254780395

254780395

organic solvent tolerance protein

GeneID in NCBI database:8209380Locus tag:CLIBASIA_01400
Protein GI in NCBI database:254780395Protein Accession:YP_003064808.1
Gene range:+(294774, 297062)Protein Length:762aa
Gene description:organic solvent tolerance protein
COG prediction:[M] Organic solvent tolerance protein OstA
KEGG prediction:organic solvent tolerance protein; K04744 LPS-assembly protein
SEED prediction:Outer membrane protein Imp, required for envelope biogenesis / Organic solvent tolerance protein precursor
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760--
MRYNYRHLIGATTFFLAFNIITPQGTPPSNEQTTTSTPSKIKKNETNRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNIKLIEPDKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQRTIFDKGTYTACSSCSKPNSRPPFWIVKSKRAILNRKTHTIRLEKPYLEIFGNSIFYFPLIEIPDETVVRKTGFLTPLFSSGEKQRFGVGIPYYLVISDNSDATFTFSPHPKKGILGEMELRKYFHSGKHTLHAAYMYNNNVESGEERHQAMLASIAEFEINPIWNLGWHLKKQTSGQLSYNYYSDALSKRININQIYLTGTGEKNSFDMRALHYHIQEPLSKNEKKFPQANIYPLIDYRYVDLQYAKSQQISITGNITAISRAKEKNTINQMKHDSQPWIPNGINRRLSIEADWRKKIIGPLGILFTPIANIRGDLHYLSFNRDLSSDTISNNPNFVASKMLTAGLDIRYPIVAVTQKSRHILEGIAQVYAATDEKYIKTIPNEDSHSLVLNSTSLFTQNRFSGFDRIEGGNRTNLGIRYIGSFNNLFTINGVIGRSIHILGTNSFSIPDSIGIGQNSGLEDKFSDYAAAVRLSLSPKITFSTQTLINPKDWSTRRTDTTIDYTMGSYEANISYTHIPAYPLYAYDARKTIQSRIKFKINDVLSADASLKWNMRAELPSHSIGLAYQNDCATVKIIYKNESPNIHGYKIQARLSLRTIGDFNPIDIDG
ccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEEEEccccEEEEEEEEEEEEccEEEEEEEEEEEccccEEEEEccEEEEcccccEEEEEEEEEEEEccEEEEEEEEEEEEcccEEEEEEEEEEEccEEEEEEEEEEEEccccccccccccEEEEEEEEEEEccccEEEEEccEEEEccEEEEcccEEEEEEcccccccEEEEEEEEccccccEEEEEEEEEEEcccEEEEEEEEEEEEcEEEEEEEEEEEEccccEEEEEEEEccccccccccccccEEEEEEEEEEcccccccEEEEEEEEEHHHHHHHHHcccccccEEEEEEEEEEEEEEEEEEEEEEEEEEccccccccccccEEEEEEEEEEcccccccccEEEEEEEEEEEEEEccccccccccccccccccccccEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEcccccccccccccccEEEEEEEEEEEEEEEcHHHcccccEEEEEEEEEEEEEcccccccccccccccEEEcccccEEEccccccccccccccEEEEEEEEEEEccccEEEEEEEEEEEEEccccccccccccccccccccccccccEEEEEEEEccccEEEEEEEEEccccccEEEEEEEEEEEccccEEEEEEEEEccccccccccEEEEEEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEEEcccEEEEEEEEEEcccccccEEEEEEEEEEEEcEEEEcccc
ccccHHHcHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEcEEEEcccccEEEEEEEEEEEEccEEEEEEEEEEEEcccEEEEEEEEEEEccccEEEEcccEEEEccccccEEEcEEEEEEcccccEcEEEEEEcccEEEEEccEEEEcccccccccccccEEEEEcEEEEcccccEEEEEEEEEEEccccEEEEEEEEcccccccccccccccccccccccccEEEEEEEEEccccccEEEcHHHHHHcccEEccEEEEEccccccEEEEEEccccccccccccccEEEEEcccEEEccEEEEEEEEEEEccHHHHcccccccccccccccEEEEEEcccccccEEEEEEEEEEEcccccccccccccEccEEEEcccccccccccEEEEEEEEEEEEcccccccccccccccccccccccccEEccccccccccccccccEEcHHHHHccccEEccccccccccccccccccEEcccccEEEEEcccEEEccccccEEEccEEEEEEEccHccccccccccccHccccccccccccccccccccccccEEEEEEEEEEEEccccEEEEEEEEEEEEEcccccccccccccccccccccccccHEEEEEEcccccEEEEEEEEEccccccccccEEEEEEccccEEEEEEEEEEccccccccccEEEEEEEEEEEccccEEEEEEEEEEccccccHHEEEEEEcccEEEEEEEEEEccccccccEEEEEEEEEcccccccccccc
