254780392

254780392

leucyl aminopeptidase

GeneID in NCBI database:8209377Locus tag:CLIBASIA_01385
Protein GI in NCBI database:254780392Protein Accession:YP_003064805.1
Gene range:-(290859, 292343)Protein Length:494aa
Gene description:leucyl aminopeptidase
COG prediction:[E] Leucyl aminopeptidase
KEGG prediction:leucyl aminopeptidase (EC:3.4.11.1); K01255 leucyl aminopeptidase [EC:3.4.11.1]
SEED prediction:Cytosol aminopeptidase PepA (EC 3.4.11.1)
Pathway involved in KEGG:Glutathione metabolism [PATH:las00480]
Subsystem involved in SEED:Aminopeptidases (EC 3.4.11.-)
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490----
MDIKFSFAKNPSIKQEGLAILLKTSFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHLNILAPVDCVWDRLVVAGIGDPRDANFSWLKAGGSIASYIEEDKNIEIFVDVPEYPITKAEIRDLVLGFMLKTYTFDQYKTKKRESSSPRSKENISVTIVTEMIQQSSQVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKLESLGVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQSWASGFGVRLLDEFVRAFYEK
cccEEcccccccccccccEEEEEEcccccccccccccHHHHHHHHHHHccccccccEEEEEccccccccEEEEEEcccHHHccHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHccccccHHcccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHcccEEEEEEHHHHHHccccEEEHHHcccccccEEEEEEEcccccccccEEEEEEEEEEcccccccccccHHHHHHccccHHHHHHHHHHHHHHcccccEEEEEEEEEEcccccccccccEEEEccccEEEEEEcccccHHHHHHHHHHHHHccccccEEEEEcHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHcc
ccEEEEcccccccccccEEEEEEccccHHHHHHHHccccHHHHHHHccccccccccEEEEcccccccccEEEEEEccccHHccHHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHHHHHcccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccEEEEccHHHHHHcccccEEEEEccccccEEEEEEEEcccccccccEEEEEcEEEEEcccccccccccHHHHHHccHHHHHHHHHHHHHHHcccccEEEEEEEEEEEccccccccccEEEEcccccEEEEccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccEEEccccHHHHHHHccccccEEcccccccHHHHHHHHHHccccccEEEEEEcccccEEcccccccccEEccccHHHHHHHHHHHHcc
mdikfsfaknpsikQEGLAILLKTsfsdvaglsligspsiVMRAVSVKNFigeskshlnilapvdCVWDRLVvagigdprdanfswlkaggsiasyieedknieifvdvpeypitkAEIRDLVLGFMLKtytfdqyktkkresssprskeniSVTIVTEMIQQSSQVVADIQSVVKGVNLARDIinepanvlgtdeFCKQVRKLESLGVAVEILDKEAMHKLGMNALLAVaqgssrppylavmkweggdseeqplafigkgvvfdtggisikpshgmeemkgdLGGAAAVTGLLHVLAERKAKINAIGVLALVenmpgssaqrpgdivrsmsgQTIEVINTDAEGRLILADALWYCRthynphlmIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLWRMPMNEEYNKLIESKFAdmkniggrgaGSIVAAQFLEKFVQDASWAHIDIagvatggypkeinqswasgfGVRLLDEFVRAFYEK
mdikfsfaknpsikQEGLAILLKTSFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHLNILAPVDCVWDRLVVAGIGDPRDANFSWLKAGGSIASYIEEDKNIEIFVDVPEYPITKAEIRDLVLGFMLKTytfdqyktkkresssprskenISVTIVTEMIQQSSQVVADIQSVVKGVNLARDIINepanvlgtdeFCKQVRKLESLGVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQSWASGFGVRLLDEFVRAFYEK
MDIKFSFAKNPSIKQEGLAILLKTSFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHLNILAPVDCVWDRLVVAGIGDPRDANFSWLKAGGSIASYIEEDKNIEIFVDVPEYPITKAEIRDLVLGFMLKTYTFDQYktkkresssprskeNISVTIVTEMIQQSSQVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKLESLGVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQllssglstgellWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQSWASGFGVRLLDEFVRAFYEK
*DIKFS*AKNPSIKQEGLAILLKTSFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHLNILAPVDCVWDRLVVAGIGDPRDANFSWLKAGGSIASYIEEDKNIEIFVDVPEYPITKAEIRDLVLGFMLKTYTFDQ****************ISVTIVTEMIQQSSQVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKLESLGVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQSWASGFGVRLLDEFVRAFY**
MDIKFSFAKNPSIKQEGLAILLKTSFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHLNILAPVDCVWDRLVVAGIGDPRDANFSWLKAGGSIASYIEEDKNIEIFVDVPEYPITKAEIRDLVLGFMLKTYTFDQ***************NISVTIVTEMIQQSSQVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKLESLGVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQSWASGFGVRLLDEFVRAFYEK
*DI**SFAKNPSIKQEGLAILLKTSFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHLNILAPVDCVWDRLVVAGIGDPRDANFSWLKAGGSIASYIEEDKNIEIFVDVPEYPITKAEIRDLVLGFMLKTYTFDQYKTKKRESSSPRSKENISVTIVTEMIQQSSQVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKLESLGVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQSWASGFGVRLLDEFVRAFYEK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIKFSFAKNPSIKQEGLAILLKTSFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHLNILAPVDCVWDRLVVAGIGDPRDANFSWLKAGGSIASYIEEDKNIEIFVDVPEYPITKAEIRDLVLGFMLKTYTFDQYKTKKRESSSPRSKENISVTIVTEMIQQSSQVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKLESLGVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQSWASGFGVRLLDEFVRAFYEK
MDIKFSFAKNPSIKQEGLAILLKTSFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHLNILAPVDCVWDRLVVAGIGDPRDANFSWLKAGGSIASYIEEDKNIEIFVDVPEYPITKAEIRDLVLGFMLKTYTFDQYKTKKRESSSPRSKENISVTIVTEMIQQSSQVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKLESLGVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQSWASGFGVRLLDEFVRAFYEK
MDIKFSFAKNPSIKQEGLAILLKTSFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHLNILAPVDCVWDRLVVAGIGDPRDANFSWLKAGGSIASYIEEDKNIEIFVDVPEYPITKAEIRDLVLGFMLKTYTFDQYKTKKRESSSPRSKENISVTIVTEMIQQSSQVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKLESLGVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQSWASGFGVRLLDEFVRAFYEK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target494 leucyl aminopeptidase [Candidatus Liberibacter asiaticu
315122196500 leucyl aminopeptidase [Candidatus Liberibacter solanace 1 0.0
209548673496 leucyl aminopeptidase [Rhizobium leguminosarum bv. trif 1 1e-161
241203951496 leucyl aminopeptidase [Rhizobium leguminosarum bv. trif 1 1e-160
86357094497 leucyl aminopeptidase [Rhizobium etli CFN 42] Length = 1 1e-159
116251337496 leucyl aminopeptidase [Rhizobium leguminosarum bv. vici 1 1e-158
190891138496 leucyl aminopeptidase [Rhizobium etli CIAT 652] Length 1 1e-158
327188012496 leucyl aminopeptidase protein [Rhizobium etli CNPAF512] 1 1e-157
227821477497 leucyl aminopeptidase [Sinorhizobium fredii NGR234] Len 1 1e-155
15964908497 leucyl aminopeptidase [Sinorhizobium meliloti 1021] Len 1 1e-153
150395990497 leucyl aminopeptidase [Sinorhizobium medicae WSM419] Le 1 1e-151
>gi|315122196|ref|YP_004062685.1| leucyl aminopeptidase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 500 Back     alignment and organism information
 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/500 (80%), Positives = 445/500 (89%), Gaps = 6/500 (1%)

Query: 1   MDIKFSFAKNPSIKQEGLAILLKTSFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHLNI 60
           MDIKFSFA+NP IK+ G+AILLKT+FSDV GLS +GS  +V RA SVKNF GESKSHLNI
Sbjct: 1   MDIKFSFARNPFIKKGGMAILLKTNFSDVTGLSFVGSLGVVERAASVKNFTGESKSHLNI 60

Query: 61  LAPVDCVWDRLVVAGIGDPR--DANFSWLKAGGSIASYIEEDKNIEIFVDVPEYPITKAE 118
           L P  CVWDRLVV GIGDPR  D  FSWLKAGG+ AS+IEEDKNIEIFVDVPEYPITK E
Sbjct: 61  LVPEGCVWDRLVVVGIGDPRIKDEKFSWLKAGGNAASFIEEDKNIEIFVDVPEYPITKEE 120

Query: 119 IRDLVLGFMLKTYTFDQYKTKKRESSSPRSKENI----SVTIVTEMIQQSSQVVADIQSV 174
           IRD  LGF+LK Y FD+YKTKK+E SS +S ++I    SVT +T+  +QS+ VVADI+SV
Sbjct: 121 IRDFTLGFILKLYNFDRYKTKKKEDSSLQSNDSINDSISVTFITQTFEQSNPVVADIKSV 180

