Score=665.51  Aligned_cols=400  Identities=27%  Similarity=0.525  Sum_probs=371.4

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             026358999999999999999999999577------89998766699999999999999999999996134302467779
Q gi|254780387|r   10 DIRPPLYKILYIQVLVAIFSGMALGHFVPQ------IGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQI   83 (426)
Q Consensus        10 ~~~~~~~~~L~~~ilig~v~Gi~~G~~~~~------~~~~l~~~G~lfi~lLkm~viPLVf~sIi~gIa~l~~~~~~gki   83 (426)
                      +.||....++..|+++|+++|+++|.++++      ...|++++||+|+|++||+++|+||+|++.|++++++ ++.||+
T Consensus         3 ~~~k~~~~~l~~~ilia~v~Gi~~G~~~~~~~~~~~~~~~l~~~G~lFi~lLkm~vvPlI~~sii~~i~~l~~-~~~gri   81 (422)
T 2nwl_A            3 LYRKYIEYPVLIKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISP-ARLGRV   81 (422)
T ss_dssp             -------CCCTTHHHHHHHHHHHHHHHHHHTTTHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTT-TTHHHH
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-HHCCCH
T ss_conf             8887522779999999999999999996542212789999999999999999999999999999999975340-100107


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCHHHHHHHCCCHHHH
Q ss_conf             99999999999999999999998773024687854344211111001333443089999988520547863215705799
Q gi|254780387|r   84 FWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTL  163 (426)
Q Consensus        84 ~~kti~~~l~tt~iA~~igl~~~~~~~PG~g~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~liP~Nif~a~a~gniL~ii  163 (426)
                      +.|++.||+.++.+|+.+|+.++++++||.+.+.+...      +..+..+.+++.|++.+++|+|+|+++++||++|++
T Consensus        82 ~~k~i~~~~~tt~~a~~lgl~~~~~~~pg~~~~~~~~~------~~~~~~~~~~~~~~~~~~ip~Ni~~a~~~~~~l~vi  155 (422)
T 2nwl_A           82 GVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGG------QQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTI  155 (422)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHSCCCCSCCCCCCC------CCC-----CCTHHHHGGGSCSCHHHHHHTCCHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCH------HHCCCCCCCCHHHHHHHHCCCCHHHHHHCCCCCHHH
T ss_conf             99999999999999999999999843877540012104------430553477499999983889779996458863036


Q ss_pred             HHHHHHHHHHHCCC--------CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             99999999952156--------4302489899999999999999865453337889999998510740024689999999
Q gi|254780387|r  164 IVALLFGISLSLVG--------EKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCL  235 (426)
Q Consensus       164 vfai~~GiA~~~~~--------~k~~~l~~~~~~~~~v~~kii~~vi~laPigvf~lia~~~a~~g~~~l~~l~~~v~~~  235 (426)
                      +||+++|+|+.+.+        |+.+++.+++++++++++|+++|+|+++|+|+|+++|++.+++|.+.+.++++++.++
T Consensus       156 ~fai~~Gia~~~~~~~~~~~~~~~~~~l~~~~~~~~~v~~~iv~~i~~l~Pigvf~l~a~~~~~~g~~~l~~l~~~~~~~  235 (422)
T 2nwl_A          156 FFAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAV  235 (422)
T ss_dssp             HHHHHHHHHHHHHHTCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHTTTGGGCCTHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             89888899999840100366678889999999999999999999999886999999999987302346788899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHH
Q ss_conf             99998877999999996328660344320001467776421431007999999984489975844676777753375215
Q gi|254780387|r  236 YATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSN  315 (426)
Q Consensus       236 ~~~~~~~~~~~~~l~~~~~~~~p~~~~~~~~~~~~~Af~T~SS~AtlP~~l~~~e~~gv~~~i~~fviPlG~tinm~G~a  315 (426)
                      ++++.++.++.++++.+++|+||++++|+++|++++||+|+||+||+|+++||+||+|+||++++|++|+|+|+||||+|
T Consensus       236 ~~~~~l~~~~~~~l~~~~~~~~p~~~~~~~~~~~~~Af~T~SS~atlP~~l~~~~~~gv~~~i~~fvlPlg~t~n~~G~a  315 (422)
T 2nwl_A          236 YVGLTLQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTA  315 (422)
T ss_dssp             HHHHHHHHHHTHHHHHHHTTCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTSCCHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHCCEECCCHHHCCCCCHH
T ss_conf             99999999999999999958888988989999999999715632145799999998597833345315631102688458