mrynyrhlIGATTFFLAFniitpqgtppsneqtttstpskikknetnrhseldissdeivlnsegstttavGNVKIeykgyhlsarditfnhknhriiasgnikliepdkrqIHAEYLDITDDFTNGIIKNltikipadetyltassaqiigqrtifdkgtytacsscskpnsrppfwivkSKRAILNRkthtirlekpyleifgnsifyfplieipdetvvrktgfltplfssgekqrfgvgipyylvisdnsdatftfsphpkkgilgEMELRKYFHSGKHTLHAAYMYNNNVESGEERHQAMLASIAEfeinpiwnlgwhlkkqtsgqlsyNYYSDALSKRININQIyltgtgeknsfDMRALHYHiqeplsknekkfpqaniyplidyryVDLQYAKSQQISITGNITAISRAKekntinqmkhdsqpwipnginrrlSIEADwrkkiigplgilftpianirgdlhylsfnrdlssdtisnnpnFVASKMLTagldirypIVAVTQKSRHILEGIAQVYAATDekyiktipnedshslvlnstslftqnrfsgfdrieggnrtnlGIRYIGSFNNLFTINGVIGRSIhilgtnsfsipdsigigqnsgledkfsDYAAAVRLSlspkitfstqtlinpkdwstrrtdttidytmgsyeanisythipayplyayDARKTIQSRIKFKINDVLSADASLKWNmraelpshsiglayqndcATVKIIYknespnihgykiQARLSLrtigdfnpididg
MRYNYRHLIGATTFFLAFNIITPqgtppsneqtttstpskikknetnrhseldissdeivlnsegstttavgnvKIEYKGYHLSARDITFNHKNHRIIAsgnikliepdKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQRTIFDKGTYTACsscskpnsrppfwivkskrailnrkthtirlekpyleIFGNSIFYFPLIEIPDETVVRKTGFLTplfssgekqrfGVGIPYYLVISDNSDATFTFSPHPKKGILGEMELRKYFHSGKHTLHAAYMYNNNVESGEERHQAMLASIAEFEINPIWNLGWHLKKQTSGQLSYNYYSDALSKRININQIYLTGTGEKNSFDMRALHYHIQeplsknekkfPQANIYPLIDYRYVDLQYAKSQQISITGNITAISRAKEKNTinqmkhdsqpwipngiNRRLSIEADWRKKIIGPLGILFTPIANIRGDLHYLSFNRDLSSDTISNNPNFVASKMLTAGLDIRYPIVAVTQKSRHILEGIAQVYAATDEKYIKTIPNEDSHSLVLNSTSLFTQNRfsgfdrieggnrTNLGIRYIGSFNNLFTINGVIGRSIHILGTNSFSIPDSIGIGQNSGLEDKFSDYAAAVRLslspkitfstqtlinpkdwstrrtDTTIDYTMGSYEANISYTHIPAYPLYAYDARKTIQSRIKFKINDVLSADASLKWNMRAELPSHSIGLAYQNDCATVKIIYknespnihgykiqarlslrtigdfnpididg
MRYNYRHLIGATTFFLAFNIITPQGTPPSNEQTTTSTPSKIKKNETNRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNIKLIEPDKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQRTIFDKGTYTACSSCSKPNSRPPFWIVKSKRAILNRKTHTIRLEKPYLEIFGNSIFYFPLIEIPDETVVRKTGFLTPLFSSGEKQRFGVGIPYYLVISDNSDATFTFSPHPKKGILGEMELRKYFHSGKHTLHAAYMYNNNVESGEERHQAMLASIAEFEINPIWNLGWHLKKQTSGQLSYNYYSDALSKRININQIYLTGTGEKNSFDMRALHYHIQEPLSKNEKKFPQANIYPLIDYRYVDLQYAKSQQISITGNITAISRAKEKNTINQMKHDSQPWIPNGINRRLSIEADWRKKIIGPLGILFTPIANIRGDLHYLSFNRDLSSDTISNNPNFVASKMLTAGLDIRYPIVAVTQKSRHILEGIAQVYAATDEKYIKTIPNEDSHSLVLNSTSLFTQNRFSGFDRIEGGNRTNLGIRYIGSFNNLFTINGVIGRSIHILGTNSFSIPDSIGIGQNSGLEDKFSDYAAAVRLSLSPKITFSTQTLINPKDWSTRRTDTTIDYTMGSYEANISYTHIPAYPLYAYDARKTIQSRIKFKINDVLSADASLKWNMRAELPSHSIGLAYQNDCATVKIIYKNESPNIHGYKIQARLSLRTIGDFNPIDIDG
