254780396

254780396

peptidyl-prolyl cis-trans isomerase protein

GeneID in NCBI database:8209381Locus tag:CLIBASIA_01405
Protein GI in NCBI database:254780396Protein Accession:YP_003064809.1
Gene range:+(297120, 298073)Protein Length:317aa
Gene description:peptidyl-prolyl cis-trans isomerase protein
COG prediction:[O] Parvulin-like peptidyl-prolyl isomerase
KEGG prediction:peptidyl-prolyl cis-trans isomerase protein; K03771 peptidyl-prolyl cis-trans isomerase SurA [EC:5.2.1.8]
SEED prediction:Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Peptidyl-prolyl cis-trans isomerase;
Periplasmic Stress Response
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY
cccHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccEEccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHccHHHHHHHHcccccEEccEEcccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccccccccccccccHHHHHHHHHHHHHHHHHHcHcHHHcccEEEEEcccEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHHcccccccHHHHHHHHccccccccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHccccccccccHHHccHHHHHHHHHccccccccEcccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEcc
MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTingevitdgdISKRIALLKLQKINGELEKIAVQELIVETLKKQEIeksgitfdsntVNYFFVQHArntglsaedfssfldkqgigdnHFKQYLAIQsiwpdvvkndfmlkygnlemeipankqkmkNITVREYLIRTVlfsipdnklqnQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKksqnnttnpyvtqkgveYIAICDKRDLGGEIALKAYLsaqntptkIEKHEAEYVKKLRSNAIIHYY
MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTtingevitdgdiSKRIALLKLQKINGELEKIAVQELIVETLKKQEIEksgitfdsnTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEmeipankqkmknITVREYLIRTVlfsipdnklqnqGFVQKRIKDAeesrlrlpkdcNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKksqnnttnpyvtqkgvEYIAICDKRDLGGEIALKAYlsaqntptkiekheaeyvKKLRSNAIIHYY
MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY
********LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISK********************ELIVETLKKQEIEKSGITFDSNTVNYFFVQH**********FSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLE******************LIRTVLFSI************************************************YLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKR**************************EYVKKLRSNAIIHYY
********LSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY
****VFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY
MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY
MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHYY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target317 peptidyl-prolyl cis-trans isomerase protein [Candidatus
255764467 565 Type I secretion system ATPase, PrtD [Candidatus L 0.048
>gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Back     alignment
 Score = 30.0 bits (66), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 4/42 (9%)

Query: 1   MTSKVFTSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRI 42
           +TS V  +L D   L T  F+++ FCI PI+   SWA+ S I
Sbjct: 123 ITSPVLPALLDI--LFTPIFIILSFCIHPILG--SWAILSGI 160

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target317 peptidyl-prolyl cis-trans isomerase protein [Candidatus
315122192315 peptidyl-prolyl cis-trans isomerase protein [Candidatus 1 8e-95
222085450316 peptidyl-prolyl cis-trans isomerase protein [Agrobacter 1 6e-41
86357089314 peptidyl-prolyl cis-trans isomerase protein [Rhizobium 1 8e-37
218671035314 probable peptidyl-prolyl cis-trans isomerase protein [R 1 2e-35
218461597313 probable peptidyl-prolyl cis-trans isomerase protein [R 1 1e-34
218661101295 peptidyl-prolyl cis-trans isomerase protein [Rhizobium 1 1e-34
327188010314 putative peptidyl-prolyl cis-trans isomerase protein [R 1 3e-34
150395986315 SurA domain-containing protein [Sinorhizobium medicae W 1 4e-34
209548668314 peptidyl-prolyl cis-trans isomerase protein [Rhizobium 1 5e-34
190891133314 peptidyl-prolyl cis-trans isomerase [Rhizobium etli CIA 1 9e-34
>gi|315122192|ref|YP_004062681.1| peptidyl-prolyl cis-trans isomerase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 315 Back     alignment and organism information
 Score =  351 bits (900), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 184/312 (58%), Positives = 241/312 (77%), Gaps = 5/312 (1%)

Query: 7   TSLSDFIKLLTTYFVLIIFCIVPIVSYKSWAMSSRIRTTINGEVITDGDISKRIALLKLQ 66
           +S + F KLL    VLI  C  P   Y+S A+SS+I  T+NGE ITDGDISKRIA LKL+
Sbjct: 7   SSFNGFSKLLAVCVVLIA-CFYP---YESSAISSQISITVNGEAITDGDISKRIAFLKLR 62

Query: 67  KINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDK 126
           KING+L+KIA QELI E LKKQE E  GI  + N++NYFF Q+ARNTG+SAE+FS  L+ 
Sbjct: 63  KINGDLKKIAKQELIAEALKKQESEGFGIILNPNSMNYFFAQYARNTGISAEEFSDMLEH 122

Query: 127 QGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPAN-KQKMKNITVREYLIRTVLF 185
            GIG+NHFKQYLAIQ  W ++V+N F++KY  L ME+P + K + KN+TVREYL++ ++F
Sbjct: 123 LGIGENHFKQYLAIQLAWDEIVRNTFIMKYRGLGMEMPPSIKGRGKNLTVREYLVKKIIF 182