Q ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCH------HHHHHHHHHHHHHH
Q ss_conf             899999999998509879989999999999999621368432589999999986159989------99999997777643
Q gi|254780387|r  316 IYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPI------AGMTLILGVDRFMS  389 (426)
Q Consensus       316 ~~~~~~~iFia~~~gi~l~~~~~~~~~~~~~i~s~g~agvPg~~~v~~~~~~~~~~glP~------~~i~ll~~id~~~D  389 (426)
                      +|++++++|++|.||+++++++++.++++++++|+|+||+||++++.+..++... |+|.      +++++++++||++|
T Consensus       316 l~~~~~~if~a~~~g~~lt~~~~~~~~~~~~l~s~g~~gvPg~~~v~~~~vl~~~-glP~~~~~~~~~i~liiaid~l~D  394 (422)
T 2nwl_A          316 LYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLAMVLHSV-GLPLTDPNVAAAYAMILGIDAILD  394 (422)
T ss_dssp             HHHHHHHHHHHHHHTCCCCSSCCHHHHHHHHHHHHHSCSSSSHHHHHHHHHHHHH-TCCTTSTTHHHHHHHHHTTHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHC-CCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             9999999999999489999899999999999999844786167999999999984-998764115668999997986606


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             5678998767799999999882510489
Q gi|254780387|r  390 ECRSVTNFIGNAVMTVVVSRWEKKLDPK  417 (426)
Q Consensus       390 ~~rT~~NV~gd~~~a~iv~~~~~~~d~~  417 (426)
                      |+||++||+||++++++++|+||++|+.
T Consensus       395 ~~rT~~NV~gd~~~a~iv~k~~g~ld~~  422 (422)
T 2nwl_A          395 MGRTMVNVTGDLTGTAIVAKTEGTLVPR  422 (422)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHC------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             6189994987899999999973888899




Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 426 C4-dicarboxylate transporter DctA [Candidatus Liberibac
d2nwwa1405 f.49.1.1 (A:12-416) Proton glutamate symport protein {P 4e-48
>d2nwwa1 f.49.1.1 (A:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]} Length = 405 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Proton glutamate symport protein
superfamily: Proton glutamate symport protein
family: Proton glutamate symport protein
domain: Proton glutamate symport protein
species: Pyrococcus horikoshii [TaxId: 53953]
 Score =  186 bits (472), Expect = 4e-48
 Identities = 101/412 (24%), Positives = 201/412 (48%), Gaps = 26/412 (6%)

Query: 19  LYIQVLVAIFSGMALGHFVPQ------IGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIA 72
           +  ++L+ +  G  +G  +        +   ++P GD+FV+  KML+ P++F ++  G A
Sbjct: 1   VLQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAA 60

Query: 73  RMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKS 132
            +   ++ G++  K +  + + S FA+ +G+I+  +  PG G+++             + 
Sbjct: 61  SISPARL-GRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLA------VGGQQFQP 113

Query: 133 SHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGE--------KSDTIR 184
             A   +  + D++P     AL +G +L T+  A++ GI+++ +           ++T+ 
Sbjct: 114 HQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAETLL 173

Query: 185 KCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFIL 244
             +  +   ++++V+ VM+ AP+G F  +++ + + G+  +  L  +   +Y      IL
Sbjct: 174 DAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQIL 233

Query: 245 GVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVP 304
            V  +L +      I  I   K+ +L    T SS   LP  M+  +E G    I S  +P
Sbjct: 234 LVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLP 293

Query: 305 TGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLA 364
            G + N+DG+ +Y  + T FI+ A    L++  QL+++L A+++S G AGV G+  I LA
Sbjct: 294 LGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLA 353

Query: 365 ATITLV-----PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWE 411
             +  V          A   +ILG+D  +   R++ N  G+   T +V++ E
Sbjct: 354 MVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTE 405