***NYRHLIGATTFFLAFNIITPQGTPPSN*********************LDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNIKLIEPDKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYL******IIGQRTIFDKGTYTACSSCSKPNSRPPFWIVKSKRAILNRKTHTIRLEKPYLEIFGNSIFYFPLIEIPDETVVRKTGFLTPLFSSGEKQRFGVGIPYYLVISDNSDATFTFSPHPKKGILGEMELRKYFHSGKHTLHAAYMYNNNVESGEERHQAMLASIAEFEINPIWNLGWHLKKQTSGQLSYNYYSDALSKRININQIYLTGTGEKNSFDMRALHYHIQEPLSKNEKKFPQANIYPLIDYRYVDLQYAKSQQISITGNITAISRAKEKNTINQMKHDSQPWIPNGINRRLSIEADWRKKIIGPLGILFTPIANIRGDLHYLSFNRDL********PNFVASKMLTAGLDIRYPIVAVTQKSRHILEGIAQVYAATDEKYIKTIPNEDSHSLVLNSTSLFTQNRFSGFDRIEGGNRTNLGIRYIGSFNNLFTINGVIGRSIHILGTNSFSIPDS*********EDKFSDYAAAVRLSLSPKITFSTQTLINPKDWSTRRTDTTIDYTMGSYEANISYTHIPAYPLYAYDARKTIQSRIKFKINDVLSADASLKWNMRAELPSHSIGLAYQNDCATVKIIYKNESPNIHGYKIQARLSLRTIGDFN******
MRYNYRHLIGATTFFLAFNIITPQGT***************KKNETNRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNIKLIEPDKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQRTIFDKGTYTACSSCSKPNSRPPFWIVKSKRAILNRKTHTIRLEKPYLEIFGNSIFYFPLIEIPDETVVRKTGFLTPLFSSGEKQRFGVGIPYYLVISDNSDATFTFSPHPKKGILGEMELRKYFHSGKHTLHAAYMYNNNVESGEERHQAMLASIAEFEINPIWNLGWHLKKQTSGQLSYNYYSDALSKRININQIYLTGTGEKNSFDMRALHYHIQEPLSKNEKKFPQANIYPLIDYRYVDLQYAKSQQISITGNITAISRAKEKNTINQMKHDSQPWIPNGINRRLSIEADWRKKIIGPLGILFTPIANIRGDLHYLSFNRDLSSDTISNNPNFVASKMLTAGLDIRYPIVAVTQKSRHILEGIAQVYAATDEKYIKTIPNEDSHSLVLNSTSLFTQNRFSGFDRIEGGNRTNLGIRYIGSFNNLFTINGVIGRSIHILGTNSFSIPDSIGIGQNSGLEDKFSDYAAAVRLSLSPKITFSTQTLINPKDWSTRRTDTTIDYTMGSYEANISYTHIPAYPLYAYDARKTIQSRIKFKINDVLSADASLKWNMRAELPSHSIGLAYQNDCATVKIIYKNESPNIHGYKIQARLSLRTIGDFNPIDIDG
*RYNYRHLIGATTFFLAFNIITPQGTPPSNEQTTTSTPSKIKKNETNRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNIKLIEPDKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQRTIFDKGTYTACSSCSKPNSRPPFWIVKSKRAILNRKTHTIRLEKPYLEIFGNSIFYFPLIEIPDETVVRKTGFLTPLFSSGEKQRFGVGIPYYLVISDNSDATFTFSPHPKKGILGEMELRKYFHSGKHTLHAAYMYNNNVESGEERHQAMLASIAEFEINPIWNLGWHLKKQTSGQLSYNYYSDALSKRININQIYLTGTGEKNSFDMRALHYHIQEPLSKNEKKFPQANIYPLIDYRYVDLQYAKSQQISITGNITAISRAKEKNTINQMKHDSQPWIPNGINRRLSIEADWRKKIIGPLGILFTPIANIRGDLHYLSFN****SDT*SNNPNFVASKMLTAGLDIRYPIVAVTQKSRHILEGIAQVYAATDEKYIKTIPNEDSHSLVLNSTSLFTQNRFSGFDRIEGGNRTNLGIRYIGSFNNLFTINGVIGRSIHILGTNSFS***S***G***G**DKFSDYAAAVRLSLSPKITFSTQTLINPKDWSTRRTDTTIDYTMGSYEANISYTHIPAYPLYAYDARKTIQSRIKFKINDVLSADASLKWNMRAELPSHSIGLAYQNDCATVKIIYKNESPNIHGYKIQARLSLRTIGDFNPI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRYNYRHLIGATTFFLAFNIITPQGTPPSNEQTTTSTPSKIKKNETNRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNIKLIEPDKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQRTIFDKGTYTACSSCSKPNSRPPFWIVKSKRAILNRKTHTIRLEKPYLEIFGNSIFYFPLIEIPDETVVRKTGFLTPLFSSGEKQRFGVGIPYYLVISDNSDATFTFSPHPKKGILGEMELRKYFHSGKHTLHAAYMYNNNVESGEERHQAMLASIAEFEINPIWNLGWHLKKQTSGQLSYNYYSDALSKRININQIYLTGTGEKNSFDMRALHYHIQEPLSKNEKKFPQANIYPLIDYRYVDLQYAKSQQISITGNITAISRAKEKNTINQMKHDSQPWIPNGINRRLSIEADWRKKIIGPLGILFTPIANIRGDLHYLSFNRDLSSDTISNNPNFVASKMLTAGLDIRYPIVAVTQKSRHILEGIAQVYAATDEKYIKTIPNEDSHSLVLNSTSLFTQNRFSGFDRIEGGNRTNLGIRYIGSFNNLFTINGVIGRSIHILGTNSFSIPDSIGIGQNSGLEDKFSDYAAAVRLSLSPKITFSTQTLINPKDWSTRRTDTTIDYTMGSYEANISYTHIPAYPLYAYDARKTIQSRIKFKINDVLSADASLKWNMRAELPSHSIGLAYQNDCATVKIIYKNESPNIHGYKIQARLSLRTIGDFNPIDIDG