Query: 186 SIPDNKLQNQGFVQKRIKDAEESRLRLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQ 245
           S+P NK +N+ F+QKRI +AE+SR   P +CN++E+FAS +HDVS+   QY LESDL PQ
Sbjct: 183 SVPYNKHKNEDFIQKRIDEAEKSRFHFPTNCNRVEEFASAMHDVSVSNPQYFLESDLQPQ 242

Query: 246 FQNLLKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYV 305
            + LLKK++NNTTN YVT+KGVEYIAIC+ RD+GGE+ALKAY + Q  P K++K++ EY+
Sbjct: 243 LKILLKKTKNNTTNTYVTEKGVEYIAICNIRDIGGELALKAYFNTQEIPKKMKKYDEEYM 302

Query: 306 KKLRSNAIIHYY 317
           K LR+NAII +Y
Sbjct: 303 KTLRANAIIQFY 314


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085450|ref|YP_002543980.1| peptidyl-prolyl cis-trans isomerase protein [Agrobacterium radiobacter K84] Length = 316 Back     alignment and organism information
>gi|86357089|ref|YP_468981.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli CFN 42] Length = 314 Back     alignment and organism information
>gi|218671035|ref|ZP_03520706.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli GR56] Length = 314 Back     alignment and organism information
>gi|218461597|ref|ZP_03501688.1| probable peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli Kim 5] Length = 313 Back     alignment and organism information
>gi|218661101|ref|ZP_03517031.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli IE4771] Length = 295 Back     alignment and organism information
>gi|327188010|gb|EGE55240.1| putative peptidyl-prolyl cis-trans isomerase protein [Rhizobium etli CNPAF512] Length = 314 Back     alignment and organism information
>gi|150395986|ref|YP_001326453.1| SurA domain-containing protein [Sinorhizobium medicae WSM419] Length = 315 Back     alignment and organism information
>gi|209548668|ref|YP_002280585.1| peptidyl-prolyl cis-trans isomerase protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 314 Back     alignment and organism information
>gi|190891133|ref|YP_001977675.1| peptidyl-prolyl cis-trans isomerase [Rhizobium etli CIAT 652] Length = 314 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target317 peptidyl-prolyl cis-trans isomerase protein [Candidatus
pfam09312118 pfam09312, SurA_N, SurA N-terminal domain 4e-05
>gnl|CDD|150092 pfam09312, SurA_N, SurA N-terminal domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 317 peptidyl-prolyl cis-trans isomerase protein [Candidatus
PRK10770428 peptidyl-prolyl cis-trans isomerase SurA; Provisional 100.0
PRK00059336 prsA peptidylprolyl isomerase; Provisional 100.0
PRK10788 622 peptidyl-prolyl cis-trans isomerase (rotamase D); Provi 100.0
PRK03002285 prsA peptidylprolyl isomerase; Reviewed 100.0
PRK04405298 prsA peptidylprolyl isomerase; Provisional 100.0
PRK02998283 prsA peptidylprolyl isomerase; Reviewed 100.0
PRK03095287 prsA peptidylprolyl isomerase; Reviewed 100.0
PRK01326310 prsA foldase protein PrsA; Reviewed 99.97
PRK12450309 foldase protein PrsA; Reviewed 99.96
COG0760320 SurA Parvulin-like peptidyl-prolyl isomerase [Posttrans 99.79
pfam09312118 SurA_N SurA N-terminal domain. This domain is found at 99.82
TIGR02933270 nifM_nitrog nitrogen fixation protein NifM; InterPro: I 99.81
PRK10770 428 peptidyl-prolyl cis-trans isomerase SurA; Provisional 99.73
TIGR02925236 cis_trans_EpsD peptidyl-prolyl cis-trans isomerase, Eps 99.7
pfam0063995 Rotamase PPIC-type PPIASE domain. Rotamases increase th 99.43
KOG3259163 consensus 99.0
KOG3258133 consensus 98.6
PRK10788 622 peptidyl-prolyl cis-trans isomerase (rotamase D); Provi 97.67
pfam05698162 Trigger_C Bacterial trigger factor protein (TF) C-termi 96.15
PRK01490 435 tig trigger factor; Provisional 95.33
>PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>PRK00059 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK10788 peptidyl-prolyl cis-trans isomerase (rotamase D); Provisional Back     alignment and domain information