Query: 175 VKGVNLARDIINEPANVLGTDEFCKQVRKLESLGVAVEILDKEAMHKLGMNALLAVAQGS 234
           V GVNLARDI+NEPANVLGTDEFC+QV+KLESLGV V+ILDK+ M +LGMNALLAV+QGS
Sbjct: 181 VNGVNLARDIVNEPANVLGTDEFCEQVKKLESLGVEVDILDKDTMAQLGMNALLAVSQGS 240

Query: 235 SRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLL 294
           SRPPYL VMKW GG+  +QPLAFIGKGVVFD+GGIS+KPS+GMEEMKGDL GAAAVTGLL
Sbjct: 241 SRPPYLVVMKWNGGNQCDQPLAFIGKGVVFDSGGISLKPSNGMEEMKGDLAGAAAVTGLL 300

Query: 295 HVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALW 354
            VLAERKAK+NAIG+LALVENMP SSAQRPGDIVRS+SGQ+IEVINTDAEGRLILADALW
Sbjct: 301 SVLAERKAKVNAIGILALVENMPDSSAQRPGDIVRSLSGQSIEVINTDAEGRLILADALW 360

Query: 355 YCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLWRMPMN 414
           YC THY P LMIDLATLTGAMVV+LGN+YAGLFANN+ LAEQLLS+GLST ELLWRMPMN
Sbjct: 361 YCHTHYKPALMIDLATLTGAMVVALGNVYAGLFANNNPLAEQLLSAGLSTEELLWRMPMN 420

Query: 415 EEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQS 474
           +EYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFV+D SWAHIDIAG ATG +PKEINQS
Sbjct: 421 DEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVKDTSWAHIDIAGTATGNHPKEINQS 480

Query: 475 WASGFGVRLLDEFVRAFYEK 494
           WASGFGVRLLD FVR FYEK
Sbjct: 481 WASGFGVRLLDTFVRDFYEK 500


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209548673|ref|YP_002280590.1| leucyl aminopeptidase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 496 Back     alignment and organism information
>gi|241203951|ref|YP_002975047.1| leucyl aminopeptidase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 496 Back     alignment and organism information
>gi|86357094|ref|YP_468986.1| leucyl aminopeptidase [Rhizobium etli CFN 42] Length = 497 Back     alignment and organism information
>gi|116251337|ref|YP_767175.1| leucyl aminopeptidase [Rhizobium leguminosarum bv. viciae 3841] Length = 496 Back     alignment and organism information
>gi|190891138|ref|YP_001977680.1| leucyl aminopeptidase [Rhizobium etli CIAT 652] Length = 496 Back     alignment and organism information
>gi|327188012|gb|EGE55242.1| leucyl aminopeptidase protein [Rhizobium etli CNPAF512] Length = 496 Back     alignment and organism information
>gi|227821477|ref|YP_002825447.1| leucyl aminopeptidase [Sinorhizobium fredii NGR234] Length = 497 Back     alignment and organism information
>gi|15964908|ref|NP_385261.1| leucyl aminopeptidase [Sinorhizobium meliloti 1021] Length = 497 Back     alignment and organism information
>gi|150395990|ref|YP_001326457.1| leucyl aminopeptidase [Sinorhizobium medicae WSM419] Length = 497 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target494 leucyl aminopeptidase [Candidatus Liberibacter asiaticu
PRK00913485 PRK00913, PRK00913, multifunctional aminopeptidase A; P 1e-172
cd00433468 cd00433, Peptidase_M17, Cytosol aminopeptidase family, 1e-136
COG0260485 COG0260, PepB, Leucyl aminopeptidase [Amino acid transp 1e-141
pfam00883312 pfam00883, Peptidase_M17, Cytosol aminopeptidase family 1e-110
PRK05015424 PRK05015, PRK05015, aminopeptidase B; Provisional 9e-58
KOG2597513 KOG2597, KOG2597, KOG2597, Predicted aminopeptidase of 5e-87
PTZ00412569 PTZ00412, PTZ00412, leucyl aminopeptidase; Provisional 1e-67
pfam02789126 pfam02789, Peptidase_M17_N, Cytosol aminopeptidase fami 2e-10
>gnl|CDD|179165 PRK00913, PRK00913, multifunctional aminopeptidase A; Provisional Back     alignment and domain information
>gnl|CDD|48344 cd00433, Peptidase_M17, Cytosol aminopeptidase family, N-terminal and catalytic domains Back     alignment and domain information
>gnl|CDD|30609 COG0260, PepB, Leucyl aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|144468 pfam00883, Peptidase_M17, Cytosol aminopeptidase family, catalytic domain Back     alignment and domain information
>gnl|CDD|179915 PRK05015, PRK05015, aminopeptidase B; Provisional Back     alignment and domain information
>gnl|CDD|37808 KOG2597, KOG2597, KOG2597, Predicted aminopeptidase of the M17 family [General function prediction only] Back     alignment and domain information
>gnl|CDD|185602 PTZ00412, PTZ00412, leucyl aminopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|145770 pfam02789, Peptidase_M17_N, Cytosol aminopeptidase family, N-terminal domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 494 leucyl aminopeptidase [Candidatus Liberibacter asiaticu
PRK00913491 leucyl aminopeptidase; Provisional 100.0
cd00433468 Peptidase_M17 Cytosol aminopeptidase family, N-terminal 100.0
KOG2597513 consensus 100.0
COG0260485 PepB Leucyl aminopeptidase [Amino acid transport and me 100.0
pfam00883312 Peptidase_M17 Cytosol aminopeptidase family, catalytic 100.0
PRK05015424 aminopeptidase B; Provisional 100.0
pfam02789126 Peptidase_M17_N Cytosol aminopeptidase family, N-termin 99.69
PRK06837427 acetylornithine deacetylase; Provisional 95.33
PRK06915422 acetylornithine deacetylase; Validated 94.82
PRK07522387 acetylornithine deacetylase; Provisional 91.03
>PRK00913 leucyl aminopeptidase; Provisional Back     alignment and domain information
>cd00433 Peptidase_M17 Cytosol aminopeptidase family, N-terminal and catalytic domains Back     alignment and domain information
>KOG2597 consensus Back     alignment and domain information
>COG0260 PepB Leucyl aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain Back     alignment and domain information
>PRK05015 aminopeptidase B; Provisional Back     alignment and domain information
>pfam02789 Peptidase_M17_N Cytosol aminopeptidase family, N-terminal domain Back     alignment and domain information
>PRK06837 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PRK06915 acetylornithine deacetylase; Validated Back     alignment and domain information
>PRK07522 acetylornithine deacetylase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target494 leucyl aminopeptidase [Candidatus Liberibacter asiaticu
1gyt_A503 E. Coli Aminopeptidase A (Pepa) Length = 503 1e-104
3h8e_A497 Low Ph Native Structure Of Leucine Aminopeptidase F 1e-103
3jru_B490 Crystal Structure Of Leucyl Aminopeptidase (Pepa) F 4e-93
2ewb_A486 The Crystal Structure Of Bovine Lens Leucine Aminop 9e-77
2j9a_A487 Bllap In Complex With Microginin Fr1 Length = 487 1e-76
1lcp_A484 Bovine Lens Leucine Aminopeptidase Complexed With L 1e-76
1bpm_A487 Differentiation And Identification Of The Two Catal 1e-76
1bll_E488 X-Ray Crystallographic Determination Of The Structu 1e-76
3pei_A486 Crystal Structure Of Cytosol Aminopeptidase From Fr 2e-74
3kqx_A528 Structure Of A Protease 1 Length = 528 3e-68
3kzw_A515 Crystal Structure Of Cytosol Aminopeptidase From St 6e-66
3ij3_A482 1.8 Angstrom Resolution Crystal Structure Of Cytoso 3e-68
2hb6_A491 Structure Of Caenorhabditis Elegans Leucine Aminope 1e-43
gi|21730291|pdb|1GYT|A Chain A, E. Coli Aminopeptidase A (Pepa) Length = 503 Back     alignment and structure
 Score =  382 bits (982), Expect = e-104,   Method: Composition-based stats.
 Identities = 167/503 (33%), Positives = 266/503 (52%), Gaps = 17/503 (3%)

Query: 1   MDIKFSFAKNPSIKQEGLAILLKT--SFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHL 58
           M+           +   + + +      S +A      S   +   +      G+    L
Sbjct: 1   MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISALLRRGELEGKPGQTL 60

Query: 59  NILAPVDCVWDRLVVAGIGDPRDANFSWLK-AGGSIASYIEEDKNIEIFVDVPEYPITK- 116
            +    + + +R+++ G G  R+ +    K       + + +  ++E    + E  +   
Sbjct: 61  LLHHVPNVLSERILLIGCGKERELDERQYKQVIQKTINTLNDTGSMEAVCFLTELHVKGR 120