MRYNYRHLIGATTFFLAFNIITPQGTPPSNEQTTTSTPSKIKKNETNRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNIKLIEPDKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQRTIFDKGTYTACSSCSKPNSRPPFWIVKSKRAILNRKTHTIRLEKPYLEIFGNSIFYFPLIEIPDETVVRKTGFLTPLFSSGEKQRFGVGIPYYLVISDNSDATFTFSPHPKKGILGEMELRKYFHSGKHTLHAAYMYNNNVESGEERHQAMLASIAEFEINPIWNLGWHLKKQTSGQLSYNYYSDALSKRININQIYLTGTGEKNSFDMRALHYHIQEPLSKNEKKFPQANIYPLIDYRYVDLQYAKSQQISITGNITAISRAKEKNTINQMKHDSQPWIPNGINRRLSIEADWRKKIIGPLGILFTPIANIRGDLHYLSFNRDLSSDTISNNPNFVASKMLTAGLDIRYPIVAVTQKSRHILEGIAQVYAATDEKYIKTIPNEDSHSLVLNSTSLFTQNRFSGFDRIEGGNRTNLGIRYIGSFNNLFTINGVIGRSIHILGTNSFSIPDSIGIGQNSGLEDKFSDYAAAVRLSLSPKITFSTQTLINPKDWSTRRTDTTIDYTMGSYEANISYTHIPAYPLYAYDARKTIQSRIKFKINDVLSADASLKWNMRAELPSHSIGLAYQNDCATVKIIYKNESPNIHGYKIQARLSLRTIGDFNPIDIDG
MRYNYRHLIGATTFFLAFNIITPQGTPPSNEQTTTSTPSKIKKNETNRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNIKLIEPDKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQRTIFDKGTYTACSSCSKPNSRPPFWIVKSKRAILNRKTHTIRLEKPYLEIFGNSIFYFPLIEIPDETVVRKTGFLTPLFSSGEKQRFGVGIPYYLVISDNSDATFTFSPHPKKGILGEMELRKYFHSGKHTLHAAYMYNNNVESGEERHQAMLASIAEFEINPIWNLGWHLKKQTSGQLSYNYYSDALSKRININQIYLTGTGEKNSFDMRALHYHIQEPLSKNEKKFPQANIYPLIDYRYVDLQYAKSQQISITGNITAISRAKEKNTINQMKHDSQPWIPNGINRRLSIEADWRKKIIGPLGILFTPIANIRGDLHYLSFNRDLSSDTISNNPNFVASKMLTAGLDIRYPIVAVTQKSRHILEGIAQVYAATDEKYIKTIPNEDSHSLVLNSTSLFTQNRFSGFDRIEGGNRTNLGIRYIGSFNNLFTINGVIGRSIHILGTNSFSIPDSIGIGQNSGLEDKFSDYAAAVRLSLSPKITFSTQTLINPKDWSTRRTDTTIDYTMGSYEANISYTHIPAYPLYAYDARKTIQSRIKFKINDVLSADASLKWNMRAELPSHSIGLAYQNDCATVKIIYKNESPNIHGYKIQARLSLRTIGDFNPIDIDG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target762 organic solvent tolerance protein [Candidatus Liberibac
315122193769 organic solvent tolerance protein [Candidatus Liberibac 1 0.0
190891134776 organic solvent tolerance protein [Rhizobium etli CIAT 1 1e-144
209548669780 organic solvent tolerance protein [Rhizobium leguminosa 1 1e-141
86357090776 putative organic solvent tolerance protein OstA [Rhizob 1 1e-141
241203947776 organic solvent tolerance protein [Rhizobium leguminosa 1 1e-140
116251333775 outer membrane protein involved in envelope biosynthesi 1 1e-139
222085451780 organic solvent tolerance protein OstA [Agrobacterium r 1 1e-139
222148151777 organic solvent tolerance protein [Agrobacterium vitis 1 1e-135
227821474782 putative organic solvent tolerance protein OstA [Sinorh 1 1e-135
150395987781 organic solvent tolerance protein [Sinorhizobium medica 1 1e-131
>gi|315122193|ref|YP_004062682.1| organic solvent tolerance protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 769 Back     alignment and organism information
 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/768 (56%), Positives = 559/768 (72%), Gaps = 21/768 (2%)

