255764469

255764469

putative permease protein

GeneID in NCBI database:8209379Locus tag:CLIBASIA_01395
Protein GI in NCBI database:255764469Protein Accession:YP_003064807.2
Gene range:+(293686, 294771)Protein Length:361aa
Gene description:putative permease protein
COG prediction:[R] Predicted permeases
KEGG prediction:putative permease protein; K11720 lipopolysaccharide export system permease protein
SEED prediction:putative permease protein
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM6 TM-Helix
TOPPRED6 TM-Helix
HMMTOP6 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-
MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccEEEEEcccccEEEEEEEEEcccccEEccEEEEEEcccccEEEEEEEEEEEEEccEEEEEEEEEEEccccccccccEEEEccccHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccEEEEEEEEcccccEEccEEEEEEccccccEEEEEHHHEEEccccEEEEEEEEEccccccEEccccEEcccccHHHHEEEEcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccc
MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNqmgelpnysisrgAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVinpiatsgekIGIDLIQQWKdngdkqksdiipwmqisnpqqdifigakkilpenhiwedftsitidkknkiihrkdADLAIIYNDKVKLKKVVEYqygripidknsttlnipikmdGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLefsrsnqprIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG
MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTsitidkknkiihrkdadlaiiyndkvklKKVVEyqygripidknsttlniPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSlefsrsnqPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG
MPGILWRyffkyylkttlyfllGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPfitlvvnivvffnlnRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAAlipviltislsilillQKEDG
MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLI***************PWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDG********ASRSFYEIIKK*************RAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKED*
MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG
MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKE**
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxx
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiii
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG
MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG
MPGILWRYFFKYYLKTTLYFLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQQDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRIPIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIVIPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAAALIPVILTISLSILILLQKEDG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target361 putative permease protein [Candidatus Liberibacter asia
255764468361 permease protein [Candidatus Liberibacter asiaticu 0.003
254781193675 putative DNA polymerase from bacteriophage origin 0.007
>gi|255764468|ref|YP_003064806.2| permease protein [Candidatus Liberibacter asiaticus str. psy62] Length = 361 Back     alignment
 Score = 34.3 bits (77), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 50/98 (51%), Gaps = 2/98 (2%)

Query: 20  FLLGAMILVFVIDLNEIQNQMGELPNYSISRGAVL--AATRVPLIIQQIIPFITLVVNIV 77
           FL+  + +VF+  + +I  ++  + + + S   +L  +   +P ++  + PF   +    
Sbjct: 16  FLMSCLFIVFIAWVIQILQRINLVSSSTESLNILLKISGYLIPTVLPMVTPFCFAMETTN 75

Query: 78  VFFNLNRTSELVISRAIGISIWQLLNPFVVGSILLGIF 115
           V  ++NR +EL+I    G S   L+ P +  +ILL IF
Sbjct: 76  VLTSMNRNTELLIIDNTGTSRITLIKPVLFLAILLSIF 113

>gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Back     alignment
 Score = 33.1 bits (74), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 21/88 (23%)

Query: 136 QQWKDNGDKQKSDIIPWMQISNPQ---QDIFIGA-----KKILPENH-----IWEDFTSI 182
           ++W+D       +   WMQ ++P+   +D+FIG      KK   + H     +W +    
Sbjct: 473 EEWED-----AENFCRWMQENHPEHAIEDLFIGTACERVKKAWRQKHSRVSELWNELHQA 527

Query: 183 ---TIDKKNKIIHRKDADLAIIYNDKVK 207
              TI+    II RK  D+ ++Y  K K
Sbjct: 528 FEQTIENGKAIIARKRRDVPLVYMKKDK 555

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target361 putative permease protein [Candidatus Liberibacter asia
315122194321 putative permease protein [Candidatus Liberibacter sola 1 1e-125
218460846362 putative permease protein [Rhizobium etli Kim 5] Length 1 1e-72
325292486362 permease protein [Agrobacterium sp. H13-3] Length = 362 1 3e-72
86357091362 putative permease protein [Rhizobium etli CFN 42] Lengt 1 5e-72
327188011362 putative permease protein [Rhizobium etli CNPAF512] Len 1 8e-72
190891135362 permease [Rhizobium etli CIAT 652] Length = 362 1 2e-71
241203948362 permease YjgP/YjgQ family protein [Rhizobium leguminosa 1 2e-70
222085452361 permease protein [Agrobacterium radiobacter K84] Length 1 5e-70
116251334362 transmembrane protein [Rhizobium leguminosarum bv. vici 1 6e-70
15888447362 hypothetical protein Atu1107 [Agrobacterium tumefaciens 1 2e-69
>gi|315122194|ref|YP_004062683.1| putative permease protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 321 Back     alignment and organism information
 Score =  451 bits (1160), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 216/322 (67%), Positives = 271/322 (84%), Gaps = 1/322 (0%)