Query: 117 ---AEIRDLVLGFMLKTYTFDQYKTKKRESSSPRSKENISVTIVTEMIQQSSQVVADIQS 173
               ++R  V       Y+FDQ KT K E   P  K   +V    E+     + +    +
Sbjct: 121 NNYWKVRQAVETAKETLYSFDQLKTNKSEPRRPLRKMVFNVPTRRELTSG-ERAIQHGLA 179

Query: 174 VVKGVNLARDIINEPANVLGTDEFCKQVRKLESLGVAV---EILDKEAMHKLGMNALLAV 230
           +  G+  A+D+ N P N+        Q R+L           ++ ++ M +LGM++ LAV
Sbjct: 180 IAAGIKAAKDLGNMPPNICNAAYLASQARQLADSYSKNVITRVIGEQQMKELGMHSYLAV 239

Query: 231 AQGSSRPPYLAVMKWE-GGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAA 289
            QGS     ++V++++     + +P+  +GKG+ FD+GGISIKPS GM+EMK D+ GAAA
Sbjct: 240 GQGSQNESLMSVIEYKGNASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAA 299

Query: 290 VTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLIL 349
           V G++ ++AE +  IN IGVLA  ENMPG  A RPGD++ +MSGQT+EV+NTDAEGRL+L
Sbjct: 300 VYGVMRMVAELQLPINVIGVLAGCENMPGGRAYRPGDVLTTMSGQTVEVLNTDAEGRLVL 359

Query: 350 ADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLW 409
            D L Y    + P  +ID+ATLTGA V++LG+   GL AN++ LA +L+++   +G+  W
Sbjct: 360 CDVLTYVER-FEPEAVIDVATLTGACVIALGHHITGLMANHNPLAHELIAASEQSGDRAW 418

Query: 410 RMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPK 469
           R+P+ +EY + +ES FADM NIGGR  G+I A  FL +F +  +WAH+DIAG A     +
Sbjct: 419 RLPLGDEYQEQLESNFADMANIGGRPGGAITAGCFLSRFTRKYNWAHLDIAGTAW----R 474

Query: 470 EINQSWASGFGVRLLDEFVRAFY 492
                 A+G  V LL +F+    
Sbjct: 475 SGKAKGATGRPVALLAQFLLNRA 497


gi|294662374|pdb|3H8E|A Chain A, Low Ph Native Structure Of Leucine Aminopeptidase From Pseud Putida Length = 497 Back     alignment and structure
gi|306440509|pdb|3JRU|B Chain B, Crystal Structure Of Leucyl Aminopeptidase (Pepa) From Xoo0834, Xanthomonas Oryzae Pv. Oryzae Kacc10331 Length = 490 Back     alignment and structure
>gi|93279321|pdb|2EWB|A Chain A, The Crystal Structure Of Bovine Lens Leucine Aminopeptidase In Complex With Zofenoprilat Length = 486 Back     alignment and structure
>gi|122920855|pdb|2J9A|A Chain A, Bllap In Complex With Microginin Fr1 Length = 487 Back     alignment and structure
>gi|1127256|pdb|1LCP|A Chain A, Bovine Lens Leucine Aminopeptidase Complexed With L-Leucine Phosphonic Acid Length = 484 Back     alignment and structure
>gi|157830427|pdb|1BPM|A Chain A, Differentiation And Identification Of The Two Catalytic Metal Binding Sites In Bovine Lens Leucine Aminopeptidase By X-Ray Crystallography Length = 487 Back     alignment and structure
>gi|809230|pdb|1BLL|E Chain E, X-Ray Crystallographic Determination Of The Structure Of Bovine Lens Leucine Aminopeptidase Complexed With Amastatin: Formulation Of A Catalytic Mechanism Featuring A Gem-Diolate Transition State Length = 488 Back     alignment and structure
>gi|313103972|pdb|3PEI|A Chain A, Crystal Structure Of Cytosol Aminopeptidase From Francisella Tularensis Length = 486 Back     alignment and structure
>gi|285803543|pdb|3KQX|A Chain A, Structure Of A Protease 1 Length = 528 Back     alignment and structure
>gi|283807231|pdb|3KZW|A Chain A, Crystal Structure Of Cytosol Aminopeptidase From Staphylococcus Aureus Col Length = 515 Back     alignment and structure
>gi|255918067|pdb|3IJ3|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Cytosol Aminopeptidase From Coxiella Burnetii Length = 482 Back     alignment and structure
>gi|114794306|pdb|2HB6|A Chain A, Structure Of Caenorhabditis Elegans Leucine Aminopeptidase (Lap1) Length = 491 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target494 leucyl aminopeptidase [Candidatus Liberibacter asiaticu
3ij3_A482 Cytosol aminopeptidase; PEPB, peptidase M17 family, IDP 1e-123
3kr4_A528 M17 leucyl aminopeptidase; protease, hydrolase; HET: BE 1e-119
3h8g_F497 Cytosol aminopeptidase; cytoplasm, hydrolase, manganese 1e-115
3kzw_A515 Cytosol aminopeptidase; cytoplasm, hydrolase, manganese 1e-114
1gyt_A503 Cytosol aminopeptidase; hydrolase, DNA recombination; 2 1e-114
3jru_B490 Probable cytosol aminopeptidase; bacterial blight, XOO0 1e-109
1lam_A484 Leucine aminopeptidase; exopeptidase, metallopeptidase, 1e-103
2hc9_A491 Leucine aminopeptidase 1; zinc, carbonate, structural g 3e-93
>3ij3_A Cytosol aminopeptidase; PEPB, peptidase M17 family, IDP01962, cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; HET: PGE PG4; 1.80A {Coxiella burnetii} Length = 482 Back     alignment and structure
 Score =  436 bits (1124), Expect = e-123
 Identities = 134/479 (27%), Positives = 221/479 (46%), Gaps = 39/479 (8%)

Query: 18  LAILLKTSFSDVAGLSLIGSPSIVMRAVSVKNFIGESKSHLNILAPVDCVWDRLVVAGIG 77
           +  ++     D     L    +   + V    F+G + +  +I      +  + V+ G+ 
Sbjct: 40  IQPMMPDELPDW----LDTQDARTQQWVKASGFVGLAGTICSIPESTGAL--QRVLLGVS 93

Query: 78  DPRDANFSWLKAGGSIASYIEEDKNIEIFVDVPEYPITKAEIRDLVLGFMLKTYTFDQYK 137
           D   + + +      +          ++  D  E           +L F L +Y F+ Y+
Sbjct: 94  DYEYS-WDFGGLSKVLPP-----GAFQLNRDDFE---DDEYYERALLAFGLGSYQFNAYR 144

Query: 138 TKKRESSSPRSKENISVTIVTEMIQQSSQVVADIQSVVKGVNLARDIINEPANVLGTDEF 197
            +    +                +         +   +  + L RD+IN PA  +G  E 
Sbjct: 145 KRSPYLAK---------------LFLPQAHRKRVTDWLTTIYLIRDLINTPAEDMGPSEL 189

Query: 198 CKQVRKL-ESLGVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVMKWEGGDSEEQPLA 256
            + V+ + +     V+I++ + +      A+ AV +  SRPP L  +KW    +    + 
Sbjct: 190 AQAVKHVAKEFEAKVKIIESKDLET-EFPAIYAVGRAGSRPPLLIDLKWGDIKAP--KVT 246

Query: 257 FIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVLALVENM 316
            +GKGV FD+GG+ IK   GM  MK D+GGAA   GL  ++  ++  +    ++  VEN 
Sbjct: 247 LVGKGVCFDSGGLDIKTPGGMLLMKKDMGGAAHALGLARMIMLQQLPVRLRLLIPAVENA 306

Query: 317 PGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMV 376
            GS + RPGD+V++ + +TIE+ NTDAEGR++LADAL       +P L+ID +TLTGA  
Sbjct: 307 IGSRSYRPGDVVQTRARKTIEITNTDAEGRVVLADALAEAV-KEDPDLIIDFSTLTGAAR 365

Query: 377 VSLGNIYAGLFANNDVLAEQLLSSGLSTGELLWRMPMNEEYNKLIESKFADMKNIG-GRG 435
           ++LG     LFAN D LA+ L+ + L T + LWR+P+ + Y   ++S+ AD+ N    R 
Sbjct: 366 IALGPNLPALFANQDSLAQALIDASLKTDDPLWRLPLFQPYRNYLKSEVADLTNSSQNRM 425

Query: 436 AGSIVAAQFLEKFVQDA-SWAHIDIAGVATGGYPKEINQSWASGFGVRLLDEFVRAFYE 493
           AG+I AA FL+ FV D   WAH DI        P            +R +  ++   Y 
Sbjct: 426 AGAITAALFLQHFVSDQIPWAHFDIFAWNLEDLP--GRPIGGEAMALRAVFHYLEQQYR 482