Query: 1   MRYNYRHLIGATTFFLAFNIIT-PQGTPPSNEQTTTSTPSKIKKNETNRHSELDISSDEI 59
           ++Y+Y+ L+    F     I T  Q    SN++   ++       E    + L +SSD +
Sbjct: 4   VQYSYKFLVTIIIFLALSTIFTVAQEETSSNKKVINNSSPNKNDREYILDNNLLVSSDTL 63

Query: 60  VLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNIKLIEPDKRQIHAEYLD 119
           V   + + TT  G +KIEY GYH+ A  I  N +N RI+A+G IK+I+P+K  IHAEYL+
Sbjct: 64  VF--DLNKTTIKGKIKIEYNGYHMFADHIMLNRQNKRIVANGGIKIIKPNKHIIHAEYLN 121

Query: 120 ITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQR-TIFDKGTYTACSSCSKPNSRPPFW 178
           IT DF NGIIKNLTI +P ++TY+TAS A++I ++ TIF +GTYTAC+ C +  + P FW
Sbjct: 122 ITQDFKNGIIKNLTIDLP-NKTYITASKAKLINEKNTIFTQGTYTACAKCVQSPNSPLFW 180

Query: 179 IVKSKRAILNRKTHTIRLEKPYLEIFGNSIFYFPLIEIPDETVVRKTGFLTPLFSSGEKQ 238
           +VKSK+ ILNR+TH IRLEK YLE FG  + Y P+IEIPDETV RKTG LTP+FS G  Q
Sbjct: 181 MVKSKKIILNRQTHMIRLEKTYLEFFGYPVIYLPMIEIPDETVTRKTGLLTPIFSIGSMQ 240

Query: 239 RFGVGIPYYLVISDNSDATFTFSPHPKKGILGEMELRKYFHSGKHTLHAAYMYNN-NVES 297
           +FG GIPYY+VISD+SDAT TFSP+P+KGIL E+E+RK F SG HTLHAAYMYN  NV +
Sbjct: 241 KFGFGIPYYVVISDSSDATITFSPYPRKGILNEIEVRKCFKSGMHTLHAAYMYNAFNVAN 300

Query: 298 GEE--RHQAMLASIAEFEINPIWNLGWHLKKQTSGQLSYNYYSDALSKRININQIYLTGT 355
            +E  RHQAML+SIA+F+INPIWN GW+L  QT  Q SY YYS  LS +   N+IYLTGT
Sbjct: 301 NQEEPRHQAMLSSIAKFQINPIWNFGWNLTAQTPHQTSYIYYSSPLSLKTKENKIYLTGT 360

Query: 356 GEKNSFDMRALHYHIQEPLSKNEKKFPQANIYPLIDYRYVDLQYAKSQQISITGNITAIS 415
           GEKNS D+RALHY+ Q  LS  E +  QAN+YPLIDY YV+ QY+K +++SITGNITAIS
Sbjct: 361 GEKNSIDIRALHYYTQGSLSPRESQLTQANVYPLIDYLYVNPQYSKREELSITGNITAIS 420

Query: 416 RAKEKNTINQMKHDSQPW---IPNGINRRLSIEADWRKKIIGPLGILFTPIANIRGDLHY 472
           RA+ K  +N     + P+    P G+N+RLS++ D+++  I PLGI  TP+ N+RGDLH 
Sbjct: 421 RAEPKTIVN----STNPYEIRFPYGLNKRLSMDLDFKRNFITPLGISLTPLLNLRGDLHS 476

Query: 473 LSFNRD-LSSDTISNNPNFVASKMLTAGLDIRYPIVAVTQKSRHILEGIAQVYAATDEKY 531
           LS  +D L+   + +N NF+   M T G+DIRYPIVA+TQ SRH+LEGI+QVY  T+E+ 
Sbjct: 477 LSSKKDSLNHSLLRDNKNFIVRGMTTLGIDIRYPIVAITQASRHVLEGISQVYLGTNEQS 536

Query: 532 IKTIPNEDSHSLVLNSTSLFTQNRFSGFDRIEGGNRTNLGIRYIGSFNNLFTINGVIGRS 591
           IK IPNED+ SL+LNSTSLFT+N+FSGFDRIEGG+R N+G+RY G F + FTI+G++G+S
Sbjct: 537 IKNIPNEDAQSLMLNSTSLFTRNKFSGFDRIEGGSRANIGVRYTGVFKDKFTIHGILGQS 596

Query: 592 IHILGTNSFSIPDSIGIGQNSGLEDKFSDYAAAVRLSLSPKITFSTQTLINPKDWSTRRT 651
           IH+ G NSFS+PD IGI QNSGLEDK SDY  A +LSL   I  S Q LIN K  + RR 
Sbjct: 597 IHLFGKNSFSLPDPIGIEQNSGLEDKLSDYVGAAKLSLPSNIMLSIQALINQKKLTVRRM 656

Query: 652 DTTIDYTMGSYEANISYTHIPAYPLYAY-DARKTIQSRIKFKINDVLSADASLKWNMRAE 710
           DT+IDYT+ S+++++++THIP Y LY + D R  +QS++KFKIN+V SA+ASLKWN+  +
Sbjct: 657 DTSIDYTLNSFQSSLNFTHIPRYSLYHHNDVRDMVQSKVKFKINNVFSANASLKWNINNQ 716

Query: 711 ----LPSHSIGLAYQNDCATVKIIYKNESPNIHGYKIQARLSLRTIGD 754
               +PSHSIGL+YQNDC T  I Y N S  I+ Y I+A LSLRTIG+
Sbjct: 717 NANYIPSHSIGLSYQNDCTTFNISYNNLSSKINNYTIKAELSLRTIGE 764