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target426 C4-dicarboxylate transporter DctA [Candidatus Liberibac
d2nwwa1405 Proton glutamate symport protein {Pyrococcus horikoshii 100.0
>d2nwwa1 f.49.1.1 (A:12-416) Proton glutamate symport protein {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Proton glutamate symport protein
superfamily: Proton glutamate symport protein
family: Proton glutamate symport protein
domain: Proton glutamate symport protein
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00  E-value=0  Score=643.32  Aligned_cols=383  Identities=27%  Similarity=0.536  Sum_probs=355.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999995778------999876669999999999999999999999613430246777999999999999
Q gi|254780387|r   21 IQVLVAIFSGMALGHFVPQI------GVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIFWKAMFLFFVF   94 (426)
Q Consensus        21 ~~ilig~v~Gi~~G~~~~~~------~~~l~~~G~lfi~lLkm~viPLVf~sIi~gIa~l~~~~~~gki~~kti~~~l~t   94 (426)
                      .|+++|+++|+++|.++++.      ..|++++||+|+|++||+++|+||+|++.|++++++ ++.||++.|++.||+.+
T Consensus         3 ~rili~lv~Gi~~G~~~~~~~~~~~~~~~l~~~g~lFi~lL~m~v~PLIf~sii~gi~~L~~-~~~gkl~~~ti~~~l~t   81 (405)
T d2nwwa1           3 QKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASISP-ARLGRVGVKIVVYYLLT   81 (405)
T ss_dssp             SHHHHHHHHHHHHHHHHHTTTTHHHHTTTTHHHHHHHHHHHHHHHHHHHHHHHHTTTCSCTT-TTHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-HHCCHHHHHHHHHHHHH
T ss_conf             89999999999999997222212789999998999999999999999999999999974550-10020899999999999


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCHHHHHHHCCCHHHHHHHHHHHHHHH
Q ss_conf             99999999999877302468785434421111100133344308999998852054786321570579999999999952
Q gi|254780387|r   95 SMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLS  174 (426)
Q Consensus        95 t~iA~~igl~~~~~~~PG~g~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~liP~Nif~a~a~gniL~iivfai~~GiA~~  174 (426)
                      |.+|+.+|+.+++.++||.+.+.+...      .+.+..+..+..+++.+++|+|+|++++++|++|+++||+++|+|+.
T Consensus        82 t~iA~~igl~~~~~~~pg~~~~~~~~~------~~~~~~~~~~~~~~l~~~iP~Ni~~al~~~~~l~vi~fail~Gial~  155 (405)
T d2nwwa1          82 SAFAVTLGIIMARLFNPGAGIHLAVGG------QQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAIT  155 (405)
T ss_dssp             HHHHHHHHHHHHHHSCSCCCCCCCCCC------CCCCCCCCCCHHHHHGGGSCSCHHHHHHSCCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCHHHH------CCCCCCCCCHHHHHHHHHCCCCHHHHHHCCCCCCHHHHHHHHHHHHH
T ss_conf             999999999999986013332200000------00143110018999997055878999646786303567888899999


Q ss_pred             CCCC--------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1564--------30248989999999999999986545333788999999851074002468999999999998877999
Q gi|254780387|r  175 LVGE--------KSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFFILGV  246 (426)
Q Consensus       175 ~~~~--------k~~~l~~~~~~~~~v~~kii~~vi~laPigvf~lia~~~a~~g~~~l~~l~~~v~~~~~~~~~~~~~~  246 (426)
                      ..++        +.+++.+++|+++++++|+++|+|+++|+|+||++++.++++|.+.+.++++|+.++|.+..++.++.
T Consensus       156 ~~~~~~~~~~~~~~~~l~~~~~~l~~v~~kii~~im~laPigvf~l~a~~~~~~g~~~l~~l~~~~~~~~~~~~l~~~~~  235 (405)
T d2nwwa1         156 YLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQILLV  235 (405)
T ss_dssp             HHTTCSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHHHTGGGCCTHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             85022003456678899999999999999998988877788899999987533345555678999999999999998888


Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             99999632866034432000146777642143100799999998448997584467677775337521589999999999
Q gi|254780387|r  247 LGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNIYITLATLFIS  326 (426)
Q Consensus       247 ~~l~~~~~~~~p~~~~~~~~~~~~~Af~T~SS~AtlP~~l~~~e~~gv~~~i~~fviPlG~tinm~G~a~~~~~~~iFia  326 (426)
                      ++++.+++|+||++++|+++|++++||+|+||+||+|+++||+||+|+||++++|++|+|+|+||||+|+|++++++|++
T Consensus       236 ~~i~~~~~~~~p~~~~~~~~~~~~~Af~T~SS~atlP~~~~~~~~~gv~~~i~~fvlPlgatin~~G~a~~~~~~~~f~a  315 (405)
T d2nwwa1         236 YFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTALYQGVCTFFIA  315 (405)
T ss_dssp             HHHHHHTTTCCHHHHHHHHHHHHHHHHHHCCTGGGHHHHHHHHHTTTCCTTTHHHHTTTTSSSCCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCCHHHHHHHCCCHHHEEEECCCCCCCCHHHHHHHHHCCCCCCCCCEECCCCHHEECCCCHHHHHHHHHHHH
T ss_conf             89999982898488843223104212001665566178999999759993520102363021003641248999999999