>PRK03002 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK04405 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK02998 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK03095 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK01326 prsA foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK12450 foldase protein PrsA; Reviewed Back     alignment and domain information
>COG0760 SurA Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam09312 SurA_N SurA N-terminal domain Back     alignment and domain information
>TIGR02933 nifM_nitrog nitrogen fixation protein NifM; InterPro: IPR014282 Members of this entry are found in a subset of nitrogen-fixing bacteria and are annotated as nitrogen fixation protein NifM Back     alignment and domain information
>PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>TIGR02925 cis_trans_EpsD peptidyl-prolyl cis-trans isomerase, EpsD family; InterPro: IPR014274 Proteins in this entry include EpsD from Methylobacillus sp Back     alignment and domain information
>pfam00639 Rotamase PPIC-type PPIASE domain Back     alignment and domain information
>KOG3259 consensus Back     alignment and domain information
>KOG3258 consensus Back     alignment and domain information
>PRK10788 peptidyl-prolyl cis-trans isomerase (rotamase D); Provisional Back     alignment and domain information
>pfam05698 Trigger_C Bacterial trigger factor protein (TF) C-terminus Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target317 peptidyl-prolyl cis-trans isomerase protein [Candidatus
2pv3_A299 Crystallographic Structure Of Sura Fragment Lacking 1e-21
1m5y_A 408 Crystallographic Structure Of Sura, A Molecular Cha 1e-19
1m5y_A408 Crystallographic Structure Of Sura, A Molecular Cha 4e-14
3rgc_A252 The Virulence Factor Peb4 And The Periplasmic Prote 1e-10
3rfw_A252 The Virulence Factor Peb4 And The Periplasmic Prote 2e-10
3nrk_A325 The Crystal Structure Of The Leptospiral Hypothetic 2e-09
1zk6_A93 Nmr Solution Structure Of B. Subtilis Prsa Ppiase L 4e-08
3gpk_A112 Crystal Structure Of Ppic-Type Peptidyl-Prolyl Cis- 9e-08
1jns_A92 Nmr Structure Of The E. Coli Peptidyl-Prolyl CisTRA 2e-07
2pv1_A103 Crystallographic Structure Of Sura First Peptidyl-P 2e-07
3kad_A167 Structure-Guided Design Of Alpha-Amino Acid-Derived 2e-06
1fjd_A104 Human Parvulin-Like Peptidyl Prolyl CisTRANS ISOMER 2e-06
2itk_A167 Human Pin1 Bound To D-Peptide Length = 167 3e-06
1f8a_B167 Structural Basis For The Phosphoserine-Proline Reco 3e-06
3kac_A123 Structure-Guided Design Of Alpha-Amino Acid-Derived 3e-06
2zqv_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 4e-06
2zqu_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 4e-06
2zr5_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 4e-06
2zr6_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 4e-06
1pin_A163 Pin1 Peptidyl-Prolyl Cis-Trans Isomerase From Homo 4e-06
2zr4_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 5e-06
2f21_A162 Human Pin1 Fip Mutant Length = 162 5e-06
1zcn_A161 Human Pin1 Ng Mutant Length = 161 5e-06
3ik8_A123 Structure-Based Design Of Novel Pin1 Inhibitors (I) 5e-06
2zqs_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 5e-06
1nmw_A114 Solution Structure Of The Ppiase Domain Of Human Pi 7e-06
2zqt_A163 Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl 2e-05
1eq3_A96 Nmr Structure Of Human Parvulin Hpar14 Length = 96 2e-05
1j6y_A139 Solution Structure Of Pin1at From Arabidopsis Thali 3e-05
2kgj_A102 Solution Structure Of Parvulin Domain Of Ppid From 6e-05
2rqs_A97 3d Structure Of Pin From The Psychrophilic Archeon 1e-04
1yw5_A177 Peptidyl-Prolyl Isomerase Ess1 From Candida Albican 6e-05
>gi|158429505|pdb|2PV3|A Chain A, Crystallographic Structure Of Sura Fragment Lacking The Second Peptidyl-Prolyl Isomerase Domain Complexed With Peptide Nftlkfwdifrk Length = 299 Back     alignment and structure
 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/265 (13%), Positives = 87/265 (32%), Gaps = 6/265 (2%)