>3kr4_A M17 leucyl aminopeptidase; protease, hydrolase; HET: BES 1PE; 2.00A {Plasmodium falciparum} PDB: 3kqz_A* 3kqx_A* 3kr5_A* Length = 528 Back     alignment and structure
>3h8g_F Cytosol aminopeptidase; cytoplasm, hydrolase, manganese, metal-bindi protease; HET: BES; 1.50A {Pseudomonas putida} PDB: 3h8e_A 3h8f_A* Length = 497 Back     alignment and structure
>3kzw_A Cytosol aminopeptidase; cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; 2.70A {Staphylococcus aureus subsp} Length = 515 Back     alignment and structure
>1gyt_A Cytosol aminopeptidase; hydrolase, DNA recombination; 2.5A {Escherichia coli} SCOP: c.56.5.3 c.50.1.1 Length = 503 Back     alignment and structure
>3jru_B Probable cytosol aminopeptidase; bacterial blight, XOO0834, PEPA, xanthomonas oryzae PV. ORYZ KACC10331, hydrolase, manganese; 2.60A {Xanthomonas oryzae PV} Length = 490 Back     alignment and structure
>1lam_A Leucine aminopeptidase; exopeptidase, metallopeptidase, hydrolase (alpha-aminoacylpeptide); 1.60A {Bos taurus} SCOP: c.56.5.3 c.50.1.1 PDB: 1lan_A 1lcp_A* 1lap_A 1bpn_A 1bpm_A 1bll_E 2j9a_A* 2ewb_A* Length = 484 Back     alignment and structure
>2hc9_A Leucine aminopeptidase 1; zinc, carbonate, structural genomics, PSI, protein structure initiative; 1.85A {Caenorhabditis elegans} PDB: 2hb6_A Length = 491 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target494 leucyl aminopeptidase [Candidatus Liberibacter asiaticu
3h8g_F497 Cytosol aminopeptidase; cytoplasm, hydrolase, manganese 100.0
1gyt_A503 Cytosol aminopeptidase; hydrolase, DNA recombination; 2 100.0
3jru_B490 Probable cytosol aminopeptidase; bacterial blight, XOO0 100.0
3kzw_A515 Cytosol aminopeptidase; cytoplasm, hydrolase, manganese 100.0
3kr4_A528 M17 leucyl aminopeptidase; protease, hydrolase; HET: BE 100.0
1lam_A484 Leucine aminopeptidase; exopeptidase, metallopeptidase, 100.0
3ij3_A482 Cytosol aminopeptidase; PEPB, peptidase M17 family, IDP 100.0
2hc9_A491 Leucine aminopeptidase 1; zinc, carbonate, structural g 100.0
2pok_A 481 Peptidase, M20/M25/M40 family; M20 family peptidase, me 95.42
1q7l_A198 Aminoacylase-1; catalysis, enzyme dimerization, site- d 94.8
3pfo_A433 Putative acetylornithine deacetylase; metal binding, me 92.19
3ct9_A356 Acetylornithine deacetylase; NP_812461.1, A putative zi 90.07
>3h8g_F Cytosol aminopeptidase; cytoplasm, hydrolase, manganese, metal-bindi protease; HET: BES; 1.50A {Pseudomonas putida} PDB: 3h8e_A 3h8f_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=1201.16  Aligned_cols=485  Identities=34%  Similarity=0.557  Sum_probs=442.2

Q ss_pred             CEEEEEEECCCCCCCCEEEEEECCCCCCC--CCCCCCCCHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCEEEEEECCC
Q ss_conf             90699950778776771699962686632--2221238888999999808998367878998437888744599994488
Q gi|254780392|r    1 MDIKFSFAKNPSIKQEGLAILLKTSFSDV--AGLSLIGSPSIVMRAVSVKNFIGESKSHLNILAPVDCVWDRLVVAGIGD   78 (494)
Q Consensus         1 M~mkis~~~~~~~~~d~lvV~~~~~~~~~--~~~~~~~~~~~L~~~i~~~~F~GK~Ge~l~l~~~~g~~~~rViLVGLG~   78 (494)
                      |++.++.......++|+|+|++.++....  ....+....+.|.+++++.+|+||.||++.++.+.+..++||+|||||+
T Consensus         1 M~i~v~s~~~~~~k~d~LVv~v~e~~~l~~~~~~Ld~~~~g~I~~~lk~~dF~GK~Ge~l~l~~~~g~~a~rIlLVGLGk   80 (497)
T 3h8g_F            1 MELVVKSVAAASVKTATLVIPVGENRKLGAVAKAVDLASEGAISAVLKRGDLAGKPGQTLLLQNLQGLKAERVLLVGSGK   80 (497)
T ss_dssp             CEEEEECSCGGGCCBSCEEEEEEGGGCCCHHHHHHHHHTTTHHHHHHHTCCCCCCTTCEEEECCCTTCSBSCEEEEEEES
T ss_pred             CEEEEEECCHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCEEEEEECCC
T ss_conf             97899808822324887999978898766899987797768999999708998888988998189987668899997786


Q ss_pred             HHHCCH-HHHHHHHHHHHHHHHCCCEEEEECCCCCCC-----CHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             155899-999999999998531697489941778999-----98999999999971477754444364333232100013
Q gi|254780392|r   79 PRDANF-SWLKAGGSIASYIEEDKNIEIFVDVPEYPI-----TKAEIRDLVLGFMLKTYTFDQYKTKKRESSSPRSKENI  152 (494)
Q Consensus        79 ~~~~~~-~~~ra~a~~~~~l~~~~~~~v~i~l~~~~~-----~~~~~~~~~eG~~L~~Y~Fd~yKskk~~~~~~~~~~~~  152 (494)
                      .++++. +++++++++++.+++.+.+++.+.++....     ....++++++|+.+++|+|++|||+++++....   .+
T Consensus        81 ~~~ls~~~~rka~~~a~~~lk~~~~~~~~i~l~~~~~~~~~~~~~~~~~~aeG~~lg~Y~Fd~yKskk~~~~~l~---~v  157 (497)
T 3h8g_F           81 DEALGDRTWRKLVASVAGVLKGLNGADAVLALDDVAVNNRDAHYGKYRLLAETLLDGEYVFDRFKSQKVEPRALK---KV  157 (497)
T ss_dssp             SSCBCHHHHHHHHHHHHHHHHHSCCSEEEECCTTCCBTTSCTTTHHHHHHHHHHHHTTCCCCTTCSSCCCCCSCC---EE
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCE---EE
T ss_conf             032799999999999999997558861999533245454200599999999999853432234445666655520---24


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEECHHHHHHHHHHHH-C-CCCCHHHHCCCCCCHHHHHHHHHH
Q ss_conf             33224577378999999999999999986420212540302999999999861-1-332100001110001345898874
Q gi|254780392|r  153 SVTIVTEMIQQSSQVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKLE-S-LGVAVEILDKEAMHKLGMNALLAV  230 (494)
Q Consensus       153 ~i~~~~~~~~~~~~~i~~~~aiaegv~lARDLvN~PaN~ltP~~lA~~a~~l~-~-~gl~v~Vld~~~L~klGMg~llaV  230 (494)
                      .+..........++.+++++++++||++||||+|+|||+|||++||+++++++ + .+++|+|+|+++|+++|||+||+|
T Consensus       158 ~l~~~~~~~~~~~~~l~~~~aiaegv~lARDLvN~P~N~ltP~~lA~~A~~lak~~~~l~v~Vld~~~l~klGMG~lLaV  237 (497)
T 3h8g_F          158 TLLADKAGQAEVERAVKHASAIATGMAFTRDLGNLPPNLCHPSFLAEQAKELGKAHKALKVEVLDEKKIKDLGMGAFYAV  237 (497)
T ss_dssp             EEECCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTSCHHHHHHHHHHHHHHCTTEEEEEECHHHHHHTTCHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECHHHHHHCCCCCEECC
T ss_conf             31235677799999999999999999999852458973358669999999986126826999950798640574302111


Q ss_pred             HCCCCCCCEEEEEECCCCCCCCCCEEEEECCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEE
Q ss_conf             20257785068862057886565126630211200663100333320023221123568999999998708787289986
Q gi|254780392|r  231 AQGSSRPPYLAVMKWEGGDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVL  310 (494)
Q Consensus       231 gqGS~~~Prli~l~Y~g~~~~~~piaLVGKGvTFDtGGislKp~~~M~~Mk~DM~GaAav~g~~~aia~l~~~v~v~~~~  310 (494)
                      ||||.+|||||+|+|+|+++.++||+|||||||||||||||||+.+|++||+||||||+|+|+|+++++|++|+||++++
T Consensus       238 gqGS~~~Prli~l~y~g~~~~~~~i~lVGKGitFDtGG~slKp~~~M~~Mk~DM~GaAaV~g~~~a~a~l~~~~~v~~~~  317 (497)
T 3h8g_F          238 GQGSDQPPRLIVLNYQGGKKADKPFVLVGKGITFDTGGISLKPGAGMDEMKYDMCGAASVFGTLRAVLELQLPVNLVCLL  317 (497)
T ss_dssp             HTTSSSCCEEEEEEEECSCTTSCCEEEEEEEEEEECCTTSCCCSTTGGGGGGTTHHHHHHHHHHHHHHHHTCSSEEEEEE
T ss_pred             CCCCCCCCCEEEEECCCCCCCCCCEEEECCEEEECCCCCCCCCCCCHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             57778998345884158877888379976636742676354567773441376756899999999999809696289998