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891134|ref|YP_001977676.1| organic solvent tolerance protein [Rhizobium etli CIAT 652] Length = 776 Back     alignment and organism information
>gi|209548669|ref|YP_002280586.1| organic solvent tolerance protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 780 Back     alignment and organism information
>gi|86357090|ref|YP_468982.1| putative organic solvent tolerance protein OstA [Rhizobium etli CFN 42] Length = 776 Back     alignment and organism information
>gi|241203947|ref|YP_002975043.1| organic solvent tolerance protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 776 Back     alignment and organism information
>gi|116251333|ref|YP_767171.1| outer membrane protein involved in envelope biosynthesis [Rhizobium leguminosarum bv. viciae 3841] Length = 775 Back     alignment and organism information
>gi|222085451|ref|YP_002543981.1| organic solvent tolerance protein OstA [Agrobacterium radiobacter K84] Length = 780 Back     alignment and organism information
>gi|222148151|ref|YP_002549108.1| organic solvent tolerance protein [Agrobacterium vitis S4] Length = 777 Back     alignment and organism information
>gi|227821474|ref|YP_002825444.1| putative organic solvent tolerance protein OstA [Sinorhizobium fredii NGR234] Length = 782 Back     alignment and organism information
>gi|150395987|ref|YP_001326454.1| organic solvent tolerance protein [Sinorhizobium medicae WSM419] Length = 781 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target762 organic solvent tolerance protein [Candidatus Liberibac
pfam04453382 pfam04453, OstA_C, Organic solvent tolerance protein 2e-35
PRK03761778 PRK03761, PRK03761, LPS assembly outer membrane complex 1e-08
PRK04423798 PRK04423, PRK04423, organic solvent tolerance protein; 1e-08
COG1452784 COG1452, Imp, Organic solvent tolerance protein OstA [C 2e-83
>gnl|CDD|113232 pfam04453, OstA_C, Organic solvent tolerance protein Back     alignment and domain information
>gnl|CDD|179645 PRK03761, PRK03761, LPS assembly outer membrane complex protein LptD; Provisional Back     alignment and domain information
>gnl|CDD|179846 PRK04423, PRK04423, organic solvent tolerance protein; Provisional Back     alignment and domain information
>gnl|CDD|31641 COG1452, Imp, Organic solvent tolerance protein OstA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 762 organic solvent tolerance protein [Candidatus Liberibac
PRK04423798 organic solvent tolerance protein; Provisional 100.0
PRK03761782 organic solvent tolerance protein; Provisional 100.0
COG1452784 Imp Organic solvent tolerance protein OstA [Cell envelo 100.0
pfam04453382 OstA_C Organic solvent tolerance protein. Family involv 100.0
COG1452784 Imp Organic solvent tolerance protein OstA [Cell envelo 99.3
PRK04423798 organic solvent tolerance protein; Provisional 99.26
pfam03968141 OstA OstA-like protein. This family of proteins are mos 99.23
PRK10894184 hypothetical protein; Provisional 99.22
COG1934173 Uncharacterized protein conserved in bacteria [Function 99.07
COG1934173 Uncharacterized protein conserved in bacteria [Function 98.51
pfam03968141 OstA OstA-like protein. This family of proteins are mos 98.31
PRK10894184 hypothetical protein; Provisional 98.08
pfam06835176 DUF1239 Protein of unknown function (DUF1239). This fam 97.59
PRK03761782 organic solvent tolerance protein; Provisional 99.05
TIGR03002150 outer_YhbN cell envelope biogenesis protein YhbN; Inter 98.96
pfam06835176 DUF1239 Protein of unknown function (DUF1239). This fam 98.33
COG5375216 Uncharacterized protein conserved in bacteria [Function 97.34
PRK10893190 hypothetical protein; Provisional 96.75
TIGR03002150 outer_YhbN cell envelope biogenesis protein YhbN; Inter 98.0
cd07306276 Porin3_VDAC Voltage-dependent anion channel of the oute 96.69
pfam01459272 Porin_3 Eukaryotic porin. 96.55
PRK09980230 ompL outer membrane porin L; Provisional 90.92
PRK10716437 long-chain fatty acid outer membrane transporter; Provi 92.1
>PRK04423 organic solvent tolerance protein; Provisional Back     alignment and domain information
>PRK03761 organic solvent tolerance protein; Provisional Back     alignment and domain information
>COG1452 Imp Organic solvent tolerance protein OstA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam04453 OstA_C Organic solvent tolerance protein Back     alignment and domain information
>COG1452 Imp Organic solvent tolerance protein OstA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK04423 organic solvent tolerance protein; Provisional Back     alignment and domain information
>pfam03968 OstA OstA-like protein Back     alignment and domain information
>PRK10894 hypothetical protein; Provisional Back     alignment and domain information
>COG1934 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1934 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam03968 OstA OstA-like protein Back     alignment and domain information
>PRK10894 hypothetical protein; Provisional Back     alignment and domain information
>pfam06835 DUF1239 Protein of unknown function (DUF1239) Back     alignment and domain information
>PRK03761 organic solvent tolerance protein; Provisional Back     alignment and domain information
>TIGR03002 outer_YhbN cell envelope biogenesis protein YhbN; InterPro: IPR014340 Members of this entry include YhbN, which is an essential protein in Escherichia coli Back     alignment and domain information
>pfam06835 DUF1239 Protein of unknown function (DUF1239) Back     alignment and domain information
>COG5375 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10893 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03002 outer_YhbN cell envelope biogenesis protein YhbN; InterPro: IPR014340 Members of this entry include YhbN, which is an essential protein in Escherichia coli Back     alignment and domain information
>cd07306 Porin3_VDAC Voltage-dependent anion channel of the outer mitochondrial membrane Back     alignment and domain information
>pfam01459 Porin_3 Eukaryotic porin Back     alignment and domain information
>PRK09980 ompL outer membrane porin L; Provisional Back     alignment and domain information
>PRK10716 long-chain fatty acid outer membrane transporter; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target762 organic solvent tolerance protein [Candidatus Liberibac
2r19_A159 Crystal Structure Of The Periplasmic Lipopolysaccha 7e-04
>gi|186972769|pdb|2R19|A Chain A, Crystal Structure Of The Periplasmic Lipopolysaccharide Transport Protein Lpta (Yhbn), Orthorhombic Form Length = 159 Back     alignment and structure
 Score = 51.1 bits (120), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 16/101 (15%), Positives = 36/101 (35%), Gaps = 4/101 (3%)