Query: 58  KRIALLKLQKINGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHARNTGLSA 117
                 +    +  L    ++ LI++ +  Q  +K G+      ++      A+   ++ 
Sbjct: 32  NAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTL 91

Query: 118 EDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVRE 177
           +   S L   G+  N ++  +  + I  +V  N+   +   L  E+ +  Q++ N     
Sbjct: 92  DQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQNDAS 151

Query: 178 YLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRLR---LPKDCNKLEKFASKIHDVSIGKA 234
             +      IP  +      V +    A     +              ++    ++ G+ 
Sbjct: 152 TELNLSHILIPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQM 211

Query: 235 QYLLESDLHPQFQNL-LKKSQNNTTNPYVTQKGVEYIAICDKRDLGGEIAL--KAYLSAQ 291
            +    +L   F        + +   P  +  G   + + D R     I+   K      
Sbjct: 212 GWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNISAAQKDRAYRM 271

Query: 292 NTPTKIEKHEAEYVKKLRSNAIIHY 316
               K  +  A ++++ R++A +  
Sbjct: 272 LMNRKFSEEAASWMQEQRASAYVKI 296


>gi|27065591|pdb|1M5Y|A Chain A, Crystallographic Structure Of Sura, A Molecular Chaperone That Facilitates Outer Membrane Porin Folding Length = 408 Back     alignment and structure
>gi|27065591|pdb|1M5Y|A Chain A, Crystallographic Structure Of Sura, A Molecular Chaperone That Facilitates Outer Membrane Porin Folding Length = 408 Back     alignment and structure
>gi|330689731|pdb|3RGC|A Chain A, The Virulence Factor Peb4 And The Periplasmic Protein Cj1289 Are Two Structurally Related Sura-Like Chaperones In The Human Pathogen Campylobacter Jejuni Length = 252 Back     alignment and structure
>gi|330689730|pdb|3RFW|A Chain A, The Virulence Factor Peb4 And The Periplasmic Protein Cj1289 Are Two Structurally-Related Sura-Like Chaperones In The Human Pathogen Campylobacter Jejuni Length = 252 Back     alignment and structure
>gi|312597426|pdb|3NRK|A Chain A, The Crystal Structure Of The Leptospiral Hypothetical Protein Lic12922 Length = 325 Back     alignment and structure
>gi|93278583|pdb|1ZK6|A Chain A, Nmr Solution Structure Of B. Subtilis Prsa Ppiase Length = 93 Back     alignment and structure
>gi|226192799|pdb|3GPK|A Chain A, Crystal Structure Of Ppic-Type Peptidyl-Prolyl Cis-Trans Isomerase Domain At 1.55a Resolution. Length = 112 Back     alignment and structure
>gi|33357145|pdb|1JNS|A Chain A, Nmr Structure Of The E. Coli Peptidyl-Prolyl CisTRANS- Isomerase Parvulin 10 Length = 92 Back     alignment and structure
>gi|158429497|pdb|2PV1|A Chain A, Crystallographic Structure Of Sura First Peptidyl-Prolyl Isomerase Domain Complexed With Peptide Weyipnv Length = 103 Back     alignment and structure
>gi|281500878|pdb|3KAD|A Chain A, Structure-Guided Design Of Alpha-Amino Acid-Derived Pin1 Inhibitors Length = 167 Back     alignment and structure
>gi|159162312|pdb|1FJD|A Chain A, Human Parvulin-Like Peptidyl Prolyl CisTRANS ISOMERASE, Hpar14 Length = 104 Back     alignment and structure
>gi|149242227|pdb|2ITK|A Chain A, Human Pin1 Bound To D-Peptide Length = 167 Back     alignment and structure
>gi|10120798|pdb|1F8A|B Chain B, Structural Basis For The Phosphoserine-Proline Recognition By Group Iv Ww Domains Length = 167 Back     alignment and structure
>gi|281500876|pdb|3KAC|A Chain A, Structure-Guided Design Of Alpha-Amino Acid-Derived Pin1 Inhibitors Length = 123 Back     alignment and structure
>gi|256599529|pdb|2ZQV|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>gi|256599528|pdb|2ZQU|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>gi|256599538|pdb|2ZR5|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>gi|256599539|pdb|2ZR6|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
gi|3891861|pdb|1PIN|A Chain A, Pin1 Peptidyl-Prolyl Cis-Trans Isomerase From Homo Sapiens Length = 163 Back     alignment and structure
>gi|256599537|pdb|2ZR4|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>gi|110591318|pdb|2F21|A Chain A, Human Pin1 Fip Mutant Length = 162 Back     alignment and structure
>gi|110590724|pdb|1ZCN|A Chain A, Human Pin1 Ng Mutant Length = 161 Back     alignment and structure
>gi|259090316|pdb|3IK8|A Chain A, Structure-Based Design Of Novel Pin1 Inhibitors (I) Length = 123 Back     alignment and structure
>gi|256599526|pdb|2ZQS|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>gi|159162752|pdb|1NMW|A Chain A, Solution Structure Of The Ppiase Domain Of Human Pin1 Length = 114 Back     alignment and structure
>gi|256599527|pdb|2ZQT|A Chain A, Crystal Structure Of A Mutant Pin1 Peptidyl-Prolyl Cis-Trans Isomerase Length = 163 Back     alignment and structure
>gi|13786637|pdb|1EQ3|A Chain A, Nmr Structure Of Human Parvulin Hpar14 Length = 96 Back     alignment and structure
>gi|22218833|pdb|1J6Y|A Chain A, Solution Structure Of Pin1at From Arabidopsis Thaliana Length = 139 Back     alignment and structure
>gi|284055341|pdb|2KGJ|A Chain A, Solution Structure Of Parvulin Domain Of Ppid From E.Coli Length = 102 Back     alignment and structure
>gi|312597019|pdb|2RQS|A Chain A, 3d Structure Of Pin From The Psychrophilic Archeon Cenarcheaum Symbiosum (Cspin) Length = 97 Back     alignment and structure
gi|66361212|pdb|1YW5|A Chain A, Peptidyl-Prolyl Isomerase Ess1 From Candida Albicans Length = 177 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target317 peptidyl-prolyl cis-trans isomerase protein [Candidatus
1m5y_A 408 SurviVal protein, surviVal protein SURA; surviVal prote 1e-12
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Length = 408 Back     alignment and structure
 Score = 69.0 bits (167), Expect = 1e-12
 Identities = 41/288 (14%), Positives = 91/288 (31%), Gaps = 12/288 (4%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQKING--------ELEKIAVQELIVETLKKQEIEK 92
           ++   +N  V+ + D+   +  +KL              L    ++ LI++ +  Q  +K
Sbjct: 7   KVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQK 66