Q ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCH------HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             8509879989999999999999621368432589999999986159989------9999999777764356789987677
Q gi|254780387|r  327 QATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPI------AGMTLILGVDRFMSECRSVTNFIGN  400 (426)
Q Consensus       327 ~~~gi~l~~~~~~~~~~~~~i~s~g~agvPg~~~v~~~~~~~~~~glP~------~~i~ll~~id~~~D~~rT~~NV~gd  400 (426)
                      |.||++++++|++.++++++++|+|++|+||+|++++..++... |+|.      |++++++++||++||+||++||+||
T Consensus       316 ~~~g~~l~~~~~~~~~~~~~l~s~g~~gvPg~~~v~~~~vl~~~-glP~~~~~~~~~i~li~~id~l~D~~rT~~Nv~gd  394 (405)
T d2nwwa1         316 NALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLAMVLHSV-GLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGD  394 (405)
T ss_dssp             HHHTCCCCSSTTHHHHHHHHHHHHTTSSCTTHHHHHHHHHHHHH-TCCTTSHHHHHHHHHHGGGHHHHHHHHHHHHHHHH
T ss_pred             HHCCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHC-CCCCCCCHHHHHHHHHHHHHHHCCHHHHHHHHHHH
T ss_conf             87197999899999999999999861786167999999999986-99886410565888887498550550898828776


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999999882
Q gi|254780387|r  401 AVMTVVVSRWE  411 (426)
Q Consensus       401 ~~~a~iv~~~~  411 (426)
                      ++++++|+|||
T Consensus       395 ~~~a~iv~k~e  405 (405)
T d2nwwa1         395 LTGTAIVAKTE  405 (405)
T ss_dssp             HHHHHHHHHHC
T ss_pred             HHHHHEEECCC
T ss_conf             58884133579



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 426 C4-dicarboxylate transporter DctA [Candidatus Libe
2nwl_A_422 (A:) GLTPH, glutamate symport protein; alpha helic 4e-52
>2nwl_A (A:) GLTPH, glutamate symport protein; alpha helical, membrane protein, helical hairpin, unwound region, transport protein; HET: PLM; 2.96A {Pyrococcus horikoshii} PDB: 2nww_A* 1xfh_A* 2nwx_A*Length = 422 Back     alignment and structure
 Score =  200 bits (508), Expect = 4e-52
 Identities = 98/420 (23%), Positives = 195/420 (46%), Gaps = 14/420 (3%)

Query: 11  IRPPLYKILYIQVLVAIFSGMALGHFVPQIGVQ------MQPLGDIFVKTTKMLITPVIF 64
            R  +   + I++L+ +  G  +G  +   G        ++P GD+FV+  KML+ P++F
Sbjct: 4   YRKYIEYPVLIKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVF 63

Query: 65  LTVSTGIARMKDMKVIGQIFWKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNT 124
            ++  G A +   ++ G++  K +  + + S FA+ +G+I+  +  PG G+++ +     
Sbjct: 64  ASLVVGAASISPARL-GRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGGQQF 122

Query: 125 ESIA--HIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLIVALLFGISLSLVGEKSDT 182
           +      +               + +  +       I+  + +  L       V + ++T
Sbjct: 123 QPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILGIAITYLMNSENEKVRKSAET 182

Query: 183 IRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLYATSAFF 242
           +   +  +   ++++V+ VM+ AP+G F  +++ + + G+  +  L  +   +Y      
Sbjct: 183 LLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVYVGLTLQ 242

Query: 243 ILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMV 302
           IL V  +L +      I  I   K+ +L    T SS   LP  M+  +E G    I S  
Sbjct: 243 ILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFT 302