Q ss_pred             EECCCCCCCCCCCHHHHHCCCCCCEEEEECCCCCCEEEEEHHHHHHHHHCCCCEEEEECCCCHHHHHHCCCCCEEEEECC
Q ss_conf             41026689997470776302489588863478664036523678875207961355211120023543177605787089
Q gi|254780392|r  311 ALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANN  390 (494)
Q Consensus       311 ~~~EN~~~~~a~~pgdvi~~~~G~tvei~nTDAEGRlvLaD~l~ya~~~~~p~~iid~ATLTGa~~~alG~~~~g~~~n~  390 (494)
                      |+|||||||+|||||||||+||||||||.||||||||||||+|+|| ++|+|+.|||+|||||||++|||++++|+|+||
T Consensus       318 ~~~eN~~~~~a~~pgdvi~~~~G~tvev~nTDAEGRlvLaD~l~~a-~~~~p~~iid~ATLTga~~~alG~~~~g~~~n~  396 (497)
T 3h8g_F          318 ACAENMPSGGATRPGDIVTTMSGQTVEILNTDAEGRLVLCDTLTYA-ERFKPQAVIDIATLTGACIVALGSHTTGLMGNN  396 (497)
T ss_dssp             EEEEECCSTTSCCTTEEEECTTSCEEEESCTTCCHHHHHHHHHHHH-GGGCCSEEEEEECCCHHHHHHHTTTSEEEEESC
T ss_pred             EEEECCCCCCCCCCCCEEECCCCCEEEEECCCCHHHEEEHHHHHHH-HHHCCCCEEEEECCCCCEEEECCCCCCCEECCC
T ss_conf             7120277888889998327689988985047741330015589999-874987078861141410250378754111486


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCCEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCC
Q ss_conf             89999999989985697176776867888617986417018887467999999998723886769994000011678888
Q gi|254780392|r  391 DVLAEQLLSSGLSTGELLWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKE  470 (494)
Q Consensus       391 ~~~~~~~~~a~~~~ge~~w~lPl~~~y~~~~~s~~AD~~n~~~~~~g~~~aa~fl~~f~~~~~w~HlDiag~a~~~~~~~  470 (494)
                      |+|++++++||+.+||++||||||++|+++|+|++|||+|+|+|+||+||||+||+|||+++||+|||||||||.++   
T Consensus       397 ~~l~~~~~~a~~~~~e~~w~lPl~~~~~~~~~s~~AD~~n~~~~~~g~~~aa~Fl~~Fv~~~~w~HlDiAg~a~~~~---  473 (497)
T 3h8g_F          397 DDLVGQLLDAGKRADDRAWQLPLFDEYQEQLDSPFADMGNIGGPKAGTITAGCFLSRFAKAYNWAHMDIAGTAWISG---  473 (497)
T ss_dssp             HHHHHHHHHHHHHHTCCEEECCCCHHHHGGGCCSSSSEESCCCSSSHHHHHHHHHHTTCTTSCEEEEECTTTSEECS---
T ss_pred             HHHHHHHHHHHHHHCCCEEECCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCC---
T ss_conf             99999999999981898750889889997569932375378989623679999999868998979996677775779---


Q ss_pred             CCCCCCCCCCHHHHHHHHHHHC
Q ss_conf             8899865435899999999766
Q gi|254780392|r  471 INQSWASGFGVRLLDEFVRAFY  492 (494)
Q Consensus       471 ~~~~g~tg~~vr~l~~~~~~~~  492 (494)
                      +.|+|+||||||||+|||+++.
T Consensus       474 ~~~~g~tg~~vr~l~~~l~~~a  495 (497)
T 3h8g_F          474 GKDKGATGRPVPLLTQYLLDRA  495 (497)
T ss_dssp             STTCEECCTTHHHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHH
T ss_conf             9999952379999999999865



>1gyt_A Cytosol aminopeptidase; hydrolase, DNA recombination; 2.5A {Escherichia coli} SCOP: c.56.5.3 c.50.1.1 Back     alignment and structure
>3jru_B Probable cytosol aminopeptidase; bacterial blight, XOO0834, PEPA, xanthomonas oryzae PV. ORYZ KACC10331, hydrolase, manganese; 2.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3kzw_A Cytosol aminopeptidase; cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; 2.70A {Staphylococcus aureus subsp} Back     alignment and structure
>3kr4_A M17 leucyl aminopeptidase; protease, hydrolase; HET: BES 1PE; 2.00A {Plasmodium falciparum} PDB: 3kqz_A* 3kqx_A* 3kr5_A* Back     alignment and structure
>1lam_A Leucine aminopeptidase; exopeptidase, metallopeptidase, hydrolase (alpha-aminoacylpeptide); 1.60A {Bos taurus} SCOP: c.56.5.3 c.50.1.1 PDB: 1lan_A 1lcp_A* 1lap_A 1bpn_A 1bpm_A 1bll_E 2j9a_A* 2ewb_A* Back     alignment and structure
>3ij3_A Cytosol aminopeptidase; PEPB, peptidase M17 family, IDP01962, cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; HET: PGE PG4; 1.80A {Coxiella burnetii} Back     alignment and structure
>2hc9_A Leucine aminopeptidase 1; zinc, carbonate, structural genomics, PSI, protein structure initiative; 1.85A {Caenorhabditis elegans} PDB: 2hb6_A Back     alignment and structure
>2pok_A Peptidase, M20/M25/M40 family; M20 family peptidase, metallo protein, MCSG, structural genomics, PSI-2; HET: BGC; 1.90A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>1q7l_A Aminoacylase-1; catalysis, enzyme dimerization, site- directed mutagenesis, structure comparison, zinc, hydrolase; 1.40A {Homo sapiens} SCOP: c.56.5.4 Back     alignment and structure
>3pfo_A Putative acetylornithine deacetylase; metal binding, merops M20A family, amino-acid biosynthesis, metallopeptidase; 1.90A {Rhodopseudomonas palustris} Back     alignment and structure
>3ct9_A Acetylornithine deacetylase; NP_812461.1, A putative zinc peptidase, peptidase family M20/M25/M40, structural genomics; 2.31A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 494 leucyl aminopeptidase [Candidatus Liberibacter asiaticu
d1gyta2325 c.56.5.3 (A:179-503) Leucine aminopeptidase, C-terminal 1e-83
d1lama1325 c.56.5.3 (A:160-484) Leucine aminopeptidase, C-terminal 2e-77
d1gyta1178 c.50.1.1 (A:1-178) Leucine aminopeptidase (Aminopeptida 6e-10
d1lama2159 c.50.1.1 (A:1-159) Leucine aminopeptidase (Aminopeptida 8e-04
>d1gyta2 c.56.5.3 (A:179-503) Leucine aminopeptidase, C-terminal domain {Escherichia coli, PepA [TaxId: 562]} Length = 325 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Zn-dependent exopeptidases
family: Leucine aminopeptidase, C-terminal domain
domain: Leucine aminopeptidase, C-terminal domain
species: Escherichia coli, PepA [TaxId: 562]
 Score =  304 bits (779), Expect = 1e-83
 Identities = 143/323 (44%), Positives = 209/323 (64%), Gaps = 9/323 (2%)

Query: 174 VVKGVNLARDIINEPANVLGTDEFCKQVRKLE---SLGVAVEILDKEAMHKLGMNALLAV 230
           +  G+  A+D+ N P N+        Q R+L    S  V   ++ ++ M +LGM++ LAV
Sbjct: 2   IAAGIKAAKDLGNMPPNICNAAYLASQARQLADSYSKNVITRVIGEQQMKELGMHSYLAV 61

Query: 231 AQGSSRPPYLAVMKWEG-GDSEEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAA 289
            QGS     ++V++++G    + +P+  +GKG+ FD+GGISIKPS GM+EMK D+ GAAA
Sbjct: 62  GQGSQNESLMSVIEYKGNASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAA 121

Query: 290 VTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINTDAEGRLIL 349
           V G++ ++AE +  IN IGVLA  ENMPG  A RPGD++ +MSGQT+EV+NTDAEGRL+L
Sbjct: 122 VYGVMRMVAELQLPINVIGVLAGCENMPGGRAYRPGDVLTTMSGQTVEVLNTDAEGRLVL 181

Query: 350 ADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELLW 409
            D L Y    + P  +ID+ATLTGA V++LG+   GL AN++ LA +L+++   +G+  W
Sbjct: 182 CDVLTYVE-RFEPEAVIDVATLTGACVIALGHHITGLMANHNPLAHELIAASEQSGDRAW 240