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
            G+      ++      A+   ++ +   S L   G+  N ++  +  + I  +V  N+ 
Sbjct: 67  MGVKISDEQLDQAIANIAKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEV 126

Query: 153 MLKYGNLEMEIPA--NKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKDAEESRL 210
             +   L  E+ +   +   +N    E  +  +L  +P+N   +Q    +    A   + 
Sbjct: 127 RRRITILPQEVESLAQQVGNQNDASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQA 186

Query: 211 RLPKDCNKLEKFASKIHDVSIGKAQYLLESDLHPQFQNLLKKS--QNNTTNPYVTQKGVE 268
           R   D  KL    S       G           P        +  + +   P  +  G  
Sbjct: 187 RNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRSGVGFH 246

Query: 269 YIAICDKRDLGGEIALKAYLSAQNTPTKIEKHEAEYVKKLRSNAIIHY 316
            + + D R     I++    +             E  +          
Sbjct: 247 ILKVNDLRGESKNISVTEVHARHILLKPSPIMTDEQARVKLEQIAADI 294


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target317 peptidyl-prolyl cis-trans isomerase protein [Candidatus
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal prote 100.0
2pv1_A103 Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS 99.53
3i6c_A123 Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1 99.51
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase 99.49
3gpk_A112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase 99.49
2itk_A167 Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1 99.48
2jzv_A111 Foldase protein PRSA; ppiase, parvulin, proline isomera 99.45
1j6y_A139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, ph 99.39
1eq3_A96 Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; 99.3
1zk6_A93 Foldase protein PRSA; alpha/beta structure, isomerase; 99.13
1m5y_A 408 SurviVal protein, surviVal protein SURA; surviVal prote 98.56
1jns_A92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandw 99.42
2kgj_A102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase 99.38
2nsa_A170 Trigger factor, TF; chaperone; 1.70A {Thermotoga mariti 96.55
3gty_X433 Trigger factor, TF; chaperone-client complex, cell cycl 94.75
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ribosom 93.08
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Back     alignment and structure
Probab=100.00  E-value=2.1e-38  Score=260.58  Aligned_cols=280  Identities=15%  Similarity=0.233  Sum_probs=222.9

Q ss_pred             CCCCCCEEEEECCEECCHHHHHHHHHHHHHHC--------CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             11348269998867868899999999987303--------5035999999999999999864200122344456689999
Q gi|254780396|r   36 WAMSSRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFV  107 (317)
Q Consensus        36 ~~~~~~vvA~Vng~~It~~e~~~~~~~~~~~~--------~~~~~~~~~l~~LI~~~l~~~~a~~~~i~v~~~~i~~~i~  107 (317)
                      +...++|||+|||++||.+||++++..+..+.        ....+++++|++||++.|+.++|+++|+.|+++++++++.
T Consensus         2 ~~~~~~ivA~Vng~~It~~d~~~~~~~~~~~~~~~~~~~~~~~~lr~qvl~~LI~~~Ll~q~A~~lgi~vsd~ev~~~i~   81 (408)
T 1m5y_A            2 PQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIA   81 (408)
T ss_dssp             ---CCCEEEEESSSEEEHHHHHHHHHHHHHHHHTTTCCCCCHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHH
T ss_pred             CCCCCEEEEEECCEECCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             85347179999999628999999999999987632467984599999999999999999999998499979999999999


Q ss_pred             HHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCC------------
Q ss_conf             99973134303567777653112455469999998999999998432035558999864432111001------------
Q gi|254780396|r  108 QHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITV------------  175 (317)
Q Consensus       108 ~~~~~~~~~~~~~~~~l~~~g~t~~~~~~~i~~~l~~~~~~~~~~~~~i~~~~~e~~~~~~~~~~~~~------------  175 (317)
                      .+..+++++.+.+.+.|...|+++..|++.++.++.|.++....+.+.+.+++.++..++........            
T Consensus        82 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  161 (408)
T 1m5y_A           82 NIAKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQNDASTELNLSHILI  161 (408)
T ss_dssp             HHHHHTTCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHTCCCCTTHHHHHHHCC-------CCEEEEEEEE
T ss_pred             HHHHHCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHC
T ss_conf             99987142378899999973888788888788999999988665321014663567899987431013310332111101


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|254780396|r  176 --------------------------------------------------------------------------------  175 (317)
Q Consensus       176 --------------------------------------------------------------------------------  175 (317)
                                                                                                      
T Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~F~~~~~~~s~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~~g~i~~~~~~  241 (408)
T 1m5y_A          162 PLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELPGIFAQALSTAKKGDIVGPIRS  241 (408)
T ss_dssp             ECCSSCCHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHCCSTTGGGTTEEEEECGGGSCHHHHTGGGTCCTTCEEEEEEE
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHCCCCCCCCHHHCCHHHHHHHHHHCCCCCCCCCCC
T ss_conf             23331016789998877899999875100499998871236265526863323301100167888765135764454235