Query: 40  MGELPNYSISRGAVLAATRVPLIIQQIIPFITLVVNIVVFFNLNRTSELVISRAIGISIW 99
           M ELP YS SRGA+L+ TR+PLIIQQ IPFI+L+V+++VFFNLNRT+ELVI+RA+G+SIW
Sbjct: 1   MSELPGYSTSRGAMLSVTRLPLIIQQTIPFISLIVSMIVFFNLNRTNELVITRAVGVSIW 60

Query: 100 QLLNPFVVGSILLGIFTVLVINPIATSGEKIGIDLIQQWKDNGDKQKSDIIPWMQISNPQ 159
           QLL+PF  GS LLG+FT+LVINP+A SGEK+GI ++  W+ + D++  +IIPW+ I N +
Sbjct: 61  QLLSPFTTGSFLLGMFTILVINPMAVSGEKMGISMVNNWRTH-DQKTLEIIPWIHIENKK 119

Query: 160 QDIFIGAKKILPENHIWEDFTSITIDKKNKIIHRKDADLAIIYNDKVKLKKVVEYQYGRI 219
           +D FIGAKKILPE +I EDFT IT++K+N  I R+DA  AI+  + + LK+VVEY+YG +
Sbjct: 120 EDFFIGAKKILPEKNILEDFTFITVNKENDTIFRQDAHFAIVQKNNIYLKEVVEYKYGAL 179

Query: 220 PIDKNSTTLNIPIKMDGFQKFSEQFASRSFYEIIKKMSFSNKSNIFHNYRAETQFYFLIV 279
           P+ KNST LNI IKM+ FQKF+EQF S SFYEIIKK+ FS++S++F NY +ETQFYF+I 
Sbjct: 180 PVFKNSTILNIAIKMNYFQKFTEQFTSHSFYEIIKKVIFSHQSSVFRNYFSETQFYFMIS 239

Query: 280 IPLMLVAMTLIAASVSLEFSRSNQPRIIVAYGIFSGFMLYTIITIMKSFGKSGILLPVAA 339
           IP MLVAMTLIAA+VSLEF+RSNQPRIIV YG+ +GFMLYTIIT+MKSFGKSGILLP AA
Sbjct: 240 IPFMLVAMTLIAAAVSLEFNRSNQPRIIVTYGVCAGFMLYTIITLMKSFGKSGILLPFAA 299

Query: 340 ALIPVILTISLSILILLQKEDG 361
           ALIP+I  I LSI ILL+KEDG
Sbjct: 300 ALIPIISIICLSIFILLKKEDG 321


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218460846|ref|ZP_03500937.1| putative permease protein [Rhizobium etli Kim 5] Length = 362 Back     alignment and organism information
>gi|325292486|ref|YP_004278350.1| permease protein [Agrobacterium sp. H13-3] Length = 362 Back     alignment and organism information
>gi|86357091|ref|YP_468983.1| putative permease protein [Rhizobium etli CFN 42] Length = 362 Back     alignment and organism information
>gi|327188011|gb|EGE55241.1| putative permease protein [Rhizobium etli CNPAF512] Length = 362 Back     alignment and organism information
>gi|190891135|ref|YP_001977677.1| permease [Rhizobium etli CIAT 652] Length = 362 Back     alignment and organism information
>gi|241203948|ref|YP_002975044.1| permease YjgP/YjgQ family protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 362 Back     alignment and organism information
>gi|222085452|ref|YP_002543982.1| permease protein [Agrobacterium radiobacter K84] Length = 361 Back     alignment and organism information
>gi|116251334|ref|YP_767172.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 362 Back     alignment and organism information
>gi|15888447|ref|NP_354128.1| hypothetical protein Atu1107 [Agrobacterium tumefaciens str. C58] Length = 362 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target361 putative permease protein [Candidatus Liberibacter asia
pfam03739353 pfam03739, YjgP_YjgQ, Predicted permease YjgP/YjgQ fami 5e-30
COG0795364 COG0795, COG0795, Predicted permeases [General function 1e-33
>gnl|CDD|146398 pfam03739, YjgP_YjgQ, Predicted permease YjgP/YjgQ family Back     alignment and domain information
>gnl|CDD|31138 COG0795, COG0795, Predicted permeases [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 361 putative permease protein [Candidatus Liberibacter asia
pfam03739353 YjgP_YjgQ Predicted permease YjgP/YjgQ family. Members 100.0
COG0795364 Predicted permeases [General function prediction only] 100.0
COG4591408 LolE ABC-type transport system, involved in lipoprotein 90.89
>pfam03739 YjgP_YjgQ Predicted permease YjgP/YjgQ family Back     alignment and domain information
>COG0795 Predicted permeases [General function prediction only] Back     alignment and domain information
>COG4591 LolE ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00