Query: 410 RMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPK 469
           R+P+ +EY + +ES FADM NIGGR  G+I A  FL +F +  +WAH+DIAG A      
Sbjct: 241 RLPLGDEYQEQLESNFADMANIGGRPGGAITAGCFLSRFTRKYNWAHLDIAGTAWRSGKA 300

Query: 470 EINQSWASGFGVRLLDEFVRAFY 492
           +     A+G  V LL +F+    
Sbjct: 301 K----GATGRPVALLAQFLLNRA 319


>d1lama1 c.56.5.3 (A:160-484) Leucine aminopeptidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Length = 325 Back     information, alignment and structure
>d1gyta1 c.50.1.1 (A:1-178) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Escherichia coli, PepA [TaxId: 562]} Length = 178 Back     information, alignment and structure
>d1lama2 c.50.1.1 (A:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Length = 159 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target494 leucyl aminopeptidase [Candidatus Liberibacter asiaticu
d1gyta2325 Leucine aminopeptidase, C-terminal domain {Escherichia 100.0
d1lama1325 Leucine aminopeptidase, C-terminal domain {Cow (Bos tau 100.0
d2grea2233 Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 92.79
d1gyta1178 Leucine aminopeptidase (Aminopeptidase A), N-terminal d 99.83
d1lama2159 Leucine aminopeptidase (Aminopeptidase A), N-terminal d 99.55
g1q7l.1280 Aminoacylase-1, catalytic domain {Human (Homo sapiens) 94.05
d1vhea2275 Hypothetical protein YsdC, catalytic domain {Bacillus s 91.25
>d1gyta2 c.56.5.3 (A:179-503) Leucine aminopeptidase, C-terminal domain {Escherichia coli, PepA [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Zn-dependent exopeptidases
family: Leucine aminopeptidase, C-terminal domain
domain: Leucine aminopeptidase, C-terminal domain
species: Escherichia coli, PepA [TaxId: 562]
Probab=100.00  E-value=0  Score=941.35  Aligned_cols=315  Identities=46%  Similarity=0.784  Sum_probs=303.5

Q ss_pred             HHHHHHHHHHHHCCCCCEEECHHHHHHHHHHH-HCC--CCCHHHHCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCCC
Q ss_conf             99999998642021254030299999999986-113--321000011100013458988742025778506886205788
Q gi|254780392|r  173 SVVKGVNLARDIINEPANVLGTDEFCKQVRKL-ESL--GVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVMKWEGGD  249 (494)
Q Consensus       173 aiaegv~lARDLvN~PaN~ltP~~lA~~a~~l-~~~--gl~v~Vld~~~L~klGMg~llaVgqGS~~~Prli~l~Y~g~~  249 (494)
                      ||++|+++||||+|+|||+|||++|+++++++ +++  +++|+|+++++|+++|||+||+|||||++|||||+|+|+|.+
T Consensus         1 Aia~gvn~aRdLvn~P~N~ltP~~~a~~a~~l~~~~~~~v~v~V~~~~~l~~~Gm~~llaVg~GS~~~p~li~l~y~~~~   80 (325)
T d1gyta2           1 AIAAGIKAAKDLGNMPPNICNAAYLASQARQLADSYSKNVITRVIGEQQMKELGMHSYLAVGQGSQNESLMSVIEYKGNA   80 (325)
T ss_dssp             HHHHHHHHHHHHHHSCTTTCSHHHHHHHHHHHHHHTTTTEEEEEECHHHHHHTTCHHHHHHHHTSSSCCEEEEEEEECCC
T ss_pred             CHHHHHHHHHHHHCCCHHHCCHHHHHHHHHHHHHHCCCCEEEEEECHHHHHHCCCCCEEEEEECCCCCCCCEEEEECCCC
T ss_conf             98899999998607992553999999999999987399759999559999757998746785035788871278856866


Q ss_pred             C-CCCCEEEEECCEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHH
Q ss_conf             6-565126630211200663100333320023221123568999999998708787289986410266899974707763
Q gi|254780392|r  250 S-EEQPLAFIGKGVVFDTGGISIKPSHGMEEMKGDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIV  328 (494)
Q Consensus       250 ~-~~~piaLVGKGvTFDtGGislKp~~~M~~Mk~DM~GaAav~g~~~aia~l~~~v~v~~~~~~~EN~~~~~a~~pgdvi  328 (494)
                      . +.+||+|||||||||||||||||+.+|.+||+||||||+|+|+|+++++|++|+||++++|+||||||++||||||||
T Consensus        81 ~~~~~~i~lVGKGitFDTGG~slKp~~~M~~Mk~DM~GAA~v~g~~~a~a~l~~~~~v~~~~p~~EN~i~~~A~kPgDVi  160 (325)
T d1gyta2          81 SEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAVYGVMRMVAELQLPINVIGVLAGCENMPGGRAYRPGDVL  160 (325)
T ss_dssp             CTTCCCEEEEEEEEEEECCTTSCCCSTTGGGGGGGGHHHHHHHHHHHHHHHHTCSSEEEEEEEEEEECCSTTCCCTTCEE
T ss_pred             CCCCCCEEEECCCEEEECCCCCCCCCCCHHHHHHHCCCCHHHHHHHHHHHHHCCCCEEEEEEEHHHCCCCCCCCCCCCEE
T ss_conf             67888779972616873366564456543554431224145788999999728686499997511115678763678745


Q ss_pred             CCCCCCEEEEECCCCCCEEEEEHHHHHHHHHCCCCEEEEECCCCHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCC
Q ss_conf             02489588863478664036523678875207961355211120023543177605787089899999999899856971
Q gi|254780392|r  329 RSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSGLSTGELL  408 (494)
Q Consensus       329 ~~~~G~tvei~nTDAEGRlvLaD~l~ya~~~~~p~~iid~ATLTGa~~~alG~~~~g~~~n~~~~~~~~~~a~~~~ge~~  408 (494)
                      |+||||||||.||||||||||||+|+||+ +++|+.|||+|||||||++|||+.++|+|+||++++++++++|+.+||++
T Consensus       161 ~s~~GkTVEI~NTDAEGRLvLADaL~ya~-~~~p~~iiD~ATLTGa~~~ALG~~~ag~~~n~~~~~~~~~~a~~~~ge~~  239 (325)
T d1gyta2         161 TTMSGQTVEVLNTDAEGRLVLCDVLTYVE-RFEPEAVIDVATLTGACVIALGHHITGLMANHNPLAHELIAASEQSGDRA  239 (325)
T ss_dssp             ECTTSCEEECSCTTCCHHHHHHHHHHHGG-GGCCSEEEEEECCCHHHHHHHTTTSEEEEESCHHHHHHHHHHHHHHTCCE
T ss_pred             ECCCCCEEEEECCCCCCHHHHHHHHHHHH-HHCCCEEECCCCCCCCEEEECCCCEEEEECCCHHHHHHHHHHHHHHCCCC
T ss_conf             63699478763167531100167899998-60975023034654600042157424762251677889999999837843


Q ss_pred             CCCCCCHHHHHHHCCCCCCEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHH
Q ss_conf             76776867888617986417018887467999999998723886769994000011678888889986543589999999
Q gi|254780392|r  409 WRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQSWASGFGVRLLDEFV  488 (494)
Q Consensus       409 w~lPl~~~y~~~~~s~~AD~~n~~~~~~g~~~aa~fl~~f~~~~~w~HlDiag~a~~~~~~~~~~~g~tg~~vr~l~~~~  488 (494)
                      ||||+|++|+++++|++|||+|++++.+|+|+||+||++||+++||+|||||||+|.++    .++|+||||||||+|||
T Consensus       240 w~lPl~~~~~~~~~S~~ADl~n~~~~~~g~~~aA~FL~~Fv~~~~w~HlDIAg~a~~~~----~~~gaTG~gvr~l~~~l  315 (325)
T d1gyta2         240 WRLPLGDEYQEQLESNFADMANIGGRPGGAITAGCFLSRFTRKYNWAHLDIAGTAWRSG----KAKGATGRPVALLAQFL  315 (325)
T ss_dssp             EECCCCHHHHGGGCCSSSSEESCCCSTTHHHHHHHHHHTTCTTSCEEEEECTTTSEECG----GGCEECCTTHHHHHHHH
T ss_pred             CCCCCCHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCCCC----CCCCCCCHHHHHHHHHH
T ss_conf             22256576786358984521258989703789999999838998989991677776799----99995305599999999


Q ss_pred             HHHC
Q ss_conf             9766
Q gi|254780392|r  489 RAFY  492 (494)
Q Consensus       489 ~~~~  492 (494)
                      ++++
T Consensus       316 ~~~~  319 (325)
T d1gyta2         316 LNRA  319 (325)
T ss_dssp             HHHT
T ss_pred             HHHH
T ss_conf             9986



