255764468

255764468

permease protein

GeneID in NCBI database:8209378Locus tag:CLIBASIA_01390
Protein GI in NCBI database:255764468Protein Accession:YP_003064806.2
Gene range:+(292560, 293645)Protein Length:361aa
Gene description:permease protein
COG prediction:[R] Predicted permeases
KEGG prediction:permease protein; K07091 lipopolysaccharide export system permease protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM6 TM-Helix
TOPPRED6 TM-Helix
HMMTOP6 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-
MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTNVLTSMNRNTELLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDLYIKISKYNPNNTLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEVHRKSPISKDISIMKFKSYTLQTESANSSTIVLKANDQNLSFLLNPNPNNPNYRPELLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGVFWGFSYIIHKIEQNPYYIPILYLFLFCISSIFLLMIKKKYTKI
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHcccccEEcccccEEEEEEEEccccEEEEEEEEEEEccccEEEEEEEEEEEEEcccEEEEEccEEEEEEcccccEEEEEcccEEEEcccccccHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcHcHHHHccccEEccccccEEEEEEEcccccEcEEEEEEcccccccEEEEEEcEEEEEcccEEEEEccEEEEEcccccccEEEEEccEEEEccccccccccccHccccHHHHccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccc
MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISgyliptvlpmvtpfCFAMETTNVLTsmnrntelliidntgtsritlIKPVLFLAILLSIFLFIseniiepkcrSTIKQLSAKAQLALTFSYLEEnlffrldddlyikiskynpnntlqgifivdsrdtqthkiyyaqsgsidldrQAIIlndgevhrkspiskdisimKFKSytlqtesanSSTIVLKAndqnlsfllnpnpnnpnyrpeLLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGVFWGFSYIIHkieqnpyyiPILYLFLFCISSIFLLMIKKKYTKI
MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTNVLTSMNRNTELLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDLYIKISkynpnntlqgiFIVDSRDTQTHKIYyaqsgsidldrQAIILNDgevhrkspiskdisimKFKSYTLQTESANSSTIVLKANDQNLSFLLNPNPNNPNYRPELLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGVFWGFSYIIHKIEQNPYYIPILYLFLFCISSIFLLMIKKKYTKI
MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTNVLTSMNRNTELLIIDNTGTSRITLIKPVlflaillsiflfiseniiePKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDLYIKISKYNPNNTLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEVHRKSPISKDISIMKFKSYTLQTESANSSTIVLKANDQnlsfllnpnpnnpnyrpellETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGVFWGFSYIIHKIEQNPYYIPilylflfcissifllMIKKKYTKI
MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTNVLTSMNRNTELLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPKCRSTIKQLSA*AQL*****YLEENLFFRLDDDLYIKISKYNPNNTLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEVHRKSPISKDISIMKFKSYTL******************LSFLLNPNPN******ELLETYRSEFHKRLTQWLFPVIFGLISIVAA*************PIFISLSISFGVFWGFSYIIHKIEQNPYYIPILYLFLFCISSIFLLMIKKKYT**
MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTNVLTSMNRNTELLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDLYIKISKYNPNNTLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEVHRKSPISKDISIMKFKSYTLQTESANSSTIVLKANDQNLSFLLNPNPNNPNYRPELLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGVFWGFSYIIHKIEQNPYYIPILYLFLFCISSIFLLMIKKKYTKI
MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTNVLTSMNRNTELLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDLYIKISKYNPNNTLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEVHRKSPISKDISIMKFKSYTLQTESANSSTIVLKANDQNLSFLLNPNPNNPNYRPELLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGVFWGFSYIIHKIEQNPYYIPILYLFLFCISSIFLLMIKKK****
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiii
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxx
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiii
oooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHiiiiii
SSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTNVLTSMNRNTELLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDLYIKISKYNPNNTLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEVHRKSPISKDISIMKFKSYTLQTESANSSTIVLKANDQNLSFLLNPNPNNPNYRPELLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGVFWGFSYIIHKIEQNPYYIPILYLFLFCISSIFLLMIKKKYTKI
MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTNVLTSMNRNTELLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDLYIKISKYNPNNTLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEVHRKSPISKDISIMKFKSYTLQTESANSSTIVLKANDQNLSFLLNPNPNNPNYRPELLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGVFWGFSYIIHKIEQNPYYIPILYLFLFCISSIFLLMIKKKYTKI
MKSFELYILRCIGRSFLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTNVLTSMNRNTELLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPKCRSTIKQLSAKAQLALTFSYLEENLFFRLDDDLYIKISKYNPNNTLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQAIILNDGEVHRKSPISKDISIMKFKSYTLQTESANSSTIVLKANDQNLSFLLNPNPNNPNYRPELLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGVFWGFSYIIHKIEQNPYYIPILYLFLFCISSIFLLMIKKKYTKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target361 permease protein [Candidatus Liberibacter asiaticus str
255764469361 putative permease protein [Candidatus Liberibacter 0.003
>gi|255764469|ref|YP_003064807.2| putative permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 361 Back     alignment
 Score = 34.3 bits (77), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 16  FLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTN 75
           FL+  + +VF+  + +I  ++  + + + S   +L  +   +P ++  + PF   +    
Sbjct: 20  FLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL--AATRVPLIIQQIIPFITLVVNIV 77

Query: 76  VLTSMNRNTELLIIDNTGTSRITLIKPVLFLAILLSIF 113
           V  ++NR +EL+I    G S   L+ P +  +ILL IF
Sbjct: 78  VFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIF 115