Q ss_pred             ---------------------CCHHHHHHHHHCCCCCCCCHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHCCC-CCCCCC
Q ss_conf             ---------------------100233322102467544479999864357-886522332489999852013-225687
Q gi|254780396|r  176 ---------------------REYLIRTVLFSIPDNKLQNQGFVQKRIKDA-EESRLRLPKDCNKLEKFASKI-HDVSIG  232 (317)
Q Consensus       176 ---------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~-~~~~~g  232 (317)
                                           ..+.++|+++.....  ............. .........++..+..++.++ +...||
T Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~v~~~~il~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~F~~~a~~~s~d~~s~~~gg  319 (408)
T 1m5y_A          242 GVGFHILKVNDLRGESKNISVTEVHARHILLKPSPI--MTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGG  319 (408)
T ss_dssp             TTEEEEEEEEEECCCCCCCCCEEEEEEEEEECCCSS--SCHHHHHHHHHHHHHHHHTTSSCHHHHHHHHCCCTTTGGGTT
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCCC--CCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCHHHCC
T ss_conf             542799999987621001333202034444148776--333899999999999987263238999998288955042057


Q ss_pred             CCCCCCHHHCCHHHHH-HCCCCCCCCCCCEEECCEEEEEEEECCCCCCC-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             4675275561367665-11245788012376389489999822357884-457899999999999999999999999997
Q gi|254780396|r  233 KAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEYIAICDKRDLGG-EIALKAYLSAQNTPTKIEKHEAEYVKKLRS  310 (317)
Q Consensus       233 ~lg~~~~~~l~~~~~~-~~~~~~G~is~pv~t~~G~hiikv~~~r~~~~-~~~~~~~i~~~l~~~~~~~~~~~~l~~Lr~  310 (317)
                      ++||+..+.++|.|.. ++.+++|++|+||+|++|||||+|+++++... +...++.|+..|.+++..+.+..|+++||+
T Consensus       320 ~lg~~~~~~~~~~~~~ai~~l~~G~is~pv~t~~G~hii~v~~~~~~~~~~~~~~~~i~~~l~~~k~~~~~~~~l~~lr~  399 (408)
T 1m5y_A          320 DLGWATPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNRKFSEEAASWMQEQRA  399 (408)
T ss_dssp             EEEEECGGGSCHHHHHHHHTCCTTCBCCCEECSSCEEEEEEEEEEECC--------HHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHCCCCCCCCCCEECCCEEEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             56667745478899999981899990874783884899999874068887465799999999999999999999999984


Q ss_pred             HCCCCCC
Q ss_conf             5477509
Q gi|254780396|r  311 NAIIHYY  317 (317)
Q Consensus       311 ~A~I~~f  317 (317)
                      +|.|++.
T Consensus       400 ~a~I~i~  406 (408)
T 1m5y_A          400 SAYVKIL  406 (408)
T ss_dssp             HSCEEEC
T ss_pred             CCEEEEE
T ss_conf             5928873



>2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A Back     alignment and structure
>3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, NYSGXRC,11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2itk_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; PIN1, isomerase, WW domain; HET: D11 NAL PE4; 1.45A {Homo sapiens} SCOP: b.72.1.1 d.26.1.1 PDB: 2q5a_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 1f8a_B* 3kad_A* 3kaf_A* 2zr6_A* 1nmv_A 1pin_A* 2zr4_A* 2zr5_A* 2zqt_A* 2zqs_A* 2zqv_A* 2zqu_A 2f21_A* 1zcn_A* ... Back     alignment and structure
>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Back     alignment and structure
>1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 Back     alignment and structure
>1eq3_A Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens} SCOP: d.26.1.1 PDB: 1fjd_A Back     alignment and structure
>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Back     alignment and structure
>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Back     alignment and structure
>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Back     alignment and structure
>2nsa_A Trigger factor, TF; chaperone; 1.70A {Thermotoga maritima} Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 317 peptidyl-prolyl cis-trans isomerase protein [Candidatus
d1m5ya1173 a.223.1.2 (A:25-164,A:395-427) Porin chaperone SurA, pe 7e-10
>d1m5ya1 a.223.1.2 (A:25-164,A:395-427) Porin chaperone SurA, peptide-binding domain {Escherichia coli [TaxId: 562]} Length = 173 Back     information, alignment and structure

class: All alpha proteins
fold: Triger factor/SurA peptide-binding domain-like
superfamily: Triger factor/SurA peptide-binding domain-like
family: Porin chaperone SurA, peptide-binding domain
domain: Porin chaperone SurA, peptide-binding domain
species: Escherichia coli [TaxId: 562]
 Score = 58.6 bits (141), Expect = 7e-10
 Identities = 24/172 (13%), Positives = 61/172 (35%), Gaps = 11/172 (6%)

Query: 41  RIRTTINGEVITDGDISKRIALLKLQKIN--------GELEKIAVQELIVETLKKQEIEK 92
           ++   +N  V+ + D+   +  +KL              L    ++ LI++ +  Q  +K
Sbjct: 3   KVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQK 62