>d1lama1 c.56.5.3 (A:160-484) Leucine aminopeptidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2grea2 c.56.5.4 (A:3-73,A:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1gyta1 c.50.1.1 (A:1-178) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Escherichia coli, PepA [TaxId: 562]} Back     information, alignment and structure
>d1lama2 c.50.1.1 (A:1-159) Leucine aminopeptidase (Aminopeptidase A), N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vhea2 c.56.5.4 (A:3-72,A:163-367) Hypothetical protein YsdC, catalytic domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 494 leucyl aminopeptidase [Candidatus Liberibacter asi
1gyt_A_165-503339 (A:165-503) Cytosol aminopeptidase; hydrolase, DNA 1e-101
3kr4_A_194-528335 (A:194-528) M17 leucyl aminopeptidase; protease, h 1e-101
2hc9_A_155-491337 (A:155-491) Leucine aminopeptidase 1; zinc, carbon 1e-100
3ij3_A_158-482325 (A:158-482) Cytosol aminopeptidase; PEPB, peptidas 2e-98
3kzw_A_213-515303 (A:213-515) Cytosol aminopeptidase; cytoplasm, hyd 6e-98
1lam_A_177-484308 (A:177-484) Leucine aminopeptidase; exopeptidase, 6e-96
3kzw_A_1-212212 (A:1-212) Cytosol aminopeptidase; cytoplasm, hydro 7e-18
1gyt_A_1-164164 (A:1-164) Cytosol aminopeptidase; hydrolase, DNA r 3e-13
3ij3_A_1-157157 (A:1-157) Cytosol aminopeptidase; PEPB, peptidase 7e-07
1lam_A_1-176176 (A:1-176) Leucine aminopeptidase; exopeptidase, me 2e-12
>1gyt_A (A:165-503) Cytosol aminopeptidase; hydrolase, DNA recombination; 2.5A {Escherichia coli}Length = 339 Back     alignment and structure
 Score =  365 bits (937), Expect = e-101
 Identities = 145/333 (43%), Positives = 213/333 (63%), Gaps = 9/333 (2%)

Query: 166 QVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKL---ESLGVAVEILDKEAMHKL 222
           + +    ++  G+  A+D+ N P N+        Q R+L    S  V   ++ ++ M +L
Sbjct: 8   RAIQHGLAIAAGIKAAKDLGNMPPNICNAAYLASQARQLADSYSKNVITRVIGEQQMKEL 67

Query: 223 GMNALLAVAQGSSRPPYLAVMKWEGGDSE-EQPLAFIGKGVVFDTGGISIKPSHGMEEMK 281
           GM++ LAV QGS     ++V++++G  SE  +P+  +GKG+ FD+GGISIKPS GM+EMK
Sbjct: 68  GMHSYLAVGQGSQNESLMSVIEYKGNASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMK 127

Query: 282 GDLGGAAAVTGLLHVLAERKAKINAIGVLALVENMPGSSAQRPGDIVRSMSGQTIEVINT 341
            D+ GAAAV G++ ++AE +  IN IGVLA  ENMPG  A RPGD++ +MSGQT+EV+NT
Sbjct: 128 YDMCGAAAVYGVMRMVAELQLPINVIGVLAGCENMPGGRAYRPGDVLTTMSGQTVEVLNT 187

Query: 342 DAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSSG 401
           DAEGRL+L D L Y    + P  +ID+ATLTGA V++LG+   GL AN++ LA +L+++ 
Sbjct: 188 DAEGRLVLCDVLTYV-ERFEPEAVIDVATLTGACVIALGHHITGLMANHNPLAHELIAAS 246

Query: 402 LSTGELLWRMPMNEEYNKLIESKFADMKNIGGRGAGSIVAAQFLEKFVQDASWAHIDIAG 461
             +G+  WR+P+ +EY + +ES FADM NIGGR  G+I A  FL +F +  +WAH+DIAG
Sbjct: 247 EQSGDRAWRLPLGDEYQEQLESNFADMANIGGRPGGAITAGCFLSRFTRKYNWAHLDIAG 306

Query: 462 VATGGYPKEINQSWASGFGVRLLDEFVRAFYEK 494
            A      +     A+G  V LL +F+      
Sbjct: 307 TAWRSGKAK----GATGRPVALLAQFLLNRAGF 335


>3kr4_A (A:194-528) M17 leucyl aminopeptidase; protease, hydrolase; HET: BES 1PE; 2.00A {Plasmodium falciparum} PDB: 3kqz_A* 3kqx_A* 3kr5_A*Length = 335 Back     alignment and structure
>2hc9_A (A:155-491) Leucine aminopeptidase 1; zinc, carbonate, structural genomics, PSI, protein structure initiative; 1.85A {Caenorhabditis elegans} PDB: 2hb6_ALength = 337 Back     alignment and structure
>3ij3_A (A:158-482) Cytosol aminopeptidase; PEPB, peptidase M17 family, IDP01962, cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; HET: PGE PG4; 1.80A {Coxiella burnetii}Length = 325 Back     alignment and structure
>3kzw_A (A:213-515) Cytosol aminopeptidase; cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; 2.70A {Staphylococcus aureus subsp}Length = 303 Back     alignment and structure
>1lam_A (A:177-484) Leucine aminopeptidase; exopeptidase, metallopeptidase, hydrolase (alpha-aminoacylpeptide); 1.60A {Bos taurus}Length = 308 Back     alignment and structure
>3kzw_A (A:1-212) Cytosol aminopeptidase; cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; 2.70A {Staphylococcus aureus subsp}Length = 212 Back     alignment and structure
>1gyt_A (A:1-164) Cytosol aminopeptidase; hydrolase, DNA recombination; 2.5A {Escherichia coli}Length = 164 Back     alignment and structure
>3ij3_A (A:1-157) Cytosol aminopeptidase; PEPB, peptidase M17 family, IDP01962, cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; HET: PGE PG4; 1.80A {Coxiella burnetii}Length = 157 Back     alignment and structure
>1lam_A (A:1-176) Leucine aminopeptidase; exopeptidase, metallopeptidase, hydrolase (alpha-aminoacylpeptide); 1.60A {Bos taurus}Length = 176 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target494 leucyl aminopeptidase [Candidatus Liberibacter asiaticu
3kr4_A_194-528335 M17 leucyl aminopeptidase; protease, hydrolase; HE 100.0
1gyt_A_165-503339 Cytosol aminopeptidase; hydrolase, DNA recombinati 100.0
3ij3_A_158-482325 Cytosol aminopeptidase; PEPB, peptidase M17 family 100.0
2hc9_A_155-491337 Leucine aminopeptidase 1; zinc, carbonate, structu 100.0
3kzw_A_213-515303 Cytosol aminopeptidase; cytoplasm, hydrolase, mang 100.0
1lam_A_177-484308 Leucine aminopeptidase; exopeptidase, metallopepti 100.0
3kzw_A_1-212212 Cytosol aminopeptidase; cytoplasm, hydrolase, mang 99.94
1lam_A_1-176176 Leucine aminopeptidase; exopeptidase, metallopepti 99.83
1gyt_A_1-164164 Cytosol aminopeptidase; hydrolase, DNA recombinati 99.79
3ij3_A_1-157157 Cytosol aminopeptidase; PEPB, peptidase M17 family 99.48
3kr4_A_1-193193 M17 leucyl aminopeptidase; protease, hydrolase; HE 97.72
3isz_A_1-177_299-377256 Succinyl-diaminopimelate desuccinylase; DAPE, Zn-b 92.47
3gb0_A_1-176_296-373254 Peptidase T; NP_980509.1, aminopeptidase PEPT, pep 91.92
1fno_A_1-205_328-417295 Peptidase T; metallo peptidase, protease, zinc, hy 90.81
2pok_A_1-214_440-481256 Peptidase, M20/M25/M40 family; M20 family peptidas 91.78
>3kr4_A (A:194-528) M17 leucyl aminopeptidase; protease, hydrolase; HET: BES 1PE; 2.00A {Plasmodium falciparum} PDB: 3kqz_A* 3kqx_A* 3kr5_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=966.31  Aligned_cols=324  Identities=38%  Similarity=0.607  Sum_probs=314.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCEEECHHHHHHHHHHH-HCCCCCHHHHCCCCCCHHHHHHHHHHHCCCCCCCEEEEE
Q ss_conf             9999999999999998642021254030299999999986-113321000011100013458988742025778506886
Q gi|254780392|r  165 SQVVADIQSVVKGVNLARDIINEPANVLGTDEFCKQVRKL-ESLGVAVEILDKEAMHKLGMNALLAVAQGSSRPPYLAVM  243 (494)
Q Consensus       165 ~~~i~~~~aiaegv~lARDLvN~PaN~ltP~~lA~~a~~l-~~~gl~v~Vld~~~L~klGMg~llaVgqGS~~~Prli~l  243 (494)
                      ++.+++++++++|+++||||+|+|||+|||++||++++++ +++|++|+|+++++|+++|||+|++|||||.+|||||+|
T Consensus         2 e~~~~~~~~~a~g~~lARdL~n~P~N~ltP~~~a~~a~~~~~~~gv~v~V~~~~~l~~~gmg~~laVg~GS~~~p~li~l   81 (335)
T 3kr4_A            2 KEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHL   81 (335)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHSCTTTSCHHHHHHHHHHHHHHHTCEEEEECHHHHHHTTCHHHHHHGGGCSSCCEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHCCHHHHHHHHHHHHHHCCCEEEEEEHHHHHHCCCCCEEEEECCCCCCCEEEEE
T ss_conf             99999999999999999987268962149999999999999872987999639999867998468761478898727999