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target361 permease protein [Candidatus Liberibacter asiaticus str
315122195283 permease protein [Candidatus Liberibacter solanacearum 1 2e-95
222085453391 permease protein [Agrobacterium radiobacter K84] Length 1 4e-76
190891136403 permease [Rhizobium etli CIAT 652] Length = 403 1 8e-75
86357092393 putative permease protein [Rhizobium etli CFN 42] Lengt 1 9e-75
209548671393 permease YjgP/YjgQ family protein [Rhizobium leguminosa 1 3e-74
241203949393 permease YjgP/YjgQ family protein [Rhizobium leguminosa 1 4e-74
116251335393 hypothetical protein RL1569 [Rhizobium leguminosarum bv 1 2e-73
218672884380 putative permease protein [Rhizobium etli GR56] Length 1 3e-66
15964907390 hypothetical protein SMc00584 [Sinorhizobium meliloti 1 1 3e-65
227821476390 putative permease protein [Sinorhizobium fredii NGR234] 1 6e-65
>gi|315122195|ref|YP_004062684.1| permease protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 283 Back     alignment and organism information
 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 187/283 (66%), Positives = 224/283 (79%), Gaps = 1/283 (0%)

Query: 80  MNRNTELLIIDNTGTSRITLIKPVLFLAILLSIFLFISENIIEPKCRSTIKQLSAKAQLA 139
           MNRN EL IIDNTGTSRITLIKPVLF AILLSIFLFI EN +EPK R+ IK+L A+A L 
Sbjct: 1   MNRNAELFIIDNTGTSRITLIKPVLFFAILLSIFLFILENTLEPKYRTEIKRLGAQAYLN 60

Query: 140 LTFSYLEENLFFRLDDDLYIKISKYNPNNTLQGIFIVDSRDTQTHKIYYAQSGSIDLDRQ 199
           LT S LEENLFF L+++ YIK+SK NPNNT+QGIF +DS D   H+IYYA+SG +DL+++
Sbjct: 61  LTLSSLEENLFFNLNNNFYIKVSKRNPNNTMQGIFAIDSSDPIIHRIYYAKSGFVDLEKK 120

Query: 200 AIILNDGEVHRKSPISKDISIMKFKSYTLQTES-ANSSTIVLKANDQNLSFLLNPNPNNP 258
            IIL  GEVHRKS +SKDISIMKF SY L  +S      I LKA+DQNLSFLLNP+PNNP
Sbjct: 121 IIILQKGEVHRKSSVSKDISIMKFDSYALDMQSLLAKQDITLKAHDQNLSFLLNPDPNNP 180

Query: 259 NYRPELLETYRSEFHKRLTQWLFPVIFGLISIVAADKRALVRQRKKIHPIFISLSISFGV 318
           +YR   +  YRSE HKRLTQWLFP++FGLISI++ +K + +R  +K+HP  I+L +SF V
Sbjct: 181 SYRENFIGKYRSELHKRLTQWLFPIVFGLISILSIEKTSSLRHYRKVHPSLIALLLSFCV 240

Query: 319 FWGFSYIIHKIEQNPYYIPILYLFLFCISSIFLLMIKKKYTKI 361
           F GFSYII  IEQ+P YIPILYLF F +SSI +L+IKKKY KI
Sbjct: 241 FSGFSYIIQGIEQSPSYIPILYLFFFVLSSILVLLIKKKYVKI 283


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085453|ref|YP_002543983.1| permease protein [Agrobacterium radiobacter K84] Length = 391 Back     alignment and organism information
>gi|190891136|ref|YP_001977678.1| permease [Rhizobium etli CIAT 652] Length = 403 Back     alignment and organism information
>gi|86357092|ref|YP_468984.1| putative permease protein [Rhizobium etli CFN 42] Length = 393 Back     alignment and organism information
>gi|209548671|ref|YP_002280588.1| permease YjgP/YjgQ family protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 393 Back     alignment and organism information
>gi|241203949|ref|YP_002975045.1| permease YjgP/YjgQ family protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 393 Back     alignment and organism information
>gi|116251335|ref|YP_767173.1| hypothetical protein RL1569 [Rhizobium leguminosarum bv. viciae 3841] Length = 393 Back     alignment and organism information
>gi|218672884|ref|ZP_03522553.1| putative permease protein [Rhizobium etli GR56] Length = 380 Back     alignment and organism information
>gi|15964907|ref|NP_385260.1| hypothetical protein SMc00584 [Sinorhizobium meliloti 1021] Length = 390 Back     alignment and organism information
>gi|227821476|ref|YP_002825446.1| putative permease protein [Sinorhizobium fredii NGR234] Length = 390 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target361 permease protein [Candidatus Liberibacter asiaticus str
COG0795364 COG0795, COG0795, Predicted permeases [General function 6e-29
pfam03739353 pfam03739, YjgP_YjgQ, Predicted permease YjgP/YjgQ fami 3e-36
>gnl|CDD|31138 COG0795, COG0795, Predicted permeases [General function prediction only] Back     alignment and domain information
>gnl|CDD|146398 pfam03739, YjgP_YjgQ, Predicted permease YjgP/YjgQ family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 361 permease protein [Candidatus Liberibacter asiaticus str
pfam03739353 YjgP_YjgQ Predicted permease YjgP/YjgQ family. Members 100.0
COG0795364 Predicted permeases [General function prediction only] 100.0
pfam02687174 FtsX Predicted permease. This is a family of predicted 90.88
pfam06835176 DUF1239 Protein of unknown function (DUF1239). This fam 90.27
>pfam03739 YjgP_YjgQ Predicted permease YjgP/YjgQ family Back     alignment and domain information
>COG0795 Predicted permeases [General function prediction only] Back     alignment and domain information
>pfam02687 FtsX Predicted permease Back     alignment and domain information
>pfam06835 DUF1239 Protein of unknown function (DUF1239) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00