Query: 303 VPTGYSFNLDGSNIYITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFIT 362
           +P G + N+DG+ +Y  + T FI+ A    L++  QL+++L A+++S G AGV G+  I 
Sbjct: 303 LPLGATINMDGTALYQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIM 362

Query: 363 LAATITLV-----PSLPIAGMTLILGVDRFMSECRSVTNFIGNAVMTVVVSRWEKKLDPK 417
           LA  +  V          A   +ILG+D  +   R++ N  G+   T +V++ E  L P+
Sbjct: 363 LAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIVAKTEGTLVPR 422


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target426 C4-dicarboxylate transporter DctA [Candidatus Liberibac
2nwl_A_422 GLTPH, glutamate symport protein; alpha helical, m 100.0
2nwl_A_422 GLTPH, glutamate symport protein; alpha helical, m 98.03
>2nwl_A (A:) GLTPH, glutamate symport protein; alpha helical, membrane protein, helical hairpin, unwound region, transport protein; HET: PLM; 2.96A {Pyrococcus horikoshii} PDB: 2nww_A* 1xfh_A* 2nwx_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=633.43  Aligned_cols=399  Identities=27%  Similarity=0.529  Sum_probs=371.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHH
Q ss_conf             26358999999999999999999999577------899987666999999999999999999999961343024677799
Q gi|254780387|r   11 IRPPLYKILYIQVLVAIFSGMALGHFVPQ------IGVQMQPLGDIFVKTTKMLITPVIFLTVSTGIARMKDMKVIGQIF   84 (426)
Q Consensus        11 ~~~~~~~~L~~~ilig~v~Gi~~G~~~~~------~~~~l~~~G~lfi~lLkm~viPLVf~sIi~gIa~l~~~~~~gki~   84 (426)
                      .|++...++..|+++|+++|+++|.++++      +..|++++||+|+|++||+++|+||+|++.|+++++ .++.||++
T Consensus         4 ~~~~~k~sl~~~ilialilGi~lG~~~~~~~~~~~~~~~l~~~G~lfi~lLkm~V~PlVf~sii~~I~~L~-~~~~g~l~   82 (422)
T 2nwl_A            4 YRKYIEYPVLIKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIVFASLVVGAASIS-PARLGRVG   82 (422)
T ss_dssp             ------CCCTTHHHHHHHHHHHHHHHHHHTTTHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCT-TTTHHHHH
T ss_pred             HHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCCCHH
T ss_conf             88862266999999999999999999543220278999999999999999999999999999999997455-11012279


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCHHHHHHHCCCHHHHH
Q ss_conf             99999999999999999999987730246878543442111110013334430899999885205478632157057999
Q gi|254780387|r   85 WKAMFLFFVFSMFALVIGLIVGNIAKPGIGMNVDLKSLNTESIAHIKSSHAKSFIGFMQDMIPDTALSALTSGNILQTLI  164 (426)
Q Consensus        85 ~kti~~~l~tt~iA~~igl~~~~~~~PG~g~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~liP~Nif~a~a~gniL~iiv  164 (426)
                      .|++.||+.++.+|+.+|+.++.+++||.+.+.+...      .+....+..+..+.+.+++|+|+++++.++|.+++++
T Consensus        83 ~~~~~~f~~~t~~A~~ig~~~~~~~~pg~~~~~~~~~------~~~~~~~~~~~~~~~~~~ip~ni~~~~~~~~~~~~~~  156 (422)
T 2nwl_A           83 VKIVVYYLLTSAFAVTLGIIMARLFNPGAGIHLAVGG------QQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIF  156 (422)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHSCCCCSCCCCCCC------CCC-----CCTHHHHGGGSCSCHHHHHHTCCHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHH------HHCCCCCCHHHHHHHHHHCCCCHHHHHHCCCCCCHHH
T ss_conf             9999999999999999999999876013332200103------3204321026999999825521798874577430367