Q ss_pred             ECCCCCCCCCCEEEEECCEEECCCCCCCC--CCCCCHHHHHHHHHHHHHHHHHHHHHHCC-CCCCEEEEEEECCCCCCCC
Q ss_conf             20578865651266302112006631003--33320023221123568999999998708-7872899864102668999
Q gi|254780392|r  244 KWEGGDSEEQPLAFIGKGVVFDTGGISIK--PSHGMEEMKGDLGGAAAVTGLLHVLAERK-AKINAIGVLALVENMPGSS  320 (494)
Q Consensus       244 ~Y~g~~~~~~piaLVGKGvTFDtGGislK--p~~~M~~Mk~DM~GaAav~g~~~aia~l~-~~v~v~~~~~~~EN~~~~~  320 (494)
                      +|+|++++++||+||||||||||||||||  |+.+|++||+||||||+|+|+|+++++|+ +|+||++++|+||||||++
T Consensus        82 ~Y~g~~~~~~~i~LVGKGiTFDtGG~slK~~P~~~M~~Mk~DM~GAAaVlga~~aia~l~~l~vnv~a~l~~~EN~i~~~  161 (335)
T 3kr4_A           82 TYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKN  161 (335)
T ss_dssp             EEECSSCCCEEEEEEEEEEEEECCTTSCSCSTTCCGGGGGGGGHHHHHHHHHHHHHHHHCCSSEEEEEEEEEEEECCSTT
T ss_pred             EECCCCCCCCCEEEECCEEEEECCCCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCEEEEEEHHHHHCCCCC
T ss_conf             97136777886665566668765885356686104787650143489999999999984358813899733443067998


Q ss_pred             CCCHHHHHCCCCCCEEEEECCCCCCEEEEEHHHHHHHHHCCCCEEEEECCCCHHHHHHCCCCCEEEEECCHHHHHHHHHH
Q ss_conf             74707763024895888634786640365236788752079613552111200235431776057870898999999998
Q gi|254780392|r  321 AQRPGDIVRSMSGQTIEVINTDAEGRLILADALWYCRTHYNPHLMIDLATLTGAMVVSLGNIYAGLFANNDVLAEQLLSS  400 (494)
Q Consensus       321 a~~pgdvi~~~~G~tvei~nTDAEGRlvLaD~l~ya~~~~~p~~iid~ATLTGa~~~alG~~~~g~~~n~~~~~~~~~~a  400 (494)
                      |||||||||+||||||||.||||||||||||+|+|| ++|+|+.|||+|||||||++|||++++|+|||||++++++++|
T Consensus       162 a~kPgDVi~s~nGkTVEI~NTDAEGRLvLADal~~a-~~~~p~~iiDiATLTGa~~~ALG~~~ag~~sn~~~l~~~l~~a  240 (335)
T 3kr4_A          162 SYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYA-EKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQS  240 (335)
T ss_dssp             SCCTTCEEECTTSCEEECSCTTCCHHHHHHHHHHHH-HHTCCSEEEEEECCCTTHHHHTTTTCEEEEESCHHHHHHHHHH
T ss_pred             CCCCCCEEECCCCCEEEEECCCCCCEEEEEHHHHHH-HCCCCCCEEEEHHHHHHHHECCCCCEEEEEECCHHHHHHHHHH
T ss_conf             879988116169967986348852004540288897-5339950111011221302404896179996999999999999


Q ss_pred             HHHHCCCCCCCCCCHHHHHHHCCCCCCEECCC-CCCHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             99856971767768678886179864170188-87467999999998723886769994000011678888889986543
Q gi|254780392|r  401 GLSTGELLWRMPMNEEYNKLIESKFADMKNIG-GRGAGSIVAAQFLEKFVQDASWAHIDIAGVATGGYPKEINQSWASGF  479 (494)
Q Consensus       401 ~~~~ge~~w~lPl~~~y~~~~~s~~AD~~n~~-~~~~g~~~aa~fl~~f~~~~~w~HlDiag~a~~~~~~~~~~~g~tg~  479 (494)
                      |+.+||++||||||++|+++++|++||++|++ ++.||+|+||+||++||+++||+|||||||+|     .+.|+|+|||
T Consensus       241 g~~~ge~~W~lPl~~~y~~~i~s~~AD~~N~~~~~~~g~~~Aa~FL~~Fv~~~~W~HlDIAg~a~-----~~~~~g~TG~  315 (335)
T 3kr4_A          241 SKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSW-----NFKARKPKGF  315 (335)
T ss_dssp             HHHHTCCEEECCCCGGGGGGGCCSSSSEESSCSSCCCHHHHHHHHHHTTCSSSEEEEEECTTTSE-----ETTTTEECCT
T ss_pred             HHHHCCCEEECCCCHHHHHHCCCCHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCEEEEECCCCCC-----CCCCCCCCCH
T ss_conf             99849976408998888977699688741789689724179999999767997989995687588-----8999895413


Q ss_pred             CHHHHHHHHHHHCCC
Q ss_conf             589999999976689
Q gi|254780392|r  480 GVRLLDEFVRAFYEK  494 (494)
Q Consensus       480 ~vr~l~~~~~~~~~~  494 (494)
                      |||||+||++++.++
T Consensus       316 gvr~L~~~l~~~a~~  330 (335)
T 3kr4_A          316 GVRLLTEFVLNDALH  330 (335)
T ss_dssp             THHHHHHHHHHC---
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             199999999852433



>1gyt_A (A:165-503) Cytosol aminopeptidase; hydrolase, DNA recombination; 2.5A {Escherichia coli} Back     alignment and structure
>3ij3_A (A:158-482) Cytosol aminopeptidase; PEPB, peptidase M17 family, IDP01962, cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; HET: PGE PG4; 1.80A {Coxiella burnetii} Back     alignment and structure
>2hc9_A (A:155-491) Leucine aminopeptidase 1; zinc, carbonate, structural genomics, PSI, protein structure initiative; 1.85A {Caenorhabditis elegans} PDB: 2hb6_A Back     alignment and structure
>3kzw_A (A:213-515) Cytosol aminopeptidase; cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; 2.70A {Staphylococcus aureus subsp} Back     alignment and structure
>1lam_A (A:177-484) Leucine aminopeptidase; exopeptidase, metallopeptidase, hydrolase (alpha-aminoacylpeptide); 1.60A {Bos taurus} Back     alignment and structure
>3kzw_A (A:1-212) Cytosol aminopeptidase; cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; 2.70A {Staphylococcus aureus subsp} Back     alignment and structure
>1lam_A (A:1-176) Leucine aminopeptidase; exopeptidase, metallopeptidase, hydrolase (alpha-aminoacylpeptide); 1.60A {Bos taurus} Back     alignment and structure
>1gyt_A (A:1-164) Cytosol aminopeptidase; hydrolase, DNA recombination; 2.5A {Escherichia coli} Back     alignment and structure
>3ij3_A (A:1-157) Cytosol aminopeptidase; PEPB, peptidase M17 family, IDP01962, cytoplasm, hydrolase, manganese, metal-binding, protease, structural genomics; HET: PGE PG4; 1.80A {Coxiella burnetii} Back     alignment and structure
>3kr4_A (A:1-193) M17 leucyl aminopeptidase; protease, hydrolase; HET: BES 1PE; 2.00A {Plasmodium falciparum} PDB: 3kqz_A* 3kqx_A* 3kr5_A* Back     alignment and structure
>3isz_A (A:1-177,A:299-377) Succinyl-diaminopimelate desuccinylase; DAPE, Zn-binding, metallopeptidase, structural genomics, PSI-2; 2.00A {Haemophilus influenzae rd KW20} PDB: 3ic1_A Back     alignment and structure
>3gb0_A (A:1-176,A:296-373) Peptidase T; NP_980509.1, aminopeptidase PEPT, peptidase family M20/M25/M40, structural genomics; 2.04A {Bacillus cereus atcc 10987} Back     alignment and structure
>1fno_A (A:1-205,A:328-417) Peptidase T; metallo peptidase, protease, zinc, hydrolase; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2pok_A (A:1-214,A:440-481) Peptidase, M20/M25/M40 family; M20 family peptidase, metallo protein, MCSG, structural genomics, PSI-2; HET: BGC; 1.90A {Streptococcus pneumoniae TIGR4} Back     alignment and structure