Query: 93  SGITFDSNTVNYFFVQHARNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDF 152
            G+      ++      A+   ++ +   S L   G+  N ++  +  + I  +V  N+ 
Sbjct: 63  MGVKISDEQLDQAIANIAKQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEV 122

Query: 153 MLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKLQNQGFVQKRIKD 204
             +   L  E+   +   + +     ++    FS        +      +K 
Sbjct: 123 RRRITILPQEV---ESLAQQVDRAYRMLMNRKFSEEAASWMQEQRASAYVKI 171


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target317 peptidyl-prolyl cis-trans isomerase protein [Candidatus
d1m5ya1173 Porin chaperone SurA, peptide-binding domain {Escherich 99.87
d1w26a1185 Trigger factor, C-terminal domain {Escherichia coli [Ta 92.39
d1pina2119 Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [ 99.55
d1m5ya3108 Porin chaperone SurA, PPIase domains {Escherichia coli 99.54
d2pv2a1103 Porin chaperone SurA, PPIase domains {Escherichia coli 99.54
d1j6ya_120 Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidops 99.44
d1eq3a_96 Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} 99.36
d1jnsa_92 Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562] 99.43
>d1m5ya1 a.223.1.2 (A:25-164,A:395-427) Porin chaperone SurA, peptide-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Triger factor/SurA peptide-binding domain-like
superfamily: Triger factor/SurA peptide-binding domain-like
family: Porin chaperone SurA, peptide-binding domain
domain: Porin chaperone SurA, peptide-binding domain
species: Escherichia coli [TaxId: 562]
Probab=99.87  E-value=1.3e-21  Score=152.74  Aligned_cols=133  Identities=17%  Similarity=0.296  Sum_probs=121.7

Q ss_pred             CCCEEEEECCEECCHHHHHHHHHHHHHHC--------CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
Q ss_conf             48269998867868899999999987303--------5035999999999999999864200122344456689999999
Q gi|254780396|r   39 SSRIRTTINGEVITDGDISKRIALLKLQK--------INGELEKIAVQELIVETLKKQEIEKSGITFDSNTVNYFFVQHA  110 (317)
Q Consensus        39 ~~~vvA~Vng~~It~~e~~~~~~~~~~~~--------~~~~~~~~~l~~LI~~~l~~~~a~~~~i~v~~~~i~~~i~~~~  110 (317)
                      .|+|||+|||++||.+|+++++.+...+.        ....+++++|+.||+++|+.++|++.|+.+++.+++..+..++
T Consensus         1 VD~VvA~Vn~~~It~~dl~~~~~~~~~~~~~~~~~~~~~~~l~~~vl~~LI~~~Ll~q~a~~~~i~vs~~ev~~~i~~~~   80 (173)
T d1m5ya1           1 VDKVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIA   80 (173)
T ss_dssp             CCCEEEEESSSEEEHHHHHHHHHHHHHHHHTTTCCCCCHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHH
T ss_pred             CCEEEEEECCEEECHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             97389988998577999999999999998753577984247999999999999999999987044589999999999999


Q ss_pred             HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             7313430356777765311245546999999899999999843203555899986443211
Q gi|254780396|r  111 RNTGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMK  171 (317)
Q Consensus       111 ~~~~~~~~~~~~~l~~~g~t~~~~~~~i~~~l~~~~~~~~~~~~~i~~~~~e~~~~~~~~~  171 (317)
                      .+++++.+.|.++|.++|+++..|++.++.+++|++++...+.+++.+|+.++..+|....
T Consensus        81 ~~~~~~~~~f~~~L~~~g~~~~~~~~~ir~~l~~~~l~~~~v~~~i~Vt~~Ei~~~~~~~~  141 (173)
T d1m5ya1          81 KQNNMTLDQMRSRLAYDGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVD  141 (173)
T ss_dssp             HHTTCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHTCCCCTTHHHHHHHCCC
T ss_pred             HHCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHH
T ss_conf             8858989999999987399899999999999999999999831689869999999999887



>d1w26a1 a.223.1.1 (A:248-432) Trigger factor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Back     information, alignment and structure
>d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target317 peptidyl-prolyl cis-trans isomerase protein [Candidatus
2itk_A_167 Peptidyl-prolyl CIS-trans isomerase NIMA- interact 99.53
1j6y_A_139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN 99.5
3gpk_A_112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rot 99.45
2pv1_A_103 Chaperone SURA; surviVal protein A, peptidyl-proly 99.45
1m5y_A_149-258110 SurviVal protein, surviVal protein SURA; surviVal 99.43
1m5y_A_259-369111 SurviVal protein, surviVal protein SURA; surviVal 99.43
2jzv_A_111 Foldase protein PRSA; ppiase, parvulin, proline is 99.39
1yw5_A_62-177116 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 99.32
2kgj_A_102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isom 99.24
1zk6_A_93 Foldase protein PRSA; alpha/beta structure, isomer 99.1
1jns_A_92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta 99.28
1eq3_A_96 Peptidyl-prolyl CIS/trans isomerase (ppiase); parv 99.02
1m5y_A_1-70_401-40878 SurviVal protein, surviVal protein SURA; surviVal 98.94
1m5y_A_71-132_370-40093 SurviVal protein, surviVal protein SURA; surviVal 98.72
1zxj_A_218 MPN555, hypothetical protein Mg377 homolog; mostly 92.85
2nsa_A_170 Trigger factor, TF; chaperone; 1.70A {Thermotoga m 98.14
1t11_A_121-151_258-392166 Trigger factor, TF; helix-turn-helix, four-helix-b 90.99
>2itk_A (A:) Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; PIN1, isomerase, WW domain; HET: D11 NAL PE4; 1.45A {Homo sapiens} Back     alignment and structure
Probab=99.53  E-value=7.1e-17  Score=125.20  Aligned_cols=162  Identities=9%  Similarity=-0.006  Sum_probs=112.2