Q ss_pred             HHHHHHHHHHCC--------CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             999999995215--------643024898999999999999998654533378899999985107400246899999999
Q gi|254780387|r  165 VALLFGISLSLV--------GEKSDTIRKCLEEINFPVFRMVSIVMRIAPLGAFGAMSFTIGKYGLSSISNLIFLVFCLY  236 (426)
Q Consensus       165 fai~~GiA~~~~--------~~k~~~l~~~~~~~~~v~~kii~~vi~laPigvf~lia~~~a~~g~~~l~~l~~~v~~~~  236 (426)
                      +++++|+++...        +||++++.+++++++++++|+++|+|+++|+|+||+++++.+++|.+.+.++++++.++|
T Consensus       157 ~ail~gi~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~ii~~ii~l~P~gvf~lia~~~~~~g~~~l~~l~~~~~~~~  236 (422)
T 2nwl_A          157 FAIILGIAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFALIAYVMAEQGVHVVGELAKVTAAVY  236 (422)
T ss_dssp             HHHHHHHHHHHHHTCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHTTTGGGCCTHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH
T ss_conf             88888999998402210345667889999999999999756887776789999999999874135577888899999999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHH
Q ss_conf             99988779999999963286603443200014677764214310079999999844899758446767777533752158
Q gi|254780387|r  237 ATSAFFILGVLGILARFCRFSIIKLIIFLKEEVLLVLSTSSSESALPGLMKKMEEAGCHRSIVSMVVPTGYSFNLDGSNI  316 (426)
Q Consensus       237 ~~~~~~~~~~~~l~~~~~~~~p~~~~~~~~~~~~~Af~T~SS~AtlP~~l~~~e~~gv~~~i~~fviPlG~tinm~G~a~  316 (426)
                      .++.++.+++++++.+++|+||++++|+.+|++++||+|+||+||+|+++||+||+|+||++++|++|+|+|+||||+++
T Consensus       237 ~~~~i~~~v~~~~~~~~~~~np~~~~~~~~~~~~~af~T~SS~atlP~~~~~~~k~gv~~~v~~~v~Plg~~~n~~G~a~  316 (422)
T 2nwl_A          237 VGLTLQILLVYFVLLKIYGIDPISFIKHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYSFTLPLGATINMDGTAL  316 (422)
T ss_dssp             HHHHHHHHHTHHHHHHHTTCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTSCCHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCHHHEEEECCCCCCCHHHHHHHHHHCCCCCCCCCEECCCCCEECCCCHHH
T ss_conf             99999999999999998489838886431101430111166655527899999984999240020245200120576047


Q ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCHH------HHHHHHHHHHHHHH
Q ss_conf             999999999985098799899999999999996213684325899999999861599899------99999977776435
Q gi|254780387|r  317 YITLATLFISQATNVPLSLTDQLSLLLIAMVSSKGAAGVTGSAFITLAATITLVPSLPIA------GMTLILGVDRFMSE  390 (426)
Q Consensus       317 ~~~~~~iFia~~~gi~l~~~~~~~~~~~~~i~s~g~agvPg~~~v~~~~~~~~~~glP~~------~i~ll~~id~~~D~  390 (426)
                      |++++++|++|.||+|++++|++.++++++++|+|+||+||++++....++..+ |+|.|      ++++++++||++||
T Consensus       317 ~~~~~~ifia~~~g~~l~~~~~~~~~~~~~l~s~g~~gvPg~~~v~~~~v~~~~-glp~~~~~~~~~i~li~~id~l~D~  395 (422)
T 2nwl_A          317 YQGVCTFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIMLAMVLHSV-GLPLTDPNVAAAYAMILGIDAILDM  395 (422)
T ss_dssp             HHHHHHHHHHHHHTCCCCSSCCHHHHHHHHHHHHHSCSSSSHHHHHHHHHHHHH-TCCTTSTTHHHHHHHHHTTHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHC-CCCCCCCHHHHHHHHHHHHHHHCCH
T ss_conf             899999999987088999899999999999999861785067999999999984-9987641156588888749855166


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             678998767799999999882510489
Q gi|254780387|r  391 CRSVTNFIGNAVMTVVVSRWEKKLDPK  417 (426)
Q Consensus       391 ~rT~~NV~gd~~~a~iv~~~~~~~d~~  417 (426)
                      +||++||+||++++.+++|++|++|+|
T Consensus       396 ~rT~~Nv~g~~~~~~iv~~~~~~~~~e  422 (422)
T 2nwl_A          396 GRTMVNVTGDLTGTAIVAKTEGTLVPR  422 (422)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHC------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             089994887899999999973887899



>2nwl_A (A:) GLTPH, glutamate symport protein; alpha helical, membrane protein, helical hairpin, unwound region, transport protein; HET: PLM; 2.96A {Pyrococcus horikoshii} PDB: 2nww_A* 1xfh_A* 2nwx_A* Back     alignment and structure