Query: 47  NRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNIKLI 106
           +    + I SD+  L+ +G+  T  GNV +      ++A  +            G  ++I
Sbjct: 5   DTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGE---QGK-EVI 60

Query: 107 EPDKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYLTASS 147
           +   +      +        G    +  ++  D   LT ++
Sbjct: 61  DGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNA 101


Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target762 organic solvent tolerance protein [Candidatus Liberibac
2r19_A159 Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, s 99.2
3my2_A175 Lipopolysaccharide export system protein LPTC; lipopoly 97.53
3my2_A175 Lipopolysaccharide export system protein LPTC; lipopoly 98.29
2r19_A159 Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, s 98.2
3emn_X295 Voltage-dependent anion-selective channel protein 1; VD 94.41
>2r19_A Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure
Probab=99.20  E-value=6.9e-10  Score=81.64  Aligned_cols=86  Identities=16%  Similarity=0.170  Sum_probs=63.5

Q ss_pred             CCCCCEEEEEEEEEEEECCCCEEEEEEEEEEEECCEEEEEEEEEEECCCC-----EEEEECCEEE-E----CCCCCEEEE
Q ss_conf             76666079992079997668979999879999899699951899986378-----7999734899-8----389878997
Q gi|254780395|r   46 TNRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNH-----RIIASGNIKL-I----EPDKRQIHA  115 (762)
Q Consensus        46 ~~~~~~~~~~ad~~~~~~~~~~~~a~G~v~i~~~~~~l~Ad~i~y~~~~~-----~~~a~G~v~~-~----~~~g~~~~~  115 (762)
                      ...+.||.|+||.|+||...+.++++|||+|.++++.|+||++++....+     .+.+.|++.. .    +.+.....|
T Consensus         4 ~D~~qpi~I~Ad~l~~d~~~~~~~~~GnV~i~~g~~~i~ad~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~a   83 (159)
T 2r19_A            4 GDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHA   83 (159)
T ss_dssp             GGGGSCEEEEESEEEEETTTTEEEEEEEEEEEETTEEEEEEEEEEECCC--CTTCEEEEECSSCEEEECCTTSCCEEEEC
T ss_pred             CCCCCCEEEEECEEEEECCCCEEEEECCEEEEECCEEEEEEEEEEEECCCCCCEEEEEECCCEEEEEEEECCCCEEEEEE
T ss_conf             67789989997779966089999998148998487699997799995377652146762143168999715884399999


Q ss_pred             EEEEEECCCCEEEEEE
Q ss_conf             0699943025599984
Q gi|254780395|r  116 EYLDITDDFTNGIIKN  131 (762)
Q Consensus       116 ~~~~~~~~~~~g~~~~  131 (762)
                      +++.|+.+.+...+.+
T Consensus        84 ~~~~Y~~~~~~~~l~G   99 (159)
T 2r19_A           84 SQMHYELAKDFVVLTG   99 (159)
T ss_dssp             SEEEEEGGGTEEEEEE
T ss_pred             EEEEEECCCCEEEEEC
T ss_conf             8999977799999964



>3my2_A Lipopolysaccharide export system protein LPTC; lipopolysaccharide export pathway, structural genomics scottish structural proteomics facility; 2.20A {Escherichia coli} Back     alignment and structure
>3my2_A Lipopolysaccharide export system protein LPTC; lipopolysaccharide export pathway, structural genomics scottish structural proteomics facility; 2.20A {Escherichia coli} Back     alignment and structure
>2r19_A Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure
>3emn_X Voltage-dependent anion-selective channel protein 1; VDAC1, eukaryotic membrane protein, beta barrel, acetylation, alternative splicing, apoptosis; HET: MC3; 2.30A {Mus musculus} PDB: 2k4t_A 2jk4_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 762 organic solvent tolerance protein [Candidatus Libe
2r19_A_159 (A:) Protein YHBN; beta-jellyroll, mainly beta, be 6e-10
>2r19_A (A:) Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_ALength = 159 Back     alignment and structure
 Score = 60.9 bits (147), Expect = 6e-10
 Identities = 20/152 (13%), Positives = 44/152 (28%), Gaps = 12/152 (7%)

Query: 45  ETNRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHRIIASGNI- 103
             +    + I SD+  L+ +G+  T  GNV +      ++A  +                
Sbjct: 3   TGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDG 62