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCCC
Q ss_conf             13430356777765311245546999999899999999843203555899986443211100110023332210246754
Q gi|254780396|r  113 TGLSAEDFSSFLDKQGIGDNHFKQYLAIQSIWPDVVKNDFMLKYGNLEMEIPANKQKMKNITVREYLIRTVLFSIPDNKL  192 (317)
Q Consensus       113 ~~~~~~~~~~~l~~~g~t~~~~~~~i~~~l~~~~~~~~~~~~~i~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  192 (317)
                      +++..+.+...+...+++...+++.++..+.+..+........+..+...+...+..........+...+..+..+....
T Consensus         3 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (167)
T 2itk_A            3 HGMADEEKLPPGWEKAMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKI   82 (167)
T ss_dssp             --------CCTTEEEEECTTTCCEEEEETTTCCEESSCCC------------CCSCEEEEEEEECCTTSSSCCCSSCSSC
T ss_pred             CCCCCCCCCCCCCEEEECCCCCCEEEEECCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCC
T ss_conf             88888889998848988288895788726776377663256653334543333554443321476326567744233332


Q ss_pred             CC-HHHHHHHHHHHHHHHHHHHHHHHH-HHHHHCCCCCCCCCCCCCCCHHHCCHHHHH-HCCCCCCCCCCCEEECCEEEE
Q ss_conf             44-799998643578865223324899-998520132256874675275561367665-112457880123763894899
Q gi|254780396|r  193 QN-QGFVQKRIKDAEESRLRLPKDCNK-LEKFASKIHDVSIGKAQYLLESDLHPQFQN-LLKKSQNNTTNPYVTQKGVEY  269 (317)
Q Consensus       193 ~~-~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~g~lg~~~~~~l~~~~~~-~~~~~~G~is~pv~t~~G~hi  269 (317)
                      .. .......+............+... +..++.+++...||++||+..++++|.|.+ ++++++|++|+||+|++||||
T Consensus        83 ~~~~~~~~~~a~~~~~~l~~g~~f~~~aa~~~s~~~sa~~gG~lg~~~~~~l~~~~~~~~~~l~~Geis~pi~t~~G~~i  162 (167)
T 2itk_A           83 TRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHI  162 (167)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHTSSCHHHHHHHHCSSGGGGGTTEEEEECTTSSCHHHHHHHHHSCTTCBCCCEEETTEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCCCCCCHHHCCCCCCCCCHHHHHHHHCCCCCCCCCCEECCCCEEE
T ss_conf             00299999999999998750212499999870778543322011135434346999999981899983787886991799


Q ss_pred             EEEEC
Q ss_conf             99822
Q gi|254780396|r  270 IAICD  274 (317)
Q Consensus       270 ikv~~  274 (317)
                      |+|+|
T Consensus       163 ikv~d  167 (167)
T 2itk_A          163 ILRTE  167 (167)
T ss_dssp             EEECC
T ss_pred             EEEEC
T ss_conf             99949



>1j6y_A (A:) Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} Back     alignment and structure
>3gpk_A (A:) PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, NYSGXRC,11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2pv1_A (A:) Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} Back     alignment and structure
>1m5y_A (A:149-258) SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} Back     alignment and structure
>1m5y_A (A:259-369) SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} Back     alignment and structure
>2jzv_A (A:) Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Back     alignment and structure
>1yw5_A (A:62-177) Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>2kgj_A (A:) Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Back     alignment and structure
>1zk6_A (A:) Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Back     alignment and structure
>1jns_A (A:) Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} Back     alignment and structure
>1eq3_A (A:) Peptidyl-prolyl CIS/trans isomerase (ppiase); parvulin; NMR {Homo sapiens} Back     alignment and structure
>1m5y_A (A:1-70,A:401-408) SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} Back     alignment and structure
>1m5y_A (A:71-132,A:370-400) SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} Back     alignment and structure
>1zxj_A (A:) MPN555, hypothetical protein Mg377 homolog; mostly alpha helical protein, TRI-lobal structure, structural genomics, PSI; 2.80A {Mycoplasma pneumoniae} Back     alignment and structure
>2nsa_A (A:) Trigger factor, TF; chaperone; 1.70A {Thermotoga maritima} Back     alignment and structure
>1t11_A (A:121-151,A:258-392) Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} Back     alignment and structure