Query: 104 --KLIEPDKRQIHAEYLDITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQRTIFD--K 159
             K     + Q + + ++      +  +    + +     YL    + I G +  +   +
Sbjct: 63  YGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVL-TGNAYLQQVDSNIKGDKITYLVKE 121

Query: 160 GTYTACSSCSKPNSRPPFWIVKSKRAILNRKT 191
               A S                  + L  K 
Sbjct: 122 QKMQAFSDKG------KRVTTVLVPSQLQDKN 147


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target762 organic solvent tolerance protein [Candidatus Liberibac
2r19_A_159 Protein YHBN; beta-jellyroll, mainly beta, beta-TA 99.75
2r19_A_159 Protein YHBN; beta-jellyroll, mainly beta, beta-TA 98.45
3emn_X_295 Voltage-dependent anion-selective channel protein 95.8
>2r19_A (A:) Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure
Probab=99.75  E-value=1.3e-17  Score=134.25  Aligned_cols=142  Identities=11%  Similarity=0.060  Sum_probs=113.4

Q ss_pred             CCCCCCEEEEEEEEEEEECCCCEEEEEEEEEEEECCEEEEEEEEEEECCCCE-----------EEEECCEEEECCCCCEE
Q ss_conf             7766660799920799976689799998799998996999518999863787-----------99973489983898789
Q gi|254780395|r   45 ETNRHSELDISSDEIVLNSEGSTTTAVGNVKIEYKGYHLSARDITFNHKNHR-----------IIASGNIKLIEPDKRQI  113 (762)
Q Consensus        45 ~~~~~~~~~~~ad~~~~~~~~~~~~a~G~v~i~~~~~~l~Ad~i~y~~~~~~-----------~~a~G~v~~~~~~g~~~  113 (762)
                      +.+.+.|+.|+||.|+|+...+.++|+|||+|.+++.+|+||+++|+++++.           +.+.|+|++.+ ++..+
T Consensus         3 ~~~~~~~i~i~Ad~~~~~~~~~~~~~~GnV~i~~~~~~l~ad~~~~~~~~~~~~~~~~~~~~~~~~~g~v~~~~-~~~~~   81 (159)
T 2r19_A            3 TGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNG-KPVEG   81 (159)
T ss_dssp             GGGGGSCEEEEESEEEEETTTTEEEEEEEEEEEETTEEEEEEEEEEECCC--CTTCEEEEECSSCEEEECCTTS-CCEEE
T ss_pred             CCCCCCCEEEEECEEEEECCCCEEEEECCEEEEECCEEEEEEEEEEEECCCCCCEEEEEEECCCEEEEEECCCC-CEEEE
T ss_conf             76778997999565992356999999756899808679999899999778866425787513411899951688-33999


Q ss_pred             EEEEEEEECCCCEEEEEEEEEEEECCCEEEEEEEEEECCCEEEEEEEEEEECCCCCCCCCCCCEEEEEEEEEEEECCCCE
Q ss_conf             97069994302559998479997067502102468723975999987997313766577888508999669999677777
Q gi|254780395|r  114 HAEYLDITDDFTNGIIKNLTIKIPADETYLTASSAQIIGQRTIFDKGTYTACSSCSKPNSRPPFWIVKSKRAILNRKTHT  193 (762)
Q Consensus       114 ~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T~C~~~~~~~~~~P~W~i~a~~i~~d~~~~~  193 (762)
                      .|+++.++.+.+.+.+.+....... ...+.+..+     .+.++++.||+|.+++      |.|++.+.++.++++++.
T Consensus        82 ~~~~~~y~~~~~~~~~~g~~~~~~~-~~~~~g~~~-----~~~~~~~~~t~~~~~~------~~~~~~~~~~~~~~~~~~  149 (159)
T 2r19_A           82 HASQMHYELAKDFVVLTGNAYLQQV-DSNIKGDKI-----TYLVKEQKMQAFSDKG------KRVTTVLVPSQLQDKNNK  149 (159)
T ss_dssp             ECSEEEEEGGGTEEEEEEEEEEEET-TEEEEEEEE-----EEETTTTEEEEECSSS------CCCCCCC-----------
T ss_pred             EEEEEEEECCCCEEEEECCEEEEEC-CCEEEECEE-----EEEECCCEEEEECCCC------CCEEEEECCCCCCCCCCC
T ss_conf             9845799746888998067899958-999996789-----9991689999965899------945999998766768888


Q ss_pred             EEEECC
Q ss_conf             999442
Q gi|254780395|r  194 IRLEKP  199 (762)
Q Consensus       194 ~~~~~a  199 (762)
                      +.+.++
T Consensus       150 ~~a~~~  155 (159)
T 2r19_A          150 GQTPAQ  155 (159)
T ss_dssp             ------
T ss_pred             CCCCCC
T ss_conf             899767



>2r19_A (A:) Protein YHBN; beta-jellyroll, mainly beta, beta-TACO, structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI; 2.16A {Escherichia coli K12} PDB: 2r1a_A Back     alignment and structure
>3emn_X (X:) Voltage-dependent anion-selective channel protein 1; VDAC1, eukaryotic membrane protein, beta barrel, acetylation, alternative splicing, apoptosis; HET: MC3; 2.30A {Mus musculus} PDB: 2k4t_A 2jk4_A Back     alignment and structure